F441422

General Info

Members Datasets Scaffolds Average Seq Length
427 244 427 416

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100152658|Ga0070712_1001526582
Length 471
Sequence VENGERLSLEQIRAFLKAADEVRFKAGKRGEVYAWISRTLCEQEYWKQSKESKGVLRRYLQKMTGLSRSQVTRLIAGYIREGTVREQSYRRNRFANRYTASDIELLAEVDEAHESLSGPATRKILQRELEQYGDRRYERLAGISVAHLYNLRKSRAYREKRLRYQKTRPVPIAIGERRRPDPRGRPGYLRVDTVHQGDLEGVKGVYHINAVDEVTQWQVVGASPQIGEKWLLPVLEAMLEQFPFRLLGFHSDNGSEFINHAVAKLLNKLLAEQTKSRPRHSNDNGLVEAKNGAVIRKHIGYGYIDSSNADAIMLFYREHFNPYLNFHRPCGVPETTIDRKGKQHRVYRRYATPWELLQEAPEFRRHLKAGLAAEGLQRVVLHAAIPRPRVSCRKPNASCLRDYGVNGAHEDSCGNDRLWTRRKTDGRFPCAPTAFGNRCAIPTFPQLRRAAAKWKALSYKFPELENQNKEA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
68 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
69 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
70 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
71 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
104 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
125 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
130 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 2.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.17
Rhizosphere 93.21
Stem 0
Stem Tuber 0
Unclassified 5.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1932015 2162886007 Bacteria 1678
2 SwRhRL2b_contig_2998736 2162886007 Bacteria 1571
3 rootH2_10175071 3300003320 Bacteria 3735
4 Ga0070670_100004732 3300005331 Bacteria 11422
5 Ga0070666_10062772 3300005335 Bacteria 2518
6 Ga0070680_100126603 3300005336 Unclassified 2135
7 Ga0070703_10022956 3300005406 Bacteria 1834
8 Ga0070709_10083866 3300005434 Bacteria 2086
9 Ga0070709_10085378 3300005434 Bacteria 2070
10 Ga0070709_10107611 3300005434 Unclassified 1869
11 Ga0070709_10112519 3300005434 Unclassified 1832
12 Ga0070713_100193078 3300005436 Bacteria 1836
13 Ga0070713_100215851 3300005436 Bacteria 1739
14 Ga0070710_10126879 3300005437 Bacteria 1551
15 Ga0070711_100132046 3300005439 Unclassified 1861
16 Ga0070711_100215513 3300005439 Unclassified 1489
17 Ga0070711_100225444 3300005439 Unclassified 1459
18 Ga0070711_100260862 3300005439 Bacteria 1363
19 Ga0070694_100173693 3300005444 Bacteria 1589
20 Ga0070708_100105846 3300005445 Bacteria 2581
21 Ga0070708_100140825 3300005445 Bacteria 2236
22 Ga0070708_100173583 3300005445 Bacteria 2014
23 Ga0070708_100203877 3300005445 Unclassified 1852
24 Ga0070708_100253568 3300005445 Bacteria 1653
25 Ga0070681_10232833 3300005458 Unclassified 1756
26 Ga0068867_100042756 3300005459 Bacteria 3316
27 Ga0068867_100126527 3300005459 Bacteria 1981
28 Ga0070706_100360229 3300005467 Bacteria 1355
29 Ga0070707_100172638 3300005468 Bacteria 2107
30 Ga0070698_100249745 3300005471 Bacteria 1707
31 Ga0070698_100256562 3300005471 Bacteria 1681
32 Ga0070699_100177905 3300005518 Unclassified 1887
33 Ga0070699_100179285 3300005518 Bacteria 1880
34 Ga0070699_100310830 3300005518 Bacteria 1415
35 Ga0070679_100311039 3300005530 Unclassified 1525
36 Ga0070684_100294613 3300005535 Unclassified 1488
37 Ga0070697_100149762 3300005536 Bacteria 1966
38 Ga0068853_100205752 3300005539 Unclassified 1792
39 Ga0068859_100162753 3300005617 Bacteria 2310
40 Ga0068859_100299792 3300005617 Unclassified 1700
41 Ga0068864_100102926 3300005618 Bacteria 2535
42 Ga0068863_100139913 3300005841 Bacteria 2313
43 Ga0068863_100164251 3300005841 Bacteria 2129
44 Ga0068863_100274917 3300005841 Bacteria 1631
45 Ga0068863_100281631 3300005841 Bacteria 1611
46 Ga0068860_100093313 3300005843 Bacteria 2869
47 Ga0070717_10145093 3300006028 Unclassified 2050
48 Ga0070717_10211580 3300006028 Bacteria 1702
49 Ga0070717_10256897 3300006028 Bacteria 1545
50 Ga0070717_10260624 3300006028 Bacteria 1534
51 Ga0070715_10058775 3300006163 Bacteria 1680
52 Ga0070716_100116288 3300006173 Unclassified 1666
53 Ga0070712_100133122 3300006175 Bacteria 1887
54 Ga0070712_100152658 3300006175 Bacteria 1775
55 Ga0097621_100118814 3300006237 Bacteria 2241
56 Ga0097621_100162975 3300006237 Bacteria 1918
57 Ga0097621_100243937 3300006237 Unclassified 1571
58 Ga0068871_100086721 3300006358 Bacteria 2601
59 Ga0068871_100164742 3300006358 Bacteria 1897
60 Ga0075428_100250331 3300006844 Bacteria 1910
61 Ga0075429_100260166 3300006880 Bacteria 1519
62 Ga0097620_100162758 3300006931 Bacteria 2310
63 Ga0097620_100299786 3300006931 Unclassified 1700
64 Ga0075435_100050873 3300007076 Bacteria 3335
65 Ga0075435_100157245 3300007076 Bacteria 1913
66 Ga0099795_10025588 3300007788 Bacteria 1980
67 Ga0105240_10203522 3300009093 Bacteria 2318
68 Ga0105240_10326886 3300009093 Unclassified 1746
69 Ga0105240_10381264 3300009093 Bacteria 1592
70 Ga0111539_10074348 3300009094 Unclassified 4003
71 Ga0105245_10188481 3300009098 Bacteria 1974
72 Ga0105245_10192781 3300009098 Bacteria 1953
73 Ga0105247_10123131 3300009101 Unclassified 1682
74 Ga0114129_10268911 3300009147 Bacteria 2281
75 Ga0105241_10074079 3300009174 Bacteria 2651
76 Ga0105242_10067213 3300009176 Bacteria 2963
77 Ga0105242_10179697 3300009176 Bacteria 1866
78 Ga0105242_10276005 3300009176 Unclassified 1525
79 Ga0105248_10277209 3300009177 Bacteria 1888
80 Ga0105248_10404346 3300009177 Bacteria 1537
81 Ga0105237_10016381 3300009545 Bacteria 7705
82 Ga0105237_10205011 3300009545 Unclassified 1972
83 Ga0105238_10276376 3300009551 Unclassified 1660
84 Ga0105249_10047900 3300009553 Bacteria 3896
85 Ga0105239_10122856 3300010375 Bacteria 2885
86 Ga0105239_10338016 3300010375 Unclassified 1699
87 Ga0105239_10353253 3300010375 Unclassified 1660
88 Ga0105239_10465274 3300010375 Unclassified 1435
89 Ga0105246_10130501 3300011119 Bacteria 1876
90 Ga0157370_10248406 3300013104 Bacteria 1646
91 Ga0157369_10315916 3300013105 Bacteria 1624
92 Ga0157374_10054552 3300013296 Bacteria 3729
93 Ga0157374_10088750 3300013296 Unclassified 2945
94 Ga0157374_10130654 3300013296 Bacteria 2430
95 Ga0157374_10220871 3300013296 Unclassified 1859
96 Ga0157378_10122168 3300013297 Bacteria 2402
97 Ga0163162_10180286 3300013306 Bacteria 2238
98 Ga0157372_10108411 3300013307 Unclassified 3178
99 Ga0157372_10302840 3300013307 Bacteria 1859
100 Ga0157372_10394541 3300013307 Unclassified 1613
101 Ga0157375_10168934 3300013308 Bacteria 2334
102 Ga0157375_10255231 3300013308 Bacteria 1915
103 Ga0163163_10262527 3300014325 Bacteria 1778
104 Ga0163163_10314550 3300014325 Bacteria 1619
105 Ga0157380_10129084 3300014326 Bacteria 2154
106 Ga0157379_10162900 3300014968 Bacteria 2013
107 Ga0157376_10071266 3300014969 Bacteria 2953
108 Ga0157376_10138323 3300014969 Bacteria 2182
109 Ga0157376_10186822 3300014969 Bacteria 1898
110 Ga0163161_10161034 3300017792 Bacteria 1711
111 Ga0213873_10020883 3300021358 Bacteria 1534
112 Ga0213874_10031000 3300021377 Bacteria 1544
113 Ga0213876_10019268 3300021384 Bacteria 3603
114 Ga0213876_10025900 3300021384 Bacteria 3093
115 Ga0213876_10055087 3300021384 Bacteria 2099
116 Ga0213876_10098411 3300021384 Unclassified 1550
117 Ga0213875_10020688 3300021388 Bacteria 3157
118 Ga0213875_10022335 3300021388 Bacteria 3027
119 Ga0213875_10050944 3300021388 Bacteria 1939
120 Ga0224569_100419 3300022732 Bacteria 3623
121 Ga0224571_101463 3300022734 Unclassified 1479
122 Ga0228600_1002487 3300024123 Unclassified 1365
123 Ga0224572_1012920 3300024225 Unclassified 1591
124 Ga0224572_1013177 3300024225 Unclassified 1575
125 Ga0207653_10033768 3300025885 Bacteria 1660
126 Ga0207680_10116968 3300025903 Bacteria 1738
127 Ga0207680_10121110 3300025903 Bacteria 1711
128 Ga0207685_10049881 3300025905 Bacteria 1610
129 Ga0207699_10041526 3300025906 Bacteria 2657
130 Ga0207699_10091613 3300025906 Bacteria 1909
131 Ga0207699_10105331 3300025906 Unclassified 1798
132 Ga0207684_10130474 3300025910 Bacteria 2157
133 Ga0207684_10248621 3300025910 Bacteria 1534
134 Ga0207654_10082504 3300025911 Bacteria 1939
135 Ga0207707_10174688 3300025912 Unclassified 1877
136 Ga0207707_10238514 3300025912 Unclassified 1581
137 Ga0207695_10200843 3300025913 Bacteria 1908
138 Ga0207671_10170509 3300025914 Unclassified 1690
139 Ga0207693_10127098 3300025915 Bacteria 2004
140 Ga0207693_10173736 3300025915 Bacteria 1696
141 Ga0207663_10074577 3300025916 Bacteria 2199
142 Ga0207663_10114819 3300025916 Unclassified 1834
143 Ga0207660_10138457 3300025917 Bacteria 1859
144 Ga0207660_10154749 3300025917 Unclassified 1764
145 Ga0207652_10263528 3300025921 Unclassified 1555
146 Ga0207646_10259569 3300025922 Bacteria 1570
147 Ga0207646_10358512 3300025922 Unclassified 1317
148 Ga0207687_10139543 3300025927 Bacteria 1837
149 Ga0207700_10234609 3300025928 Bacteria 1561
150 Ga0207664_10243860 3300025929 Unclassified 1566
151 Ga0207664_10255713 3300025929 Bacteria 1530
152 Ga0207706_10206314 3300025933 Bacteria 1723
153 Ga0207686_10066930 3300025934 Unclassified 2296
154 Ga0207686_10108287 3300025934 Bacteria 1869
155 Ga0207665_10104467 3300025939 Bacteria 1983
156 Ga0207665_10110600 3300025939 Bacteria 1930
157 Ga0207711_10160952 3300025941 Bacteria 2032
158 Ga0207711_10186743 3300025941 Bacteria 1887
159 Ga0207711_10268833 3300025941 Bacteria 1568
160 Ga0207661_10208724 3300025944 Unclassified 1720
161 Ga0207667_10244114 3300025949 Unclassified 1838
162 Ga0207712_10092023 3300025961 Bacteria 2235
163 Ga0207658_10012605 3300025986 Bacteria 5772
164 Ga0207658_10167312 3300025986 Bacteria 1807
165 Ga0207658_10225127 3300025986 Bacteria 1580
166 Ga0207677_10085300 3300026023 Bacteria 2279
167 Ga0207703_10338523 3300026035 Bacteria 1382
168 Ga0207639_10109041 3300026041 Unclassified 2252
169 Ga0207641_10154226 3300026088 Bacteria 2083
170 Ga0207641_10160085 3300026088 Bacteria 2046
171 Ga0207641_10263890 3300026088 Bacteria 1613
172 Ga0207641_10283842 3300026088 Unclassified 1558
173 Ga0207648_10106990 3300026089 Unclassified 2454
174 Ga0207648_10123994 3300026089 Bacteria 2272
175 Ga0207676_10255488 3300026095 Bacteria 1579
176 Ga0207674_10012515 3300026116 Bacteria 9478
177 Ga0265354_1003319 3300028016 Unclassified 1817
178 Ga0265354_1003358 3300028016 Bacteria 1802
179 Ga0265354_1003590 3300028016 Bacteria 1719
180 Ga0265357_1001256 3300028023 Bacteria 1811
181 Ga0268264_10078876 3300028381 Bacteria 2808
182 Ga0265318_10039174 3300028577 Bacteria 1809
183 Ga0265338_10120594 3300028800 Bacteria 2091
184 Ga0265338_10148559 3300028800 Bacteria 1824
185 Ga0265762_1006487 3300030760 Bacteria 2093
186 Ga0265763_1001536 3300030763 Bacteria 1660
187 Ga0265770_1001839 3300030878 Unclassified 2887
188 Ga0265770_1005942 3300030878 Bacteria 1689
189 Ga0265765_1002536 3300030879 Bacteria 1777
190 Ga0265760_10012781 3300031090 Unclassified 2402
191 Ga0265760_10014909 3300031090 Unclassified 2228
192 Ga0265760_10027232 3300031090 Unclassified 1675
193 Ga0265760_10028446 3300031090 Bacteria 1640
194 Ga0265760_10028590 3300031090 Bacteria 1636
195 Ga0265332_10051759 3300031238 Bacteria 1763
196 Ga0265340_10063843 3300031247 Bacteria 1756
197 Ga0265339_10076143 3300031249 Bacteria 1780
198 Ga0265327_10054103 3300031251 Bacteria 2079
199 Ga0265316_10069150 3300031344 Bacteria 2725
200 Ga0265316_10110914 3300031344 Bacteria 2077
201 Ga0265316_10116423 3300031344 Unclassified 2020
202 Ga0265316_10160972 3300031344 Bacteria 1678
203 Ga0265316_10224200 3300031344 Unclassified 1386
204 Ga0307408_100219263 3300031548 Unclassified 1551
205 Ga0265314_10004785 3300031711 Bacteria 12403
206 Ga0265314_10120282 3300031711 Bacteria 1654
207 Ga0265342_10090255 3300031712 Bacteria 1757
208 Ga0307412_10159827 3300031911 Unclassified 1672
209 Ga0307409_100254407 3300031995 Bacteria 1608
210 Ga0307414_10154529 3300032004 Unclassified 1814
211 Ga0316585_10033699 3300032137 Unclassified 1616
212 Ga0316212_1007300 3300033547 Bacteria 1596
213 Ga0373934_0025624 3300035086 Bacteria 2285
214 Ga0373923_0014723 3300035111 Plasmid 2943
215 Ga0373936_0031098 3300035113 Unclassified 2107
216 Ga0373939_0041168 3300035114 Unclassified 1391
217 Ga0373945_0020884 3300035116 Unclassified 2245
218 Ga0373953_0006189 3300035117 Bacteria 3932
219 Ga0373954_0066376 3300035118 Unclassified 1708
220 Ga0373954_0077599 3300035118 Bacteria 1584
221 Ga0373954_0079365 3300035118 Bacteria 1567
222 Ga0373956_0032059 3300035119 Unclassified 2305
223 Ga0373956_0033951 3300035119 Bacteria 2245
224 Ga0373957_0019679 3300035120 Unclassified 2378
225 Ga0373957_0038574 3300035120 Bacteria 1789
226 Ga0373943_0009511 3300035170 Bacteria 4356
227 Ga0373946_0027311 3300035171 Unclassified 2256
228 Ga0373955_0065404 3300035172 Unclassified 2018
229 Ga0373955_0102008 3300035172 Unclassified 1648
230 Ga0373942_0012793 3300035207 Bacteria 2009
231 Ga0373924_0032571 3300035410 Unclassified 2100
232 Ga0373924_0053334 3300035410 Bacteria 1679
233 Ga0373931_0049042 3300035691 Bacteria 2240
234 Ga0373931_0093113 3300035691 Unclassified 1682
235 Ga0373935_0110359 3300035692 Bacteria 1825
236 Ga0373935_0110946 3300035692 Bacteria 1821
237 Ga0373935_0138767 3300035692 Bacteria 1640
238 Ga0373927_0027533 3300035695 Bacteria 3710
239 Ga0373927_0095117 3300035695 Unclassified 1936
240 Ga0373927_0114191 3300035695 Bacteria 1760
241 Ga0373927_0211821 3300035695 Bacteria 1273
242 Ga0373933_0098965 3300035724 Bacteria 1807
243 Ga0373933_0102203 3300035724 Bacteria 1779
244 Ga0373933_0119938 3300035724 Unclassified 1646
245 Ga0373947_0056654 3300035725 Bacteria 2369
246 Ga0373947_0110724 3300035725 Unclassified 1735
247 Ga0373937_0114591 3300036401 Bacteria 2509
248 Ga0373937_0144869 3300036401 Bacteria 2223
249 Ga0373937_0174473 3300036401 Bacteria 2017
250 Ga0373937_0240080 3300036401 Unclassified 1707
251 Ga0373937_0269563 3300036401 Unclassified 1606
252 Ga0373925_0036267 3300037068 Bacteria 3639
253 Ga0373925_0067263 3300037068 Bacteria 2702
254 Ga0373925_0184229 3300037068 Bacteria 1654
255 Ga0373925_0330514 3300037068 Bacteria 1235
256 Ga0436364_0045342 3300037853 Unclassified 1513
257 Ga0436364_0384177 3300037853 Bacteria 2350
258 Ga0436364_0575157 3300037853 Bacteria 27092
259 Ga0436364_1017487 3300037853 Bacteria 2013
260 Ga0436364_1179334 3300037853 Bacteria 1895
261 Ga0436365_0062341 3300039437 Bacteria 2239
262 Ga0436365_0969408 3300039437 Bacteria 4236
263 Ga0436365_1175062 3300039437 Bacteria 4314
264 Ga0436365_1442571 3300039437 Bacteria 2372
265 Ga0436365_1526143 3300039437 Bacteria 1815
266 Ga0436360_1249497 3300039438 Bacteria 1986
267 Ga0436361_0055779 3300039447 Unclassified 1784
268 Ga0436363_0070903 3300039450 Unclassified 2348
269 Ga0436363_0541950 3300039450 Bacteria 1571
270 Ga0436363_1622816 3300039450 Bacteria 1737
271 Ga0436362_0165090 3300039453 Bacteria 1711
272 Ga0451577_0195100 3300042876 Unclassified 1827
273 Ga0453683_0066927 3300044673 Bacteria 2245
274 Ga0466963_0169955 3300044694 Unclassified 1519
275 Ga0453684_0268384 3300044712 Bacteria 1951
276 Ga0451576_0206206 3300045051 Bacteria 2053
277 Ga0466967_0165463 3300045976 Unclassified 2078
278 Ga0495592_0137939 3300046454 Bacteria 1699
279 Ga0495592_0180109 3300046454 Bacteria 1440
280 Ga0495651_0179985 3300046462 Unclassified 1497
281 Ga0495580_0101719 3300046472 Unclassified 1998
282 Ga0495580_0110053 3300046472 Bacteria 1913
283 Ga0495580_0122058 3300046472 Bacteria 1808
284 Ga0495580_0175094 3300046472 Bacteria 1482
285 Ga0495580_0196116 3300046472 Bacteria 1392
286 Ga0495582_0078498 3300046473 Bacteria 1831
287 Ga0495605_0042756 3300046474 Bacteria 2250
288 Ga0495639_0043990 3300046475 Bacteria 2018
289 Ga0495664_0011019 3300046477 Bacteria 5086
290 Ga0495664_0066101 3300046477 Bacteria 2156
291 Ga0495664_0145017 3300046477 Bacteria 1439
292 Ga0495584_0077624 3300046491 Bacteria 1670
293 Ga0495594_0077232 3300046499 Unclassified 1857
294 Ga0495607_0096607 3300046501 Bacteria 1590
295 Ga0495608_0119033 3300046511 Unclassified 1694
296 Ga0495616_0077001 3300046513 Bacteria 1602
297 Ga0495618_0069597 3300046514 Unclassified 2237
298 Ga0495628_0111789 3300046516 Bacteria 2100
299 Ga0495630_0241220 3300046517 Unclassified 1381
300 Ga0495663_0026540 3300046525 Bacteria 1696
301 Ga0495666_0085870 3300046526 Bacteria 1486
302 Ga0495642_0042840 3300046528 Bacteria 1845
303 Ga0495642_0049693 3300046528 Bacteria 1723
304 Ga0495642_0052260 3300046528 Unclassified 1682
305 Ga0495652_0125638 3300046529 Bacteria 2038
306 Ga0495652_0189755 3300046529 Bacteria 1569
307 Ga0495665_0035477 3300046531 Bacteria 2664
308 Ga0495665_0058567 3300046531 Unclassified 2034
309 Ga0495665_0077902 3300046531 Unclassified 1744
310 Ga0495665_0093963 3300046531 Bacteria 1575
311 Ga0495640_0070069 3300046533 Unclassified 2357
312 Ga0495586_0076596 3300046535 Unclassified 1833
313 Ga0495586_0078665 3300046535 Unclassified 1809
314 Ga0495587_0070759 3300046536 Bacteria 2030
315 Ga0495645_0043074 3300046543 Bacteria 3292
316 Ga0495645_0117901 3300046543 Bacteria 1872
317 Ga0495645_0121598 3300046543 Bacteria 1837
318 Ga0495633_0055265 3300046558 Bacteria 1866
319 Ga0495667_0069791 3300046559 Unclassified 2293
320 Ga0495667_0104267 3300046559 Bacteria 1833
321 Ga0495634_0075582 3300046642 Bacteria 2212
322 Ga0495611_0043729 3300046648 Bacteria 2003
323 Ga0495611_0046942 3300046648 Bacteria 1937
324 Ga0495611_0062680 3300046648 Bacteria 1691
325 Ga0495635_0062310 3300046663 Bacteria 2561
326 Ga0495635_0093569 3300046663 Unclassified 2055
327 Ga0495635_0131198 3300046663 Bacteria 1708
328 Ga0495635_0168608 3300046663 Bacteria 1489
329 Ga0495659_0026901 3300046664 Bacteria 1980
330 Ga0495659_0034647 3300046664 Bacteria 1776
331 Ga0495588_0082421 3300046674 Unclassified 1680
332 Ga0495657_0066647 3300046675 Unclassified 2365
333 Ga0495599_0102598 3300046678 Bacteria 1782
334 Ga0495599_0121488 3300046678 Bacteria 1623
335 Ga0495623_0056887 3300046679 Unclassified 2461
336 Ga0495623_0114389 3300046679 Unclassified 1631
337 Ga0495646_0057434 3300046680 Bacteria 2329
338 Ga0495646_0096032 3300046680 Bacteria 1704
339 Ga0495647_0061006 3300046681 Unclassified 1488
340 Ga0495624_0108404 3300046690 Bacteria 1708
341 Ga0495670_0077165 3300046691 Bacteria 1693
342 Ga0495604_0096131 3300047317 Unclassified 2187
343 Ga0495604_0123960 3300047317 Bacteria 1866
344 Ga0495674_0002996 3300047319 Bacteria 16452
345 Ga0495674_0034566 3300047319 Unclassified 4571
346 Ga0495674_0095882 3300047319 Bacteria 2529
347 Ga0495674_0125883 3300047319 Bacteria 2162
348 Ga0495676_0150731 3300047321 Unclassified 1655
349 Ga0495675_0090947 3300047444 Unclassified 1915
350 Ga0495675_0093403 3300047444 Bacteria 1887
351 Ga0495675_0152675 3300047444 Bacteria 1426
352 Ga0495675_0167598 3300047444 Bacteria 1350
353 Ga0495685_044075 3300047447 Unclassified 1522
354 Ga0495684_0037437 3300047471 Unclassified 3720
355 Ga0495684_0056985 3300047471 Bacteria 2978
356 Ga0495684_0066941 3300047471 Bacteria 2731
357 Ga0495684_0172178 3300047471 Unclassified 1609
358 Ga0495593_0067987 3300047673 Bacteria 1854
359 Ga0495593_0080319 3300047673 Bacteria 1687
360 Ga0495602_0101047 3300048088 Bacteria 2366
361 Ga0495602_0105658 3300048088 Unclassified 2300
362 Ga0495602_0177354 3300048088 Bacteria 1647
363 Ga0495614_0046004 3300048089 Bacteria 1871
364 Ga0496104_0126303 3300048907 Bacteria 2456
365 Ga0496108_0210389 3300048911 Unclassified 1688
366 Ga0496109_0396721 3300048912 Bacteria 1303
367 Ga0496112_0221744 3300048915 Bacteria 1847
368 Ga0496112_0271789 3300048915 Unclassified 1643
369 Ga0501031_0086942 3300049568 Unclassified 2038
370 Ga0501031_0120197 3300049568 Bacteria 1716
371 Ga0501033_0137969 3300049570 Unclassified 1764
372 Ga0501036_0086394 3300049572 Bacteria 2651
373 Ga0501036_0153326 3300049572 Bacteria 1943
374 Ga0501037_0157168 3300049573 Unclassified 1622
375 Ga0501038_0165538 3300049574 Bacteria 1794
376 Ga0501038_0193591 3300049574 Unclassified 1635
377 Ga0501039_0228311 3300049575 Bacteria 1463
378 Ga0501040_0057899 3300049576 Unclassified 2661
379 Ga0501040_0117033 3300049576 Bacteria 1867
380 Ga0501041_0112454 3300049577 Unclassified 1689
381 Ga0501042_0113667 3300049578 Unclassified 1949
382 Ga0501042_0176095 3300049578 Unclassified 1543
383 Ga0501046_0056790 3300049580 Bacteria 3071
384 Ga0501046_0157395 3300049580 Bacteria 1710
385 Ga0501048_0082914 3300049582 Bacteria 2261
386 Ga0501048_0124373 3300049582 Bacteria 1823
387 Ga0501048_0138096 3300049582 Bacteria 1723
388 Ga0501070_0211096 3300049586 Unclassified 1593
389 Ga0501070_0228726 3300049586 Bacteria 1524
390 Ga0501071_0156345 3300049587 Unclassified 1702
391 Ga0501071_0193131 3300049587 Bacteria 1527
392 Ga0501072_0201808 3300049588 Unclassified 1585
393 Ga0501072_0238206 3300049588 Unclassified 1449
394 Ga0501072_0247249 3300049588 Bacteria 1420
395 Ga0501074_0149777 3300049590 Unclassified 1668
396 Ga0501075_0094492 3300049591 Bacteria 2269
397 Ga0501075_0160621 3300049591 Unclassified 1714
398 Ga0501075_0189541 3300049591 Bacteria 1568
399 Ga0501076_0114177 3300049592 Bacteria 2185
400 Ga0501076_0148738 3300049592 Unclassified 1904
401 Ga0501077_0136530 3300049593 Unclassified 1555
402 Ga0501079_0115493 3300049741 Bacteria 2086
403 Ga0501079_0160777 3300049741 Bacteria 1751
404 Ga0501079_0196547 3300049741 Bacteria 1574
405 Ga0501080_0215567 3300049742 Unclassified 1758
406 Ga0501081_0101488 3300049743 Bacteria 2034
407 Ga0501081_0130185 3300049743 Bacteria 1797
408 Ga0501081_0167899 3300049743 Bacteria 1583
409 Ga0501273_004325 3300049770 Bacteria 1555
410 Ga0501035_0225796 3300049822 Unclassified 1597
411 Ga0501044_0289113 3300049823 Unclassified 1571
412 Ga0501045_0094073 3300049824 Unclassified 2216
413 Ga0501045_0211260 3300049824 Bacteria 1445
414 nmdc:mga05p37_103512_c1 3300050507 Bacteria 3504
415 nmdc:mga09592_174267_c1 3300050508 Bacteria 1860
416 nmdc:mga0rr50_157241_c1 3300050513 Bacteria 1842
417 nmdc:mga0rr50_195533_c1 3300050513 Unclassified 1660
418 nmdc:mga0a205_240103_c1 3300050515 Bacteria 1693
419 nmdc:mga0a205_246643_c1 3300050515 Bacteria 1666
420 Ga0495601_0085620 3300053077 Bacteria 2025
421 Ga0495595_0059947 3300053084 Unclassified 1780
422 Ga0495619_0130219 3300053085 Bacteria 1728
423 Ga0501084_0088835 3300054114 Bacteria 2594
424 Ga0501084_0237697 3300054114 Bacteria 1538
425 Ga0501082_0081675 3300060353 Unclassified 2789
426 Ga0501082_0216210 3300060353 Unclassified 1667
427 Ga0530510_0070942 3300061734 Bacteria 2528

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0330514 Ga0373925_0330514_48_1088 339
2 3300048912 Ga0496109_0396721 Ga0496109_0396721_72_1280 347
3 3300039450 Ga0436363_0541950 Ga0436363_0541950_20_1156 370
4 3300006028 Ga0070717_10256897 Ga0070717_102568971 372
5 3300046648 Ga0495611_0043729 Ga0495611_0043729_459_1688 378
6 3300039437 Ga0436365_0969408 Ga0436365_0969408_138_1361 381
7 3300039447 Ga0436361_0055779 Ga0436361_0055779_362_1597 385
8 3300022734 Ga0224571_101463 Ga0224571_1014631 387
9 3300024225 Ga0224572_1012920 Ga0224572_10129201 387
10 3300005434 Ga0070709_10112519 Ga0070709_101125191 388
11 3300005439 Ga0070711_100132046 Ga0070711_1001320461 388
12 3300025906 Ga0207699_10105331 Ga0207699_101053311 388
13 3300025916 Ga0207663_10114819 Ga0207663_101148192 388
14 3300021384 Ga0213876_10098411 Ga0213876_100984112 389
15 3300039437 Ga0436365_1526143 Ga0436365_1526143_386_1609 389
16 3300005437 Ga0070710_10126879 Ga0070710_101268791 390
17 3300005459 Ga0068867_100042756 Ga0068867_1000427563 391
18 3300005841 Ga0068863_100139913 Ga0068863_1001399133 391
19 3300005843 Ga0068860_100093313 Ga0068860_1000933132 391
20 3300006237 Ga0097621_100162975 Ga0097621_1001629751 391
21 3300006358 Ga0068871_100164742 Ga0068871_1001647421 391
22 3300009093 Ga0105240_10203522 Ga0105240_102035222 391
23 3300009176 Ga0105242_10067213 Ga0105242_100672132 391
24 3300009553 Ga0105249_10047900 Ga0105249_100479003 391
25 3300010375 Ga0105239_10122856 Ga0105239_101228563 391
26 3300010375 Ga0105239_10353253 Ga0105239_103532532 391
27 3300013296 Ga0157374_10088750 Ga0157374_100887502 391
28 3300014969 Ga0157376_10138323 Ga0157376_101383232 391
29 3300025903 Ga0207680_10116968 Ga0207680_101169681 391
30 3300025913 Ga0207695_10200843 Ga0207695_102008432 391
31 3300025934 Ga0207686_10108287 Ga0207686_101082872 391
32 3300025961 Ga0207712_10092023 Ga0207712_100920232 391
33 3300025986 Ga0207658_10167312 Ga0207658_101673121 391
34 3300026023 Ga0207677_10085300 Ga0207677_100853001 391
35 3300026088 Ga0207641_10154226 Ga0207641_101542262 391
36 3300026089 Ga0207648_10123994 Ga0207648_101239942 391
37 3300028381 Ga0268264_10078876 Ga0268264_100788762 391
38 3300035114 Ga0373939_0041168 Ga0373939_0041168_39_1289 391
39 3300035207 Ga0373942_0012793 Ga0373942_0012793_526_1776 391
40 3300035691 Ga0373931_0049042 Ga0373931_0049042_811_2061 391
41 3300046472 Ga0495580_0110053 Ga0495580_0110053_556_1785 391
42 3300046531 Ga0495665_0077902 Ga0495665_0077902_240_1466 392
43 3300005434 Ga0070709_10083866 Ga0070709_100838661 393
44 3300025906 Ga0207699_10091613 Ga0207699_100916131 393
45 3300035695 Ga0373927_0211821 Ga0373927_0211821_21_1202 393
46 3300046528 Ga0495642_0052260 Ga0495642_0052260_231_1460 394
47 3300047447 Ga0495685_044075 Ga0495685_044075_237_1466 394
48 3300035118 Ga0373954_0079365 Ga0373954_0079365_326_1555 397
49 3300028577 Ga0265318_10039174 Ga0265318_100391742 399
50 3300031251 Ga0265327_10054103 Ga0265327_100541032 399
51 3300045051 Ga0451576_0206206 Ga0451576_0206206_488_1729 399
52 3300005445 Ga0070708_100203877 Ga0070708_1002038771 400
53 3300006028 Ga0070717_10260624 Ga0070717_102606241 401
54 3300032004 Ga0307414_10154529 Ga0307414_101545291 401
55 3300035725 Ga0373947_0110724 Ga0373947_0110724_491_1717 401
56 3300046499 Ga0495594_0077232 Ga0495594_0077232_521_1747 401
57 3300046535 Ga0495586_0078665 Ga0495586_0078665_440_1666 401
58 3300046674 Ga0495588_0082421 Ga0495588_0082421_356_1582 401
59 3300046681 Ga0495647_0061006 Ga0495647_0061006_125_1351 401
60 3300047321 Ga0495676_0150731 Ga0495676_0150731_191_1417 401
61 3300021388 Ga0213875_10050944 Ga0213875_100509441 402
62 3300037853 Ga0436364_0384177 Ga0436364_0384177_617_1858 402
63 3300005444 Ga0070694_100173693 Ga0070694_1001736931 403
64 3300005445 Ga0070708_100105846 Ga0070708_1001058463 403
65 3300005468 Ga0070707_100172638 Ga0070707_1001726382 403
66 3300005471 Ga0070698_100249745 Ga0070698_1002497451 403
67 3300005617 Ga0068859_100162753 Ga0068859_1001627532 403
68 3300006844 Ga0075428_100250331 Ga0075428_1002503312 403
69 3300006880 Ga0075429_100260166 Ga0075429_1002601662 403
70 3300006931 Ga0097620_100162758 Ga0097620_1001627582 403
71 3300009147 Ga0114129_10268911 Ga0114129_102689111 403
72 3300025922 Ga0207646_10358512 Ga0207646_103585121 403
73 3300047444 Ga0495675_0090947 Ga0495675_0090947_526_1899 403
74 3300049770 Ga0501273_004325 Ga0501273_004325_10_1455 403
75 3300050513 nmdc:mga0rr50_195533_c1 nmdc:mga0rr50_195533_c1_206_1417 403
76 3300049578 Ga0501042_0176095 Ga0501042_0176095_99_1343 406
77 3300049582 Ga0501048_0138096 Ga0501048_0138096_204_1448 406
78 3300049588 Ga0501072_0238206 Ga0501072_0238206_51_1295 406
79 3300049591 Ga0501075_0189541 Ga0501075_0189541_136_1380 406
80 3300049741 Ga0501079_0196547 Ga0501079_0196547_176_1420 406
81 3300049743 Ga0501081_0130185 Ga0501081_0130185_216_1460 406
82 3300054114 Ga0501084_0237697 Ga0501084_0237697_242_1486 406
83 3300005331 Ga0070670_100004732 Ga0070670_1000047326 407
84 3300005336 Ga0070680_100126603 Ga0070680_1001266031 407
85 3300005406 Ga0070703_10022956 Ga0070703_100229561 407
86 3300005436 Ga0070713_100215851 Ga0070713_1002158512 407
87 3300005439 Ga0070711_100260862 Ga0070711_1002608621 407
88 3300005445 Ga0070708_100140825 Ga0070708_1001408252 407
89 3300005458 Ga0070681_10232833 Ga0070681_102328331 407
90 3300005467 Ga0070706_100360229 Ga0070706_1003602291 407
91 3300005518 Ga0070699_100179285 Ga0070699_1001792851 407
92 3300005530 Ga0070679_100311039 Ga0070679_1003110391 407
93 3300005539 Ga0068853_100205752 Ga0068853_1002057521 407
94 3300006028 Ga0070717_10211580 Ga0070717_102115802 407
95 3300006173 Ga0070716_100116288 Ga0070716_1001162881 407
96 3300006175 Ga0070712_100133122 Ga0070712_1001331222 407
97 3300006237 Ga0097621_100243937 Ga0097621_1002439371 407
98 3300007076 Ga0075435_100050873 Ga0075435_1000508734 407
99 3300009093 Ga0105240_10326886 Ga0105240_103268861 407
100 3300009101 Ga0105247_10123131 Ga0105247_101231311 407
101 3300009174 Ga0105241_10074079 Ga0105241_100740792 407
102 3300009176 Ga0105242_10276005 Ga0105242_102760051 407
103 3300009545 Ga0105237_10205011 Ga0105237_102050111 407
104 3300009551 Ga0105238_10276376 Ga0105238_102763762 407
105 3300010375 Ga0105239_10338016 Ga0105239_103380162 407
106 3300010375 Ga0105239_10465274 Ga0105239_104652741 407
107 3300013104 Ga0157370_10248406 Ga0157370_102484061 407
108 3300013105 Ga0157369_10315916 Ga0157369_103159161 407
109 3300013296 Ga0157374_10054552 Ga0157374_100545523 407
110 3300013296 Ga0157374_10220871 Ga0157374_102208711 407
111 3300013307 Ga0157372_10108411 Ga0157372_101084112 407
112 3300013307 Ga0157372_10394541 Ga0157372_103945412 407
113 3300022732 Ga0224569_100419 Ga0224569_1004192 407
114 3300024123 Ga0228600_1002487 Ga0228600_10024871 407
115 3300024225 Ga0224572_1013177 Ga0224572_10131771 407
116 3300025885 Ga0207653_10033768 Ga0207653_100337681 407
117 3300025910 Ga0207684_10248621 Ga0207684_102486211 407
118 3300025912 Ga0207707_10238514 Ga0207707_102385141 407
119 3300025914 Ga0207671_10170509 Ga0207671_101705091 407
120 3300025915 Ga0207693_10173736 Ga0207693_101737361 407
121 3300025917 Ga0207660_10154749 Ga0207660_101547492 407
122 3300025921 Ga0207652_10263528 Ga0207652_102635282 407
123 3300025922 Ga0207646_10259569 Ga0207646_102595691 407
124 3300025928 Ga0207700_10234609 Ga0207700_102346092 407
125 3300025929 Ga0207664_10243860 Ga0207664_102438601 407
126 3300025934 Ga0207686_10066930 Ga0207686_100669301 407
127 3300025939 Ga0207665_10104467 Ga0207665_101044671 407
128 3300025949 Ga0207667_10244114 Ga0207667_102441141 407
129 3300025986 Ga0207658_10012605 Ga0207658_100126054 407
130 3300026041 Ga0207639_10109041 Ga0207639_101090411 407
131 3300026116 Ga0207674_10012515 Ga0207674_100125158 407
132 3300028016 Ga0265354_1003358 Ga0265354_10033582 407
133 3300030878 Ga0265770_1001839 Ga0265770_10018392 407
134 3300031090 Ga0265760_10027232 Ga0265760_100272321 407
135 3300036401 Ga0373937_0240080 Ga0373937_0240080_160_1395 407
136 3300037068 Ga0373925_0184229 Ga0373925_0184229_25_1275 407
137 3300046528 Ga0495642_0049693 Ga0495642_0049693_203_1450 407
138 3300046690 Ga0495624_0108404 Ga0495624_0108404_310_1560 407
139 3300048089 Ga0495614_0046004 Ga0495614_0046004_209_1459 407
140 3300049586 Ga0501070_0211096 Ga0501070_0211096_256_1479 407
141 3300049586 Ga0501070_0228726 Ga0501070_0228726_186_1409 407
142 3300049742 Ga0501080_0215567 Ga0501080_0215567_349_1572 407
143 3300049823 Ga0501044_0289113 Ga0501044_0289113_210_1433 407
144 3300005434 Ga0070709_10107611 Ga0070709_101076112 408
145 3300005439 Ga0070711_100225444 Ga0070711_1002254441 408
146 3300005535 Ga0070684_100294613 Ga0070684_1002946131 408
147 3300006028 Ga0070717_10145093 Ga0070717_101450932 408
148 3300009093 Ga0105240_10381264 Ga0105240_103812641 408
149 3300011119 Ga0105246_10130501 Ga0105246_101305012 408
150 3300013307 Ga0157372_10302840 Ga0157372_103028401 408
151 3300021358 Ga0213873_10020883 Ga0213873_100208832 408
152 3300021384 Ga0213876_10019268 Ga0213876_100192682 408
153 3300021384 Ga0213876_10025900 Ga0213876_100259002 408
154 3300021384 Ga0213876_10055087 Ga0213876_100550872 408
155 3300021388 Ga0213875_10020688 Ga0213875_100206883 408
156 3300021388 Ga0213875_10022335 Ga0213875_100223352 408
157 3300025906 Ga0207699_10041526 Ga0207699_100415261 408
158 3300025911 Ga0207654_10082504 Ga0207654_100825041 408
159 3300025912 Ga0207707_10174688 Ga0207707_101746881 408
160 3300025916 Ga0207663_10074577 Ga0207663_100745772 408
161 3300025917 Ga0207660_10138457 Ga0207660_101384571 408
162 3300025929 Ga0207664_10255713 Ga0207664_102557132 408
163 3300025944 Ga0207661_10208724 Ga0207661_102087242 408
164 3300026035 Ga0207703_10338523 Ga0207703_103385231 408
165 3300028800 Ga0265338_10120594 Ga0265338_101205942 408
166 3300031249 Ga0265339_10076143 Ga0265339_100761431 408
167 3300031344 Ga0265316_10069150 Ga0265316_100691501 408
168 3300031344 Ga0265316_10116423 Ga0265316_101164232 408
169 3300031344 Ga0265316_10160972 Ga0265316_101609722 408
170 3300031344 Ga0265316_10224200 Ga0265316_102242001 408
171 3300031711 Ga0265314_10004785 Ga0265314_100047857 408
172 3300031711 Ga0265314_10120282 Ga0265314_101202822 408
173 3300031995 Ga0307409_100254407 Ga0307409_1002544071 408
174 3300035086 Ga0373934_0025624 Ga0373934_0025624_488_1714 408
175 3300035111 Ga0373923_0014723 Ga0373923_0014723_897_2123 408
176 3300035113 Ga0373936_0031098 Ga0373936_0031098_284_1510 408
177 3300035116 Ga0373945_0020884 Ga0373945_0020884_112_1338 408
178 3300035117 Ga0373953_0006189 Ga0373953_0006189_1652_2878 408
179 3300035118 Ga0373954_0066376 Ga0373954_0066376_240_1466 408
180 3300035119 Ga0373956_0033951 Ga0373956_0033951_353_1579 408
181 3300035120 Ga0373957_0019679 Ga0373957_0019679_1051_2277 408
182 3300035170 Ga0373943_0009511 Ga0373943_0009511_1809_3035 408
183 3300035171 Ga0373946_0027311 Ga0373946_0027311_783_2009 408
184 3300035172 Ga0373955_0102008 Ga0373955_0102008_175_1401 408
185 3300035410 Ga0373924_0032571 Ga0373924_0032571_392_1618 408
186 3300035692 Ga0373935_0138767 Ga0373935_0138767_227_1453 408
187 3300035695 Ga0373927_0027533 Ga0373927_0027533_2252_3478 408
188 3300035695 Ga0373927_0095117 Ga0373927_0095117_357_1607 408
189 3300035724 Ga0373933_0098965 Ga0373933_0098965_86_1312 408
190 3300035724 Ga0373933_0119938 Ga0373933_0119938_306_1532 408
191 3300035725 Ga0373947_0056654 Ga0373947_0056654_116_1342 408
192 3300036401 Ga0373937_0144869 Ga0373937_0144869_333_1559 408
193 3300036401 Ga0373937_0269563 Ga0373937_0269563_241_1467 408
194 3300037068 Ga0373925_0036267 Ga0373925_0036267_1852_3078 408
195 3300037853 Ga0436364_0045342 Ga0436364_0045342_88_1326 408
196 3300037853 Ga0436364_0575157 Ga0436364_0575157_18588_19817 408
197 3300037853 Ga0436364_1179334 Ga0436364_1179334_134_1378 408
198 3300039437 Ga0436365_0062341 Ga0436365_0062341_772_2010 408
199 3300039437 Ga0436365_1175062 Ga0436365_1175062_1379_2608 408
200 3300039437 Ga0436365_1442571 Ga0436365_1442571_947_2185 408
201 3300039453 Ga0436362_0165090 Ga0436362_0165090_330_1556 408
202 3300044712 Ga0453684_0268384 Ga0453684_0268384_575_1801 408
203 3300046462 Ga0495651_0179985 Ga0495651_0179985_169_1395 408
204 3300046472 Ga0495580_0101719 Ga0495580_0101719_361_1587 408
205 3300046472 Ga0495580_0175094 Ga0495580_0175094_137_1363 408
206 3300046501 Ga0495607_0096607 Ga0495607_0096607_63_1454 408
207 3300046511 Ga0495608_0119033 Ga0495608_0119033_354_1580 408
208 3300046517 Ga0495630_0241220 Ga0495630_0241220_42_1268 408
209 3300046531 Ga0495665_0058567 Ga0495665_0058567_590_1816 408
210 3300046531 Ga0495665_0093963 Ga0495665_0093963_135_1361 408
211 3300046535 Ga0495586_0076596 Ga0495586_0076596_413_1639 408
212 3300046536 Ga0495587_0070759 Ga0495587_0070759_354_1580 408
213 3300046559 Ga0495667_0069791 Ga0495667_0069791_586_1812 408
214 3300046648 Ga0495611_0062680 Ga0495611_0062680_136_1527 408
215 3300046663 Ga0495635_0093569 Ga0495635_0093569_346_1596 408
216 3300046663 Ga0495635_0131198 Ga0495635_0131198_120_1346 408
217 3300046675 Ga0495657_0066647 Ga0495657_0066647_285_1511 408
218 3300046679 Ga0495623_0114389 Ga0495623_0114389_157_1383 408
219 3300047317 Ga0495604_0096131 Ga0495604_0096131_666_1892 408
220 3300047319 Ga0495674_0034566 Ga0495674_0034566_3227_4453 408
221 3300047319 Ga0495674_0125883 Ga0495674_0125883_671_1897 408
222 3300047444 Ga0495675_0093403 Ga0495675_0093403_433_1659 408
223 3300047471 Ga0495684_0056985 Ga0495684_0056985_1549_2799 408
224 3300047471 Ga0495684_0172178 Ga0495684_0172178_116_1342 408
225 3300047673 Ga0495593_0067987 Ga0495593_0067987_154_1380 408
226 3300048088 Ga0495602_0101047 Ga0495602_0101047_716_1942 408
227 3300049568 Ga0501031_0086942 Ga0501031_0086942_427_1689 408
228 3300049570 Ga0501033_0137969 Ga0501033_0137969_287_1549 408
229 3300049572 Ga0501036_0086394 Ga0501036_0086394_425_1687 408
230 3300049573 Ga0501037_0157168 Ga0501037_0157168_266_1528 408
231 3300049574 Ga0501038_0193591 Ga0501038_0193591_198_1460 408
232 3300049576 Ga0501040_0057899 Ga0501040_0057899_331_1593 408
233 3300049577 Ga0501041_0112454 Ga0501041_0112454_144_1406 408
234 3300049578 Ga0501042_0113667 Ga0501042_0113667_560_1822 408
235 3300049580 Ga0501046_0056790 Ga0501046_0056790_48_1310 408
236 3300049582 Ga0501048_0124373 Ga0501048_0124373_329_1591 408
237 3300049587 Ga0501071_0156345 Ga0501071_0156345_109_1371 408
238 3300049588 Ga0501072_0201808 Ga0501072_0201808_228_1490 408
239 3300049590 Ga0501074_0149777 Ga0501074_0149777_247_1509 408
240 3300049591 Ga0501075_0094492 Ga0501075_0094492_597_1859 408
241 3300049592 Ga0501076_0148738 Ga0501076_0148738_410_1672 408
242 3300049593 Ga0501077_0136530 Ga0501077_0136530_102_1364 408
243 3300049741 Ga0501079_0115493 Ga0501079_0115493_491_1753 408
244 3300049743 Ga0501081_0101488 Ga0501081_0101488_435_1697 408
245 3300049822 Ga0501035_0225796 Ga0501035_0225796_248_1510 408
246 3300049824 Ga0501045_0094073 Ga0501045_0094073_565_1827 408
247 3300050515 nmdc:mga0a205_240103_c1 nmdc:mga0a205_240103_c1_213_1463 408
248 3300054114 Ga0501084_0088835 Ga0501084_0088835_419_1681 408
249 3300060353 Ga0501082_0216210 Ga0501082_0216210_306_1568 408
250 3300061734 Ga0530510_0070942 Ga0530510_0070942_419_1681 408
251 2162886007 SwRhRL2b_contig_1932015 SwRhRL2b_0169.00001810 409
252 2162886007 SwRhRL2b_contig_2998736 SwRhRL2b_0354.00009250 409
253 3300003320 rootH2_10175071 rootH2_101750712 409
254 3300005335 Ga0070666_10062772 Ga0070666_100627721 409
255 3300005434 Ga0070709_10085378 Ga0070709_100853782 409
256 3300005436 Ga0070713_100193078 Ga0070713_1001930782 409
257 3300005439 Ga0070711_100215513 Ga0070711_1002155131 409
258 3300005445 Ga0070708_100173583 Ga0070708_1001735831 409
259 3300005445 Ga0070708_100253568 Ga0070708_1002535681 409
260 3300005459 Ga0068867_100126527 Ga0068867_1001265271 409
261 3300005471 Ga0070698_100256562 Ga0070698_1002565622 409
262 3300005518 Ga0070699_100177905 Ga0070699_1001779051 409
263 3300005518 Ga0070699_100310830 Ga0070699_1003108301 409
264 3300005536 Ga0070697_100149762 Ga0070697_1001497622 409
265 3300005617 Ga0068859_100299792 Ga0068859_1002997922 409
266 3300005618 Ga0068864_100102926 Ga0068864_1001029262 409
267 3300005841 Ga0068863_100164251 Ga0068863_1001642512 409
268 3300005841 Ga0068863_100274917 Ga0068863_1002749171 409
269 3300005841 Ga0068863_100281631 Ga0068863_1002816311 409
270 3300006163 Ga0070715_10058775 Ga0070715_100587751 409
271 3300006175 Ga0070712_100152658 Ga0070712_1001526582 409
272 3300006237 Ga0097621_100118814 Ga0097621_1001188142 409
273 3300006358 Ga0068871_100086721 Ga0068871_1000867211 409
274 3300006931 Ga0097620_100299786 Ga0097620_1002997862 409
275 3300007076 Ga0075435_100157245 Ga0075435_1001572452 409
276 3300007788 Ga0099795_10025588 Ga0099795_100255881 409
277 3300009094 Ga0111539_10074348 Ga0111539_100743484 409
278 3300009098 Ga0105245_10188481 Ga0105245_101884812 409
279 3300009098 Ga0105245_10192781 Ga0105245_101927811 409
280 3300009176 Ga0105242_10179697 Ga0105242_101796972 409
281 3300009177 Ga0105248_10277209 Ga0105248_102772092 409
282 3300009177 Ga0105248_10404346 Ga0105248_104043461 409
283 3300009545 Ga0105237_10016381 Ga0105237_100163811 409
284 3300013296 Ga0157374_10130654 Ga0157374_101306542 409
285 3300013297 Ga0157378_10122168 Ga0157378_101221682 409
286 3300013306 Ga0163162_10180286 Ga0163162_101802862 409
287 3300013308 Ga0157375_10168934 Ga0157375_101689342 409
288 3300013308 Ga0157375_10255231 Ga0157375_102552311 409
289 3300014325 Ga0163163_10262527 Ga0163163_102625271 409
290 3300014325 Ga0163163_10314550 Ga0163163_103145501 409
291 3300014326 Ga0157380_10129084 Ga0157380_101290842 409
292 3300014968 Ga0157379_10162900 Ga0157379_101629002 409
293 3300014969 Ga0157376_10071266 Ga0157376_100712661 409
294 3300014969 Ga0157376_10186822 Ga0157376_101868221 409
295 3300017792 Ga0163161_10161034 Ga0163161_101610341 409
296 3300021377 Ga0213874_10031000 Ga0213874_100310002 409
297 3300025903 Ga0207680_10121110 Ga0207680_101211101 409
298 3300025905 Ga0207685_10049881 Ga0207685_100498811 409
299 3300025910 Ga0207684_10130474 Ga0207684_101304742 409
300 3300025915 Ga0207693_10127098 Ga0207693_101270982 409
301 3300025927 Ga0207687_10139543 Ga0207687_101395431 409
302 3300025933 Ga0207706_10206314 Ga0207706_102063142 409
303 3300025939 Ga0207665_10110600 Ga0207665_101106002 409
304 3300025941 Ga0207711_10160952 Ga0207711_101609522 409
305 3300025941 Ga0207711_10186743 Ga0207711_101867431 409
306 3300025941 Ga0207711_10268833 Ga0207711_102688331 409
307 3300025986 Ga0207658_10225127 Ga0207658_102251272 409
308 3300026088 Ga0207641_10160085 Ga0207641_101600852 409
309 3300026088 Ga0207641_10263890 Ga0207641_102638902 409
310 3300026088 Ga0207641_10283842 Ga0207641_102838421 409
311 3300026089 Ga0207648_10106990 Ga0207648_101069902 409
312 3300026095 Ga0207676_10255488 Ga0207676_102554881 409
313 3300028016 Ga0265354_1003319 Ga0265354_10033191 409
314 3300028016 Ga0265354_1003590 Ga0265354_10035902 409
315 3300028023 Ga0265357_1001256 Ga0265357_10012561 409
316 3300028800 Ga0265338_10148559 Ga0265338_101485591 409
317 3300030760 Ga0265762_1006487 Ga0265762_10064872 409
318 3300030763 Ga0265763_1001536 Ga0265763_10015362 409
319 3300030878 Ga0265770_1005942 Ga0265770_10059421 409
320 3300030879 Ga0265765_1002536 Ga0265765_10025361 409
321 3300031090 Ga0265760_10012781 Ga0265760_100127812 409
322 3300031090 Ga0265760_10014909 Ga0265760_100149092 409
323 3300031090 Ga0265760_10028446 Ga0265760_100284461 409
324 3300031090 Ga0265760_10028590 Ga0265760_100285901 409
325 3300031238 Ga0265332_10051759 Ga0265332_100517591 409
326 3300031247 Ga0265340_10063843 Ga0265340_100638431 409
327 3300031344 Ga0265316_10110914 Ga0265316_101109141 409
328 3300031548 Ga0307408_100219263 Ga0307408_1002192632 409
329 3300031712 Ga0265342_10090255 Ga0265342_100902552 409
330 3300031911 Ga0307412_10159827 Ga0307412_101598271 409
331 3300032137 Ga0316585_10033699 Ga0316585_100336992 409
332 3300033547 Ga0316212_1007300 Ga0316212_10073001 409
333 3300035118 Ga0373954_0077599 Ga0373954_0077599_75_1478 409
334 3300035119 Ga0373956_0032059 Ga0373956_0032059_543_1772 409
335 3300035120 Ga0373957_0038574 Ga0373957_0038574_226_1455 409
336 3300035172 Ga0373955_0065404 Ga0373955_0065404_430_1659 409
337 3300035410 Ga0373924_0053334 Ga0373924_0053334_331_1560 409
338 3300035691 Ga0373931_0093113 Ga0373931_0093113_146_1552 409
339 3300035692 Ga0373935_0110359 Ga0373935_0110359_443_1684 409
340 3300035692 Ga0373935_0110946 Ga0373935_0110946_108_1337 409
341 3300035695 Ga0373927_0114191 Ga0373927_0114191_362_1603 409
342 3300035724 Ga0373933_0102203 Ga0373933_0102203_230_1459 409
343 3300036401 Ga0373937_0114591 Ga0373937_0114591_560_1963 409
344 3300036401 Ga0373937_0174473 Ga0373937_0174473_679_1908 409
345 3300037068 Ga0373925_0067263 Ga0373925_0067263_959_2200 409
346 3300037853 Ga0436364_1017487 Ga0436364_1017487_269_1498 409
347 3300039438 Ga0436360_1249497 Ga0436360_1249497_563_1792 409
348 3300039450 Ga0436363_0070903 Ga0436363_0070903_678_1919 409
349 3300039450 Ga0436363_1622816 Ga0436363_1622816_227_1456 409
350 3300042876 Ga0451577_0195100 Ga0451577_0195100_388_1617 409
351 3300044673 Ga0453683_0066927 Ga0453683_0066927_854_2086 409
352 3300044694 Ga0466963_0169955 Ga0466963_0169955_243_1472 409
353 3300045976 Ga0466967_0165463 Ga0466967_0165463_480_1721 409
354 3300046454 Ga0495592_0137939 Ga0495592_0137939_189_1592 409
355 3300046454 Ga0495592_0180109 Ga0495592_0180109_185_1414 409
356 3300046472 Ga0495580_0122058 Ga0495580_0122058_351_1592 409
357 3300046472 Ga0495580_0196116 Ga0495580_0196116_110_1351 409
358 3300046473 Ga0495582_0078498 Ga0495582_0078498_416_1657 409
359 3300046474 Ga0495605_0042756 Ga0495605_0042756_632_2026 409
360 3300046475 Ga0495639_0043990 Ga0495639_0043990_471_1712 409
361 3300046477 Ga0495664_0011019 Ga0495664_0011019_3271_4674 409
362 3300046477 Ga0495664_0066101 Ga0495664_0066101_405_1811 409
363 3300046477 Ga0495664_0145017 Ga0495664_0145017_160_1389 409
364 3300046491 Ga0495584_0077624 Ga0495584_0077624_92_1486 409
365 3300046513 Ga0495616_0077001 Ga0495616_0077001_72_1466 409
366 3300046514 Ga0495618_0069597 Ga0495618_0069597_586_1989 409
367 3300046516 Ga0495628_0111789 Ga0495628_0111789_474_1880 409
368 3300046525 Ga0495663_0026540 Ga0495663_0026540_257_1651 409
369 3300046526 Ga0495666_0085870 Ga0495666_0085870_119_1360 409
370 3300046528 Ga0495642_0042840 Ga0495642_0042840_108_1502 409
371 3300046529 Ga0495652_0125638 Ga0495652_0125638_568_1971 409
372 3300046529 Ga0495652_0189755 Ga0495652_0189755_191_1420 409
373 3300046531 Ga0495665_0035477 Ga0495665_0035477_398_1639 409
374 3300046533 Ga0495640_0070069 Ga0495640_0070069_417_1820 409
375 3300046543 Ga0495645_0043074 Ga0495645_0043074_382_1788 409
376 3300046543 Ga0495645_0117901 Ga0495645_0117901_137_1540 409
377 3300046543 Ga0495645_0121598 Ga0495645_0121598_436_1665 409
378 3300046558 Ga0495633_0055265 Ga0495633_0055265_305_1699 409
379 3300046559 Ga0495667_0104267 Ga0495667_0104267_282_1685 409
380 3300046642 Ga0495634_0075582 Ga0495634_0075582_152_1555 409
381 3300046648 Ga0495611_0046942 Ga0495611_0046942_408_1637 409
382 3300046663 Ga0495635_0062310 Ga0495635_0062310_1030_2433 409
383 3300046663 Ga0495635_0168608 Ga0495635_0168608_100_1329 409
384 3300046664 Ga0495659_0026901 Ga0495659_0026901_177_1571 409
385 3300046664 Ga0495659_0034647 Ga0495659_0034647_229_1458 409
386 3300046678 Ga0495599_0102598 Ga0495599_0102598_134_1363 409
387 3300046678 Ga0495599_0121488 Ga0495599_0121488_105_1511 409
388 3300046679 Ga0495623_0056887 Ga0495623_0056887_959_2362 409
389 3300046680 Ga0495646_0057434 Ga0495646_0057434_588_1991 409
390 3300046680 Ga0495646_0096032 Ga0495646_0096032_231_1637 409
391 3300046691 Ga0495670_0077165 Ga0495670_0077165_175_1569 409
392 3300047317 Ga0495604_0123960 Ga0495604_0123960_404_1807 409
393 3300047319 Ga0495674_0002996 Ga0495674_0002996_9128_10531 409
394 3300047319 Ga0495674_0095882 Ga0495674_0095882_218_1624 409
395 3300047444 Ga0495675_0152675 Ga0495675_0152675_168_1397 409
396 3300047444 Ga0495675_0167598 Ga0495675_0167598_14_1255 409
397 3300047471 Ga0495684_0037437 Ga0495684_0037437_785_2188 409
398 3300047471 Ga0495684_0066941 Ga0495684_0066941_263_1492 409
399 3300047673 Ga0495593_0080319 Ga0495593_0080319_126_1367 409
400 3300048088 Ga0495602_0105658 Ga0495602_0105658_290_1693 409
401 3300048088 Ga0495602_0177354 Ga0495602_0177354_263_1492 409
402 3300048907 Ga0496104_0126303 Ga0496104_0126303_913_2319 409
403 3300048911 Ga0496108_0210389 Ga0496108_0210389_125_1531 409
404 3300048915 Ga0496112_0221744 Ga0496112_0221744_350_1579 409
405 3300048915 Ga0496112_0271789 Ga0496112_0271789_105_1511 409
406 3300049568 Ga0501031_0120197 Ga0501031_0120197_83_1324 409
407 3300049572 Ga0501036_0153326 Ga0501036_0153326_143_1384 409
408 3300049574 Ga0501038_0165538 Ga0501038_0165538_161_1402 409
409 3300049575 Ga0501039_0228311 Ga0501039_0228311_97_1338 409
410 3300049576 Ga0501040_0117033 Ga0501040_0117033_282_1523 409
411 3300049580 Ga0501046_0157395 Ga0501046_0157395_283_1524 409
412 3300049582 Ga0501048_0082914 Ga0501048_0082914_545_1786 409
413 3300049587 Ga0501071_0193131 Ga0501071_0193131_77_1318 409
414 3300049588 Ga0501072_0247249 Ga0501072_0247249_150_1391 409
415 3300049591 Ga0501075_0160621 Ga0501075_0160621_46_1287 409
416 3300049592 Ga0501076_0114177 Ga0501076_0114177_450_1691 409
417 3300049741 Ga0501079_0160777 Ga0501079_0160777_195_1436 409
418 3300049743 Ga0501081_0167899 Ga0501081_0167899_95_1336 409
419 3300049824 Ga0501045_0211260 Ga0501045_0211260_89_1330 409
420 3300050507 nmdc:mga05p37_103512_c1 nmdc:mga05p37_103512_c1_641_1882 409
421 3300050508 nmdc:mga09592_174267_c1 nmdc:mga09592_174267_c1_248_1477 409
422 3300050513 nmdc:mga0rr50_157241_c1 nmdc:mga0rr50_157241_c1_324_1565 409
423 3300050515 nmdc:mga0a205_246643_c1 nmdc:mga0a205_246643_c1_349_1590 409
424 3300053077 Ga0495601_0085620 Ga0495601_0085620_313_1719 409
425 3300053084 Ga0495595_0059947 Ga0495595_0059947_249_1478 409
426 3300053085 Ga0495619_0130219 Ga0495619_0130219_387_1616 409
427 3300060353 Ga0501082_0081675 Ga0501082_0081675_495_1736 409

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qbv-assembly1.cif.gz_B structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form) 0.6883 185 274
1exq-assembly1.cif.gz_B crystal structure of the hiv-1 integrase catalytic core domain 0.6673 187 276
1exq-assembly1.cif.gz_A crystal structure of the hiv-1 integrase catalytic core domain 0.6629 187 278
6vlm-assembly1.cif.gz_A core catalytic domain of hiv integrase in complex with virtual screening hit 0.6559 187 278
6ex9-assembly1.cif.gz_A-2 crystal structure of hiv-1 integrase catalytic core domain with inhibitor peptide 0.6554 187 273
ID Description Score Start End Superfamily
af_Q9VU22_153_381_3.40.570.10 Alpha Beta;3-Layer(aba) Sandwich;Extracellular Endonuclease; Chain A;Extracellular Endonuclease, subunit A 0.7874 203 222 3.40.570.10
af_P71644_141_290_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7546 186 316 3.30.420.10
af_P9WIQ3_47_324_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7136 326 347 3.50.50.60
af_P71644_141_290_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6671 186 316 3.30.420.10
af_Q47718_102_174_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.649 185 240 3.30.420.10
ID Description Score Start End GO Terms
AF-T1AAK4-F1-model_v4 Integrase, catalytic region 0.9463 296 403
AF-A0A2Z3R1N3-F1-model_v4 Integrase 0.9193 1 111
AF-T1AAK4-F1-model_v4 Integrase, catalytic region 0.9063 296 403
AF-A0A1J4SPV0-F1-model_v4 Integrase catalytic domain-containing protein 0.9053 104 409 GO:0003676
GO:0015074
AF-A0A2H0P6H3-F1-model_v4 Integrase catalytic domain-containing protein 0.891 194 407 GO:0003676
GO:0015074

Feature Viewer

pLDDT pTM Quality
80.55 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map