F441270

General Info

Members Datasets Scaffolds Average Seq Length
426 256 852 272

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0005080|Ga0495594_0005080_3801_4715
Length 304
Sequence MAEAWNRGGALPSQVPGIEDFFQPRPPDGEISHKEPTLPEHSPVDTDSAHSARIYDYILGGTDNYPADREAGDAMVREWPAMPVHMRANRDFMNRAVRYLAGEAGIRQFLDIGSGIPTSPNIHEIAQATAPAARVVYVDNDPLVLALSQGLLDSTPEGRTAYVEADMLDPAAILRAPEFRGTLDAGEPVALTVIAIVHFVLDADDAVGIVRRLLEPLPSGSYLAMSIGTAEFAPDEVGRVAREYAARGMPMRLRTYPEAEEFFAGLELVGPGIVQVHKWRPDGTDTEPIRDADIAMYGAVARKP

Samples

Sample ID Description Type Environment
1 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
15 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
16 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
17 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
18 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
19 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
20 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
23 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
24 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
25 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
26 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
27 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
28 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
29 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
30 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
31 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
32 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
33 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
34 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
35 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
36 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
37 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
38 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
41 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
42 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
43 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
44 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
45 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
46 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
47 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
48 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
49 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
50 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
51 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
52 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
54 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
55 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
56 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
57 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
58 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
59 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
60 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
61 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
62 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
63 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
64 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
65 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
66 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
67 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
68 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
69 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
70 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
71 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
72 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
73 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
74 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
75 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
96 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
105 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
111 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
141 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
148 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
189 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
190 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
191 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
192 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
193 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
194 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
195 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
196 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
197 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
198 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
199 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
200 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
201 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
202 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
203 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
204 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
207 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
208 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
209 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
214 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
215 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
216 2626541554 Frankia sp. AvcI.1 Isolate Nodule
217 2643221578 Streptomyces sp. Root63 Isolate Unclassified
218 2643221647 Streptomyces sp. Root369 Isolate Unclassified
219 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
220 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
221 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
222 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
223 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
224 2808606448 Streptomyces sp. 193411 Isolate Unclassified
225 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
226 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
227 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
228 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
229 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
230 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
231 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
232 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
233 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
234 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
235 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
236 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
237 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
238 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
239 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
240 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
241 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
242 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
243 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
244 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
245 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
246 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
247 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
248 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
249 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
250 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
251 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
252 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
253 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
254 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
255 8054920844 Frankia tisae Agncl-8 Isolate Nodule
256 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.56
Metatranscriptomes 0.47
Isolates 11.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.33
Nodule 1.17
Rhizoplane 0.94
Rhizosphere 71.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495594_0005080 3300046499 Bacteria 6772
2 JGI24737J22298_10029910 3300001990 Bacteria 1706
3 rootH2_10002059 3300003320 Bacteria 5514
4 Ga0006562J51391_1089409 3300003578 Bacteria 2840
5 Ga0070680_100199305 3300005336 Bacteria 1688
6 Ga0070713_100216945 3300005436 Bacteria 1734
7 Ga0070684_100082399 3300005535 Bacteria 2848
8 Ga0068853_100015218 3300005539 Bacteria 6323
9 Ga0068857_100236364 3300005577 Bacteria 1672
10 Ga0081455_10051844 3300005937 Bacteria 3517
11 Ga0081538_10005513 3300005981 Bacteria 11369
12 Ga0081538_10005832 3300005981 Bacteria 10976
13 Ga0075368_10034997 3300006042 Bacteria 1959
14 Ga0075367_10037835 3300006178 Bacteria 2806
15 Ga0105238_10128053 3300009551 Bacteria 2517
16 Ga0105035_107960 3300009988 Bacteria 899
17 Ga0157369_10306357 3300013105 Bacteria 1652
18 Ga0157372_10164270 3300013307 Bacteria 2567
19 Ga0209758_1015940 3300025297 Bacteria 3853
20 Ga0207426_1007274 3300025302 Bacteria 4660
21 Ga0207647_10004639 3300025904 Bacteria 10181
22 Ga0207639_10051892 3300026041 Bacteria 3122
23 Ga0209813_10017415 3300027866 Bacteria 1972
24 Ga0307517_10002312 3300028786 Bacteria 30753
25 Ga0307517_10015618 3300028786 Bacteria 10071
26 Ga0307515_10000939 3300028794 Bacteria 66738
27 Ga0307515_10054137 3300028794 Bacteria 5898
28 Ga0307515_10140296 3300028794 Bacteria 2597
29 Ga0307515_10161283 3300028794 Bacteria 2285
30 Ga0265338_10006156 3300028800 Bacteria 15398
31 Ga0307511_10006355 3300030521 Bacteria 11913
32 Ga0307511_10037678 3300030521 Bacteria 4170
33 Ga0307512_10004407 3300030522 Bacteria 15469
34 Ga0307512_10022119 3300030522 Bacteria 5722
35 Ga0307512_10094294 3300030522 Bacteria 2066
36 Ga0307512_10183634 3300030522 Bacteria 1169
37 Ga0307513_10008427 3300031456 Bacteria 13202
38 Ga0307513_10012700 3300031456 Bacteria 10370
39 Ga0307513_10033388 3300031456 Bacteria 5785
40 Ga0307513_10035513 3300031456 Bacteria 5575
41 Ga0307513_10084768 3300031456 Bacteria 3253
42 Ga0307509_10008727 3300031507 Bacteria 12827
43 Ga0307509_10129278 3300031507 Bacteria 2485
44 Ga0307509_10304583 3300031507 Bacteria 1339
45 Ga0307408_100099997 3300031548 Bacteria 2208
46 Ga0307408_100229223 3300031548 Bacteria 1520
47 Ga0307508_10002588 3300031616 Bacteria 19024
48 Ga0307508_10007362 3300031616 Bacteria 10254
49 Ga0307508_10014415 3300031616 Bacteria 7210
50 Ga0307508_10018454 3300031616 Bacteria 6339
51 Ga0307508_10048852 3300031616 Bacteria 3768
52 Ga0307508_10203314 3300031616 Bacteria 1581
53 Ga0307508_10265013 3300031616 Bacteria 1312
54 Ga0307514_10002659 3300031649 Bacteria 18151
55 Ga0307514_10026663 3300031649 Bacteria 4673
56 Ga0307514_10043000 3300031649 Bacteria 3550
57 Ga0307514_10116543 3300031649 Bacteria 1876
58 Ga0307514_10167220 3300031649 Bacteria 1444
59 Ga0307516_10062451 3300031730 Bacteria 3610
60 Ga0307516_10081627 3300031730 Bacteria 3076
61 Ga0307405_10000585 3300031731 Bacteria 13954
62 Ga0307405_10014810 3300031731 Bacteria 4205
63 Ga0307413_10147024 3300031824 Bacteria 1637
64 Ga0307406_10007578 3300031901 Bacteria 6026
65 Ga0307412_10207513 3300031911 Bacteria 1492
66 Ga0307409_100004766 3300031995 Bacteria 7688
67 Ga0307409_100012975 3300031995 Bacteria 5337
68 Ga0307416_100000505 3300032002 Bacteria 19894
69 Ga0307416_100001516 3300032002 Bacteria 12668
70 Ga0307415_100000017 3300032126 Bacteria 71738
71 Ga0307415_100000141 3300032126 Bacteria 31863
72 Ga0307507_10003693 3300033179 Bacteria 28918
73 Ga0307507_10027766 3300033179 Bacteria 6054
74 Ga0307510_10057048 3300033180 Bacteria 4058
75 Ga0307510_10057188 3300033180 Bacteria 4050
76 Ga0307510_10071378 3300033180 Bacteria 3458
77 Ga0316214_1000299 3300033545 Bacteria 4756
78 Ga0316212_1015489 3300033547 Bacteria 1077
79 Ga0373940_0031145 3300035088 Bacteria 1422
80 Ga0373953_0084497 3300035117 Bacteria 1323
81 Ga0373956_0084181 3300035119 Bacteria 1462
82 Ga0373942_0000076 3300035207 Bacteria 21156
83 Ga0373933_0013148 3300035724 Bacteria 4584
84 Ga0373937_0049769 3300036401 Bacteria 3837
85 Ga0372808_015982 3300036459 Bacteria 1074
86 Ga0373925_0152656 3300037068 Bacteria 1814
87 Ga0395900_0146629 3300037418 Bacteria 2413
88 Ga0395898_0004551 3300037466 Bacteria 15135
89 Ga0395898_0010450 3300037466 Bacteria 9704
90 Ga0395901_0294569 3300038443 Bacteria 1683
91 Ga0395901_0407746 3300038443 Bacteria 1396
92 Ga0439436_0007629 3300041404 Bacteria 3331
93 Ga0439439_0008355 3300041406 Bacteria 2444
94 Ga0451802_2021079 3300041460 Bacteria 1557
95 Ga0451841_0369953 3300041498 Bacteria 3037
96 Ga0451853_0304182 3300041512 Bacteria 5110
97 Ga0439433_0001165 3300041999 Bacteria 5380
98 Ga0439433_0005100 3300041999 Bacteria 2822
99 Ga0439448_0039850 3300042005 Bacteria 1516
100 Ga0439449_0068988 3300042007 Bacteria 1303
101 Ga0439457_000155 3300042014 Bacteria 17611
102 Ga0439462_0005353 3300042015 Bacteria 3162
103 Ga0439462_0073403 3300042015 Bacteria 930
104 Ga0450894_002772 3300042131 Bacteria 2325
105 Ga0450898_004532 3300042134 Bacteria 2059
106 Ga0450899_005267 3300042135 Bacteria 1389
107 Ga0450908_011853 3300042184 Bacteria 1589
108 Ga0439464_0003505 3300042439 Bacteria 3965
109 Ga0439460_0014531 3300042461 Bacteria 2070
110 Ga0466969_0036348 3300044656 Bacteria 2488
111 Ga0466972_0001144 3300044658 Bacteria 12698
112 Ga0466965_0000394 3300044683 Bacteria 14974
113 Ga0466966_0005262 3300044684 Bacteria 8508
114 Ga0466966_0013533 3300044684 Bacteria 5399
115 Ga0466961_0000237 3300044693 Bacteria 37109
116 Ga0466961_0005367 3300044693 Bacteria 8065
117 Ga0466963_0000471 3300044694 Bacteria 18741
118 Ga0466963_0035287 3300044694 Bacteria 3257
119 Ga0466964_0000486 3300044706 Bacteria 12274
120 Ga0466971_0053546 3300044719 Bacteria 1818
121 Ga0466968_0010407 3300044735 Bacteria 3605
122 Ga0466970_0000647 3300044765 Bacteria 17153
123 Ga0466957_0000488 3300044842 Bacteria 19749
124 Ga0466959_0008101 3300045049 Bacteria 7411
125 Ga0466959_0048927 3300045049 Bacteria 3106
126 Ga0466959_0066611 3300045049 Bacteria 2612
127 Ga0466958_0003463 3300045836 Bacteria 8188
128 Ga0466958_0032309 3300045836 Bacteria 3114
129 Ga0466967_0007823 3300045976 Bacteria 7766
130 Ga0466967_0077123 3300045976 Bacteria 2999
131 Ga0495617_017811 3300046452 Bacteria 2400
132 Ga0495592_0113011 3300046454 Bacteria 1919
133 Ga0495592_0122671 3300046454 Bacteria 1826
134 Ga0495590_0204207 3300046457 Bacteria 727
135 Ga0495629_0004881 3300046459 Bacteria 10064
136 Ga0495629_0038207 3300046459 Bacteria 3382
137 Ga0495629_0127445 3300046459 Bacteria 1773
138 Ga0495629_0299431 3300046459 Bacteria 1101
139 Ga0495638_0016406 3300046460 Bacteria 4962
140 Ga0495638_0121250 3300046460 Bacteria 1545
141 Ga0495638_0170746 3300046460 Bacteria 1248
142 Ga0495638_0238004 3300046460 Bacteria 1009
143 Ga0495651_0002958 3300046462 Bacteria 13128
144 Ga0495605_0002785 3300046474 Bacteria 10647
145 Ga0495662_0000997 3300046476 Bacteria 13853
146 Ga0495664_0001150 3300046477 Bacteria 13740
147 Ga0495664_0054503 3300046477 Bacteria 2378
148 Ga0495585_0038412 3300046492 Bacteria 2695
149 Ga0495585_0146698 3300046492 Bacteria 1232
150 Ga0495594_0017219 3300046499 Bacteria 3816
151 Ga0495583_0037863 3300046506 Bacteria 2283
152 Ga0495583_0040096 3300046506 Bacteria 2202
153 Ga0495583_0055737 3300046506 Bacteria 1785
154 Ga0495606_0019393 3300046507 Bacteria 5062
155 Ga0495610_0128297 3300046512 Bacteria 1104
156 Ga0495616_0019992 3300046513 Bacteria 3649
157 Ga0495618_0012586 3300046514 Bacteria 5139
158 Ga0495620_0002186 3300046515 Bacteria 11371
159 Ga0495620_0004708 3300046515 Bacteria 7667
160 Ga0495628_0035843 3300046516 Bacteria 3985
161 Ga0495628_0047299 3300046516 Bacteria 3414
162 Ga0495628_0169250 3300046516 Bacteria 1657
163 Ga0495628_0362731 3300046516 Bacteria 1063
164 Ga0495631_0023629 3300046518 Bacteria 2847
165 Ga0495643_0003593 3300046522 Bacteria 11270
166 Ga0495643_0008364 3300046522 Bacteria 6558
167 Ga0495643_0010762 3300046522 Bacteria 5617
168 Ga0495648_0048155 3300046524 Bacteria 2627
169 Ga0495648_0086916 3300046524 Bacteria 1762
170 Ga0495648_0192441 3300046524 Bacteria 1028
171 Ga0495666_0058807 3300046526 Bacteria 1838
172 Ga0495652_0059524 3300046529 Bacteria 3232
173 Ga0495652_0172963 3300046529 Bacteria 1665
174 Ga0495640_0005632 3300046533 Bacteria 9962
175 Ga0495640_0117190 3300046533 Bacteria 1734
176 Ga0495587_0002334 3300046536 Bacteria 12686
177 Ga0495609_0004936 3300046538 Bacteria 7158
178 Ga0495597_0121871 3300046542 Bacteria 1086
179 Ga0495645_0016666 3300046543 Bacteria 5253
180 Ga0495633_0016972 3300046558 Bacteria 3735
181 Ga0495633_0048805 3300046558 Bacteria 1998
182 Ga0495667_0070891 3300046559 Bacteria 2273
183 Ga0495667_0255553 3300046559 Bacteria 1115
184 Ga0495668_0024832 3300046616 Bacteria 3407
185 Ga0495634_0001449 3300046642 Bacteria 21089
186 Ga0495634_0017265 3300046642 Bacteria 5153
187 Ga0495634_0067376 3300046642 Bacteria 2368
188 Ga0495611_0059335 3300046648 Bacteria 1736
189 Ga0495625_0051356 3300046660 Bacteria 2956
190 Ga0495625_0114113 3300046660 Bacteria 1844
191 Ga0495625_0122574 3300046660 Bacteria 1767
192 Ga0495635_0034119 3300046663 Bacteria 3530
193 Ga0495635_0048336 3300046663 Bacteria 2933
194 Ga0495661_0171846 3300046665 Bacteria 1155
195 Ga0495588_0076672 3300046674 Bacteria 1742
196 Ga0495588_0081327 3300046674 Bacteria 1691
197 Ga0495657_0007633 3300046675 Bacteria 8331
198 Ga0495657_0042990 3300046675 Bacteria 3082
199 Ga0495657_0043399 3300046675 Bacteria 3066
200 Ga0495657_0072519 3300046675 Bacteria 2245
201 Ga0495599_0069873 3300046678 Bacteria 2191
202 Ga0495599_0339687 3300046678 Bacteria 902
203 Ga0495613_0001267 3300046689 Bacteria 19269
204 Ga0495624_0098103 3300046690 Bacteria 1805
205 Ga0495670_0023351 3300046691 Bacteria 3052
206 Ga0495670_0208779 3300046691 Bacteria 1035
207 Ga0495671_0011308 3300046692 Bacteria 4919
208 Ga0495649_0044620 3300046694 Bacteria 2420
209 Ga0495649_0132953 3300046694 Bacteria 1312
210 Ga0495589_0011620 3300046794 Bacteria 4571
211 Ga0495589_0028560 3300046794 Bacteria 2814
212 Ga0495589_0052003 3300046794 Bacteria 2024
213 Ga0495600_0005337 3300046809 Bacteria 7745
214 Ga0495660_0085501 3300046810 Bacteria 1647
215 Ga0495581_0003617 3300047315 Bacteria 8902
216 Ga0495581_0325755 3300047315 Bacteria 897
217 Ga0495604_0000563 3300047317 Bacteria 32678
218 Ga0495604_0265119 3300047317 Bacteria 1166
219 Ga0495636_0002012 3300047318 Bacteria 7789
220 Ga0495636_0041808 3300047318 Bacteria 1903
221 Ga0495636_0053208 3300047318 Bacteria 1699
222 Ga0495674_0044949 3300047319 Bacteria 3924
223 Ga0495680_0024646 3300047322 Bacteria 4989
224 Ga0495680_0069754 3300047322 Bacteria 2681
225 Ga0495680_0100805 3300047322 Bacteria 2151
226 Ga0495683_0037119 3300047323 Bacteria 2471
227 Ga0495687_001070 3300047443 Bacteria 26985
228 Ga0495687_004654 3300047443 Bacteria 9158
229 Ga0495687_007222 3300047443 Bacteria 6600
230 Ga0495687_009949 3300047443 Bacteria 5260
231 Ga0495687_036154 3300047443 Bacteria 2212
232 Ga0495675_0023824 3300047444 Bacteria 3901
233 Ga0495679_041550 3300047446 Bacteria 1423
234 Ga0495685_000224 3300047447 Bacteria 19324
235 Ga0495685_018828 3300047447 Bacteria 2370
236 Ga0495685_019627 3300047447 Bacteria 2323
237 Ga0495681_0001416 3300047470 Bacteria 18033
238 Ga0495681_0005103 3300047470 Bacteria 8853
239 Ga0495681_0073690 3300047470 Bacteria 1541
240 Ga0495681_0094368 3300047470 Bacteria 1316
241 Ga0495684_0106644 3300047471 Bacteria 2116
242 Ga0495686_0028529 3300047472 Bacteria 3635
243 Ga0495686_0032803 3300047472 Bacteria 3359
244 Ga0495686_0161974 3300047472 Bacteria 1306
245 Ga0495593_0000408 3300047673 Bacteria 23954
246 Ga0495593_0075555 3300047673 Bacteria 1747
247 Ga0495602_0035887 3300048088 Bacteria 4619
248 Ga0495602_0101414 3300048088 Bacteria 2361
249 Ga0495614_0055950 3300048089 Bacteria 1692
250 Ga0495626_0028441 3300048091 Bacteria 2710
251 Ga0496108_0437856 3300048911 Bacteria 1142
252 Ga0496126_0011458 3300048929 Bacteria 9175
253 Ga0495678_029618 3300049459 Bacteria 2297
254 Ga0501031_0011592 3300049568 Bacteria 5749
255 Ga0501031_0026693 3300049568 Bacteria 3764
256 Ga0501032_0027801 3300049569 Bacteria 3886
257 Ga0501032_0096693 3300049569 Bacteria 1957
258 Ga0501032_0216822 3300049569 Bacteria 1246
259 Ga0501033_0005672 3300049570 Bacteria 9853
260 Ga0501033_0059318 3300049570 Bacteria 2825
261 Ga0501033_0072202 3300049570 Bacteria 2535
262 Ga0501034_0010206 3300049571 Bacteria 9796
263 Ga0501034_0016853 3300049571 Bacteria 7491
264 Ga0501034_0021050 3300049571 Bacteria 6655
265 Ga0501034_0151245 3300049571 Bacteria 2296
266 Ga0501034_0489384 3300049571 Bacteria 1144
267 Ga0501036_0000507 3300049572 Bacteria 27895
268 Ga0501036_0047507 3300049572 Bacteria 3634
269 Ga0501036_0096235 3300049572 Bacteria 2503
270 Ga0501036_0238376 3300049572 Bacteria 1526
271 Ga0501037_0002853 3300049573 Bacteria 12531
272 Ga0501037_0043685 3300049573 Bacteria 3293
273 Ga0501037_0052438 3300049573 Bacteria 2983
274 Ga0501038_0001192 3300049574 Bacteria 23638
275 Ga0501038_0009117 3300049574 Bacteria 9102
276 Ga0501038_0043891 3300049574 Bacteria 3886
277 Ga0501038_0158170 3300049574 Bacteria 1843
278 Ga0501038_0174773 3300049574 Bacteria 1736
279 Ga0501039_0008905 3300049575 Bacteria 7646
280 Ga0501039_0145761 3300049575 Bacteria 1861
281 Ga0501039_0254165 3300049575 Bacteria 1381
282 Ga0501040_0023022 3300049576 Bacteria 4175
283 Ga0501040_0029054 3300049576 Bacteria 3730
284 Ga0501040_0079779 3300049576 Bacteria 2266
285 Ga0501041_0123147 3300049577 Bacteria 1612
286 Ga0501042_0152976 3300049578 Bacteria 1663
287 Ga0501042_0247429 3300049578 Bacteria 1286
288 Ga0501043_0000847 3300049579 Bacteria 27104
289 Ga0501043_0011663 3300049579 Bacteria 6878
290 Ga0501043_0020894 3300049579 Bacteria 5135
291 Ga0501043_0050687 3300049579 Bacteria 3262
292 Ga0501046_0017713 3300049580 Bacteria 5941
293 Ga0501046_0031349 3300049580 Bacteria 4310
294 Ga0501046_0040941 3300049580 Bacteria 3699
295 Ga0501046_0172290 3300049580 Bacteria 1623
296 Ga0501047_0012792 3300049581 Bacteria 7949
297 Ga0501047_0013437 3300049581 Bacteria 7762
298 Ga0501047_0020280 3300049581 Bacteria 6383
299 Ga0501047_0073629 3300049581 Bacteria 3289
300 Ga0501047_0128372 3300049581 Bacteria 2415
301 Ga0501047_0514296 3300049581 Bacteria 1023
302 Ga0501048_0013167 3300049582 Bacteria 6138
303 Ga0501048_0020061 3300049582 Bacteria 4903
304 Ga0501048_0091283 3300049582 Bacteria 2148
305 Ga0501068_0006292 3300049584 Bacteria 6538
306 Ga0501069_0027712 3300049585 Bacteria 3105
307 Ga0501070_0110061 3300049586 Bacteria 2276
308 Ga0501071_0072832 3300049587 Bacteria 2505
309 Ga0501072_0030292 3300049588 Bacteria 4231
310 Ga0501073_0045198 3300049589 Bacteria 3102
311 Ga0501074_0004002 3300049590 Bacteria 10502
312 Ga0501074_0208798 3300049590 Bacteria 1391
313 Ga0501076_0569927 3300049592 Bacteria 934
314 Ga0501077_0358574 3300049593 Bacteria 931
315 Ga0501079_0024005 3300049741 Bacteria 4677
316 Ga0501080_0024781 3300049742 Bacteria 5564
317 Ga0501080_0237711 3300049742 Bacteria 1663
318 Ga0501083_0044686 3300049744 Bacteria 2998
319 Ga0501035_0025671 3300049822 Bacteria 5401
320 Ga0501035_0046878 3300049822 Bacteria 3884
321 Ga0501035_0100034 3300049822 Bacteria 2545
322 Ga0501044_0008173 3300049823 Bacteria 11484
323 Ga0501044_0019465 3300049823 Bacteria 7260
324 Ga0501044_0069171 3300049823 Bacteria 3594
325 Ga0501044_0076029 3300049823 Bacteria 3409
326 Ga0501045_0162354 3300049824 Bacteria 1663
327 Ga0501045_0332072 3300049824 Bacteria 1131
328 nmdc:mga0yw44_222909_c1 3300050492 Bacteria 1250
329 nmdc:mga06z11_24288_c1 3300050494 Bacteria 2857
330 nmdc:mga04h51_59275_c1 3300050495 Bacteria 1308
331 Ga0495601_0048297 3300053077 Bacteria 2680
332 Ga0495655_0004585 3300053083 Bacteria 2375
333 Ga0495619_0054261 3300053085 Bacteria 2652
334 Ga0500578_0012595 3300053086 Bacteria 5453
335 Ga0500578_0127644 3300053086 Bacteria 1596
336 Ga0500644_0043299 3300053088 Bacteria 1505
337 Ga0500644_0153661 3300053088 Bacteria 925
338 Ga0500651_0082587 3300053093 Bacteria 1989
339 Ga0500566_0099725 3300053094 Bacteria 1594
340 Ga0500640_026185 3300053095 Bacteria 2540
341 Ga0500654_022254 3300053099 Bacteria 4018
342 Ga0500654_038429 3300053099 Bacteria 2754
343 Ga0500553_010892 3300053101 Bacteria 4573
344 Ga0500553_027710 3300053101 Bacteria 2845
345 Ga0500553_029560 3300053101 Bacteria 2745
346 Ga0500560_003850 3300053107 Bacteria 3102
347 Ga0500560_005516 3300053107 Bacteria 2809
348 Ga0500560_093418 3300053107 Bacteria 1006
349 Ga0500569_001283 3300053109 Bacteria 4683
350 Ga0500569_003244 3300053109 Bacteria 3301
351 Ga0500569_015043 3300053109 Bacteria 1930
352 Ga0500580_064411 3300053113 Bacteria 1521
353 Ga0500628_015356 3300053129 Bacteria 1463
354 Ga0500652_003693 3300053131 Bacteria 4664
355 Ga0500652_100353 3300053131 Bacteria 1210
356 Ga0500658_0004676 3300053134 Bacteria 5107
357 Ga0500561_0001232 3300053137 Bacteria 4163
358 Ga0500561_0057850 3300053137 Bacteria 1077
359 Ga0500573_0066688 3300053140 Bacteria 2057
360 Ga0500573_0195389 3300053140 Bacteria 1078
361 Ga0500588_0011470 3300053146 Bacteria 2170
362 Ga0500600_0005740 3300053149 Bacteria 7344
363 Ga0500600_0096489 3300053149 Bacteria 1567
364 Ga0500616_0017599 3300053153 Bacteria 4053
365 Ga0500633_0036168 3300053160 Bacteria 1631
366 Ga0500633_0094990 3300053160 Bacteria 1092
367 Ga0500634_0017798 3300053161 Bacteria 3808
368 Ga0500656_000513 3300053732 Bacteria 2886
369 Ga0500587_002221 3300053739 Bacteria 2766
370 Ga0501084_0005643 3300054114 Bacteria 10274
371 Ga0501082_0080478 3300060353 Bacteria 2811
372 Ga0466962_0003257 3300061719 Bacteria 7711
373 Ga0466962_0013559 3300061719 Bacteria 3925
374 Ga0466962_0178768 3300061719 Bacteria 1034
375 Ga0530510_0056246 3300061734 Bacteria 2842
376 2585319948 2582581314 Bacteria 11452267
377 2616693703 2616644814 Bacteria 11555299
378 2626638721 2626541554 Bacteria 7741902
379 2643901197 2643221578 Bacteria 9213798
380 2644264793 2643221647 Bacteria 10741251
381 2644407341 2643221673 Bacteria 9196637
382 2784585695 2784132148 Bacteria 8627943
383 2785340497 2784746763 Bacteria 9783172
384 2793976625 2791355406 Bacteria 11364898
385 2793978791 2791355406 Bacteria 11364898
386 2804846710 2802429296 Bacteria 7227771
387 2809229196 2808606448 Bacteria 8656184
388 2812476968 2811994917 Bacteria 7761064
389 2862383534 2862382967 Bacteria 10317375
390 2862706925 2862705112 Bacteria 6563286
391 2863409358 2863404153 Bacteria 9672205
392 2867352111 2867346516 Bacteria 7608576
393 2875397970 2875391855 Bacteria 7600475
394 2912722950 2912715099 Bacteria 9460473
395 2912728276 2912723979 Bacteria 8557534
396 2912761622 2912757875 Bacteria 7940295
397 2946046083 2946045630 Bacteria 8527308
398 2954010311 2954002825 Bacteria 9173742
399 2954693992 2954691527 Bacteria 10720516
400 2954709097 2954701450 Bacteria 10834262
401 2966605414 2966598605 Bacteria 7676064
402 2990068089 2990059506 Bacteria 9321252
403 3006322975 3006321560 Bacteria 8247479
404 3006324628 3006321560 Bacteria 8247479
405 8008486330 8008485437 Bacteria 7198341
406 8008563639 8008558824 Bacteria 10610750
407 8008575426 8008574985 Bacteria 7815457
408 8023626529 8023623736 Bacteria 8593882
409 8025418066 8025413630 Bacteria 7014048
410 8025528109 8025524527 Bacteria 7197316
411 8025531568 8025530807 Bacteria 8495698
412 8025531717 8025530807 Bacteria 8495698
413 8033689690 8033684223 Bacteria 6906479
414 8047894586 8047893842 Bacteria 11723082
415 8047903735 8047893842 Bacteria 11723082
416 8048130916 8048127548 Bacteria 11053136
417 8048134965 8048127548 Bacteria 11053136
418 8048356997 8048356638 Bacteria 11044339
419 8048364466 8048356638 Bacteria 11044339
420 8048371603 8048369669 Bacteria 11666822
421 8048378828 8048369669 Bacteria 11666822
422 8048380537 8048379754 Bacteria 11877923
423 8048387930 8048379754 Bacteria 11877923
424 8054914106 8054913762 Bacteria 7713009
425 8054922003 8054920844 Bacteria 7068637
426 8056834748 8056829672 Bacteria 9045328
427 Ga0495594_0005080
428 JGI24737J22298_10029910
429 rootH2_10002059
430 Ga0006562J51391_1089409
431 Ga0070680_100199305
432 Ga0070713_100216945
433 Ga0070684_100082399
434 Ga0068853_100015218
435 Ga0068857_100236364
436 Ga0081455_10051844
437 Ga0081538_10005513
438 Ga0081538_10005832
439 Ga0075368_10034997
440 Ga0075367_10037835
441 Ga0105238_10128053
442 Ga0105035_107960
443 Ga0157369_10306357
444 Ga0157372_10164270
445 Ga0209758_1015940
446 Ga0207426_1007274
447 Ga0207647_10004639
448 Ga0207639_10051892
449 Ga0209813_10017415
450 Ga0307517_10002312
451 Ga0307517_10015618
452 Ga0307515_10000939
453 Ga0307515_10054137
454 Ga0307515_10140296
455 Ga0307515_10161283
456 Ga0265338_10006156
457 Ga0307511_10006355
458 Ga0307511_10037678
459 Ga0307512_10004407
460 Ga0307512_10022119
461 Ga0307512_10094294
462 Ga0307512_10183634
463 Ga0307513_10008427
464 Ga0307513_10012700
465 Ga0307513_10033388
466 Ga0307513_10035513
467 Ga0307513_10084768
468 Ga0307509_10008727
469 Ga0307509_10129278
470 Ga0307509_10304583
471 Ga0307408_100099997
472 Ga0307408_100229223
473 Ga0307508_10002588
474 Ga0307508_10007362
475 Ga0307508_10014415
476 Ga0307508_10018454
477 Ga0307508_10048852
478 Ga0307508_10203314
479 Ga0307508_10265013
480 Ga0307514_10002659
481 Ga0307514_10026663
482 Ga0307514_10043000
483 Ga0307514_10116543
484 Ga0307514_10167220
485 Ga0307516_10062451
486 Ga0307516_10081627
487 Ga0307405_10000585
488 Ga0307405_10014810
489 Ga0307413_10147024
490 Ga0307406_10007578
491 Ga0307412_10207513
492 Ga0307409_100004766
493 Ga0307409_100012975
494 Ga0307416_100000505
495 Ga0307416_100001516
496 Ga0307415_100000017
497 Ga0307415_100000141
498 Ga0307507_10003693
499 Ga0307507_10027766
500 Ga0307510_10057048
501 Ga0307510_10057188
502 Ga0307510_10071378
503 Ga0316214_1000299
504 Ga0316212_1015489
505 Ga0373940_0031145
506 Ga0373953_0084497
507 Ga0373956_0084181
508 Ga0373942_0000076
509 Ga0373933_0013148
510 Ga0373937_0049769
511 Ga0372808_015982
512 Ga0373925_0152656
513 Ga0395900_0146629
514 Ga0395898_0004551
515 Ga0395898_0010450
516 Ga0395901_0294569
517 Ga0395901_0407746
518 Ga0439436_0007629
519 Ga0439439_0008355
520 Ga0451802_2021079
521 Ga0451841_0369953
522 Ga0451853_0304182
523 Ga0439433_0001165
524 Ga0439433_0005100
525 Ga0439448_0039850
526 Ga0439449_0068988
527 Ga0439457_000155
528 Ga0439462_0005353
529 Ga0439462_0073403
530 Ga0450894_002772
531 Ga0450898_004532
532 Ga0450899_005267
533 Ga0450908_011853
534 Ga0439464_0003505
535 Ga0439460_0014531
536 Ga0466969_0036348
537 Ga0466972_0001144
538 Ga0466965_0000394
539 Ga0466966_0005262
540 Ga0466966_0013533
541 Ga0466961_0000237
542 Ga0466961_0005367
543 Ga0466963_0000471
544 Ga0466963_0035287
545 Ga0466964_0000486
546 Ga0466971_0053546
547 Ga0466968_0010407
548 Ga0466970_0000647
549 Ga0466957_0000488
550 Ga0466959_0008101
551 Ga0466959_0048927
552 Ga0466959_0066611
553 Ga0466958_0003463
554 Ga0466958_0032309
555 Ga0466967_0007823
556 Ga0466967_0077123
557 Ga0495617_017811
558 Ga0495592_0113011
559 Ga0495592_0122671
560 Ga0495590_0204207
561 Ga0495629_0004881
562 Ga0495629_0038207
563 Ga0495629_0127445
564 Ga0495629_0299431
565 Ga0495638_0016406
566 Ga0495638_0121250
567 Ga0495638_0170746
568 Ga0495638_0238004
569 Ga0495651_0002958
570 Ga0495605_0002785
571 Ga0495662_0000997
572 Ga0495664_0001150
573 Ga0495664_0054503
574 Ga0495585_0038412
575 Ga0495585_0146698
576 Ga0495594_0017219
577 Ga0495583_0037863
578 Ga0495583_0040096
579 Ga0495583_0055737
580 Ga0495606_0019393
581 Ga0495610_0128297
582 Ga0495616_0019992
583 Ga0495618_0012586
584 Ga0495620_0002186
585 Ga0495620_0004708
586 Ga0495628_0035843
587 Ga0495628_0047299
588 Ga0495628_0169250
589 Ga0495628_0362731
590 Ga0495631_0023629
591 Ga0495643_0003593
592 Ga0495643_0008364
593 Ga0495643_0010762
594 Ga0495648_0048155
595 Ga0495648_0086916
596 Ga0495648_0192441
597 Ga0495666_0058807
598 Ga0495652_0059524
599 Ga0495652_0172963
600 Ga0495640_0005632
601 Ga0495640_0117190
602 Ga0495587_0002334
603 Ga0495609_0004936
604 Ga0495597_0121871
605 Ga0495645_0016666
606 Ga0495633_0016972
607 Ga0495633_0048805
608 Ga0495667_0070891
609 Ga0495667_0255553
610 Ga0495668_0024832
611 Ga0495634_0001449
612 Ga0495634_0017265
613 Ga0495634_0067376
614 Ga0495611_0059335
615 Ga0495625_0051356
616 Ga0495625_0114113
617 Ga0495625_0122574
618 Ga0495635_0034119
619 Ga0495635_0048336
620 Ga0495661_0171846
621 Ga0495588_0076672
622 Ga0495588_0081327
623 Ga0495657_0007633
624 Ga0495657_0042990
625 Ga0495657_0043399
626 Ga0495657_0072519
627 Ga0495599_0069873
628 Ga0495599_0339687
629 Ga0495613_0001267
630 Ga0495624_0098103
631 Ga0495670_0023351
632 Ga0495670_0208779
633 Ga0495671_0011308
634 Ga0495649_0044620
635 Ga0495649_0132953
636 Ga0495589_0011620
637 Ga0495589_0028560
638 Ga0495589_0052003
639 Ga0495600_0005337
640 Ga0495660_0085501
641 Ga0495581_0003617
642 Ga0495581_0325755
643 Ga0495604_0000563
644 Ga0495604_0265119
645 Ga0495636_0002012
646 Ga0495636_0041808
647 Ga0495636_0053208
648 Ga0495674_0044949
649 Ga0495680_0024646
650 Ga0495680_0069754
651 Ga0495680_0100805
652 Ga0495683_0037119
653 Ga0495687_001070
654 Ga0495687_004654
655 Ga0495687_007222
656 Ga0495687_009949
657 Ga0495687_036154
658 Ga0495675_0023824
659 Ga0495679_041550
660 Ga0495685_000224
661 Ga0495685_018828
662 Ga0495685_019627
663 Ga0495681_0001416
664 Ga0495681_0005103
665 Ga0495681_0073690
666 Ga0495681_0094368
667 Ga0495684_0106644
668 Ga0495686_0028529
669 Ga0495686_0032803
670 Ga0495686_0161974
671 Ga0495593_0000408
672 Ga0495593_0075555
673 Ga0495602_0035887
674 Ga0495602_0101414
675 Ga0495614_0055950
676 Ga0495626_0028441
677 Ga0496108_0437856
678 Ga0496126_0011458
679 Ga0495678_029618
680 Ga0501031_0011592
681 Ga0501031_0026693
682 Ga0501032_0027801
683 Ga0501032_0096693
684 Ga0501032_0216822
685 Ga0501033_0005672
686 Ga0501033_0059318
687 Ga0501033_0072202
688 Ga0501034_0010206
689 Ga0501034_0016853
690 Ga0501034_0021050
691 Ga0501034_0151245
692 Ga0501034_0489384
693 Ga0501036_0000507
694 Ga0501036_0047507
695 Ga0501036_0096235
696 Ga0501036_0238376
697 Ga0501037_0002853
698 Ga0501037_0043685
699 Ga0501037_0052438
700 Ga0501038_0001192
701 Ga0501038_0009117
702 Ga0501038_0043891
703 Ga0501038_0158170
704 Ga0501038_0174773
705 Ga0501039_0008905
706 Ga0501039_0145761
707 Ga0501039_0254165
708 Ga0501040_0023022
709 Ga0501040_0029054
710 Ga0501040_0079779
711 Ga0501041_0123147
712 Ga0501042_0152976
713 Ga0501042_0247429
714 Ga0501043_0000847
715 Ga0501043_0011663
716 Ga0501043_0020894
717 Ga0501043_0050687
718 Ga0501046_0017713
719 Ga0501046_0031349
720 Ga0501046_0040941
721 Ga0501046_0172290
722 Ga0501047_0012792
723 Ga0501047_0013437
724 Ga0501047_0020280
725 Ga0501047_0073629
726 Ga0501047_0128372
727 Ga0501047_0514296
728 Ga0501048_0013167
729 Ga0501048_0020061
730 Ga0501048_0091283
731 Ga0501068_0006292
732 Ga0501069_0027712
733 Ga0501070_0110061
734 Ga0501071_0072832
735 Ga0501072_0030292
736 Ga0501073_0045198
737 Ga0501074_0004002
738 Ga0501074_0208798
739 Ga0501076_0569927
740 Ga0501077_0358574
741 Ga0501079_0024005
742 Ga0501080_0024781
743 Ga0501080_0237711
744 Ga0501083_0044686
745 Ga0501035_0025671
746 Ga0501035_0046878
747 Ga0501035_0100034
748 Ga0501044_0008173
749 Ga0501044_0019465
750 Ga0501044_0069171
751 Ga0501044_0076029
752 Ga0501045_0162354
753 Ga0501045_0332072
754 nmdc:mga0yw44_222909_c1
755 nmdc:mga06z11_24288_c1
756 nmdc:mga04h51_59275_c1
757 Ga0495601_0048297
758 Ga0495655_0004585
759 Ga0495619_0054261
760 Ga0500578_0012595
761 Ga0500578_0127644
762 Ga0500644_0043299
763 Ga0500644_0153661
764 Ga0500651_0082587
765 Ga0500566_0099725
766 Ga0500640_026185
767 Ga0500654_022254
768 Ga0500654_038429
769 Ga0500553_010892
770 Ga0500553_027710
771 Ga0500553_029560
772 Ga0500560_003850
773 Ga0500560_005516
774 Ga0500560_093418
775 Ga0500569_001283
776 Ga0500569_003244
777 Ga0500569_015043
778 Ga0500580_064411
779 Ga0500628_015356
780 Ga0500652_003693
781 Ga0500652_100353
782 Ga0500658_0004676
783 Ga0500561_0001232
784 Ga0500561_0057850
785 Ga0500573_0066688
786 Ga0500573_0195389
787 Ga0500588_0011470
788 Ga0500600_0005740
789 Ga0500600_0096489
790 Ga0500616_0017599
791 Ga0500633_0036168
792 Ga0500633_0094990
793 Ga0500634_0017798
794 Ga0500656_000513
795 Ga0500587_002221
796 Ga0501084_0005643
797 Ga0501082_0080478
798 Ga0466962_0003257
799 Ga0466962_0013559
800 Ga0466962_0178768
801 Ga0530510_0056246
802 2585319948
803 2616693703
804 2626638721
805 2643901197
806 2644264793
807 2644407341
808 2784585695
809 2785340497
810 2793976625
811 2793978791
812 2804846710
813 2809229196
814 2812476968
815 2862383534
816 2862706925
817 2863409358
818 2867352111
819 2875397970
820 2912722950
821 2912728276
822 2912761622
823 2946046083
824 2954010311
825 2954693992
826 2954709097
827 2966605414
828 2990068089
829 3006322975
830 3006324628
831 8008486330
832 8008563639
833 8008575426
834 8023626529
835 8025418066
836 8025528109
837 8025531568
838 8025531717
839 8033689690
840 8047894586
841 8047903735
842 8048130916
843 8048134965
844 8048356997
845 8048364466
846 8048371603
847 8048378828
848 8048380537
849 8048387930
850 8054914106
851 8054922003
852 8056834748

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04672

Methyltransf_19

S-adenosyl methyltransferase

38

304

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3go4-assembly1.cif.gz_A crystal structure of a duf574 family protein (sav_2177) from streptomyces avermitilis ma-4680 at 1.80 a resolution 0.9907 11 272
3go4-assembly1.cif.gz_A crystal structure of a duf574 family protein (sav_2177) from streptomyces avermitilis ma-4680 at 1.80 a resolution 0.987 11 272
2qe6-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tfu_2867) from thermobifida fusca yx at 1.95 a resolution 0.9183 6 271
2qe6-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tfu_2867) from thermobifida fusca yx at 1.95 a resolution 0.9017 6 271
5dpl-assembly1.cif.gz_B the structure of pkmt2 from rickettsia typhi in complex with adohcy 0.7515 72 200
ID Description Score Start End Superfamily
3go4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9893 11 272 3.40.50.150
3go4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9854 11 272 3.40.50.150
2qe6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9227 13 271 3.40.50.150
2qe6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.885 13 271 3.40.50.150
af_F7F172_79_179_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7384 64 143 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7K3DN94-F1-model_v4 SAM-dependent methyltransferase 0.9958 12 112
AF-A8LBC4-F1-model_v4 deleted 0.9938 12 110
AF-A0A7K2NVL0-F1-model_v4 SAM-dependent methyltransferase 0.9903 60 272 GO:0008168
GO:0032259
AF-W9D6D3-F1-model_v4 deleted 0.9898 12 113
AF-A0A1X1PY41-F1-model_v4 deleted 0.9892 12 113

Map