F441269

General Info

Members Datasets Scaffolds Average Seq Length
426 248 852 167

Family's Representative Sequence

Representative Sequence 3300046491|Ga0495584_0029652|Ga0495584_0029652_50_655
Length 201
Sequence MSSFDASEKPRRRRYHENGAASGRLGVATVVAMATTLNLRTIKLRSGEQFRDEREIQLEPLELGGQRYLPVPQEVPAQLTITRASTGTVFELVFSVGLHGPCYRCLEDAVLELPISAREYQATNPESDEMRTPYLDNDRLDLSAWARDALALELPDKILCKPDCAGLCPVCGKDLNLEPHDHGEPEPDSRWSALAELKHKL

Samples

Sample ID Description Type Environment
1 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
122 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
140 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
141 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
157 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
158 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
159 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
160 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
161 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
162 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
163 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
164 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
165 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
166 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
167 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
168 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
169 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
170 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
171 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
175 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
176 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
177 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.1
Rhizosphere 90.85
Stem 0
Stem Tuber 0
Unclassified 9.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495584_0029652 3300046491 Bacteria 2774
2 rootL2_10131179 3300003322 Bacteria 1780
3 rootH1_10146211 3300003323 Bacteria 1045
4 JGI25407J50210_10022652 3300003373 Unclassified 1633
5 Ga0070676_10394569 3300005328 Unclassified 961
6 Ga0070683_100183954 3300005329 Bacteria 1984
7 Ga0070683_100254087 3300005329 Bacteria 1672
8 Ga0070683_100352445 3300005329 Bacteria 1402
9 Ga0070683_100408826 3300005329 Bacteria 1294
10 Ga0070680_100210474 3300005336 Bacteria 1640
11 Ga0070680_100324244 3300005336 Bacteria 1308
12 Ga0070680_100350200 3300005336 Bacteria 1256
13 Ga0070682_100000785 3300005337 Bacteria 18650
14 Ga0070682_100023210 3300005337 Bacteria 3683
15 Ga0068868_100014906 3300005338 Bacteria 5739
16 Ga0068868_100498916 3300005338 Unclassified 1066
17 Ga0070660_100017792 3300005339 Bacteria 5184
18 Ga0070660_100241033 3300005339 Bacteria 1473
19 Ga0070660_100758881 3300005339 Bacteria 815
20 Ga0070689_100870487 3300005340 Bacteria 796
21 Ga0070661_100100774 3300005344 Bacteria 2148
22 Ga0070668_100239074 3300005347 Bacteria 1504
23 Ga0070673_101593609 3300005364 Bacteria 617
24 Ga0070659_100423792 3300005366 Bacteria 1126
25 Ga0070659_100698783 3300005366 Bacteria 877
26 Ga0070709_10436144 3300005434 Bacteria 984
27 Ga0070709_10458042 3300005434 Bacteria 962
28 Ga0070709_11253662 3300005434 Bacteria 597
29 Ga0070714_100001136 3300005435 Bacteria 19099
30 Ga0070714_100022234 3300005435 Bacteria 5197
31 Ga0070714_100092310 3300005435 Bacteria 2653
32 Ga0070714_100198078 3300005435 Bacteria 1836
33 Ga0070713_100251699 3300005436 Bacteria 1611
34 Ga0070713_100273578 3300005436 Bacteria 1547
35 Ga0070710_10051132 3300005437 Bacteria 2319
36 Ga0070710_10645033 3300005437 Bacteria 742
37 Ga0070701_10602037 3300005438 Unclassified 728
38 Ga0070711_100366300 3300005439 Bacteria 1162
39 Ga0070711_100576069 3300005439 Bacteria 936
40 Ga0070705_100487096 3300005440 Unclassified 933
41 Ga0070678_100029329 3300005456 Bacteria 3766
42 Ga0070662_100035393 3300005457 Bacteria 3526
43 Ga0070662_100079559 3300005457 Bacteria 2438
44 Ga0070662_100783475 3300005457 Bacteria 810
45 Ga0068867_100852740 3300005459 Bacteria 816
46 Ga0070707_100151293 3300005468 Bacteria 2260
47 Ga0070698_100065859 3300005471 Bacteria 3648
48 Ga0070698_100093394 3300005471 Bacteria 2988
49 Ga0070698_100330024 3300005471 Bacteria 1456
50 Ga0070679_100056224 3300005530 Bacteria 3921
51 Ga0070679_100468073 3300005530 Bacteria 1205
52 Ga0068853_100162698 3300005539 Bacteria 2015
53 Ga0070686_100516923 3300005544 Bacteria 929
54 Ga0070695_100471362 3300005545 Bacteria 966
55 Ga0070696_100053043 3300005546 Bacteria 2822
56 Ga0070693_100010921 3300005547 Bacteria 4562
57 Ga0070704_100528583 3300005549 Unclassified 1028
58 Ga0068855_100209078 3300005563 Bacteria 2194
59 Ga0068855_100413277 3300005563 Bacteria 1477
60 Ga0068855_100575855 3300005563 Bacteria 1216
61 Ga0068857_100003516 3300005577 Bacteria 13090
62 Ga0068857_100447596 3300005577 Bacteria 1207
63 Ga0068854_100193399 3300005578 Bacteria 1595
64 Ga0068856_100067232 3300005614 Bacteria 3542
65 Ga0070702_100015171 3300005615 Bacteria 3927
66 Ga0068861_100053478 3300005719 Bacteria 3072
67 Ga0068861_100251536 3300005719 Bacteria 1508
68 Ga0068861_101235860 3300005719 Bacteria 724
69 Ga0068861_101387592 3300005719 Bacteria 686
70 Ga0068858_101772003 3300005842 Unclassified 610
71 Ga0068860_101457045 3300005843 Bacteria 706
72 Ga0081455_10003924 3300005937 Bacteria 16929
73 Ga0081455_10018451 3300005937 Bacteria 6646
74 Ga0081455_10025192 3300005937 Bacteria 5496
75 Ga0081455_10035948 3300005937 Bacteria 4417
76 Ga0081455_10049328 3300005937 Bacteria 3629
77 Ga0081455_10156582 3300005937 Bacteria 1750
78 Ga0081455_10370589 3300005937 Bacteria 1004
79 Ga0081455_10635149 3300005937 Bacteria 690
80 Ga0081538_10001861 3300005981 Bacteria 21273
81 Ga0081538_10004939 3300005981 Bacteria 12148
82 Ga0081538_10039759 3300005981 Bacteria 3011
83 Ga0081538_10077175 3300005981 Bacteria 1796
84 Ga0081538_10133812 3300005981 Bacteria 1159
85 Ga0081540_1012448 3300005983 Bacteria 5599
86 Ga0081539_10000427 3300005985 Bacteria 89575
87 Ga0070717_10247919 3300006028 Bacteria 1572
88 Ga0070717_10308006 3300006028 Bacteria 1409
89 Ga0075432_10003234 3300006058 Bacteria 5494
90 Ga0075432_10024649 3300006058 Bacteria 2062
91 Ga0075432_10041109 3300006058 Bacteria 1614
92 Ga0070715_10128544 3300006163 Bacteria 1217
93 Ga0070716_100170566 3300006173 Unclassified 1419
94 Ga0070716_100260050 3300006173 Bacteria 1187
95 Ga0070716_100611775 3300006173 Bacteria 821
96 Ga0070712_100611298 3300006175 Bacteria 923
97 Ga0070712_100997332 3300006175 Unclassified 725
98 Ga0097621_100019548 3300006237 Bacteria 5201
99 Ga0068871_100045611 3300006358 Bacteria 3528
100 Ga0075428_100261983 3300006844 Bacteria 1861
101 Ga0075428_100271021 3300006844 Bacteria 1826
102 Ga0075428_100781763 3300006844 Bacteria 1015
103 Ga0075430_100031417 3300006846 Bacteria 4506
104 Ga0075431_100066572 3300006847 Bacteria 3719
105 Ga0075431_100073286 3300006847 Bacteria 3532
106 Ga0075431_100217955 3300006847 Bacteria 1947
107 Ga0075433_10071780 3300006852 Bacteria 3043
108 Ga0075433_10561385 3300006852 Bacteria 1003
109 Ga0075434_100378181 3300006871 Bacteria 1437
110 Ga0075434_100395270 3300006871 Bacteria 1403
111 Ga0075429_100498819 3300006880 Bacteria 1067
112 Ga0075436_100011019 3300006914 Bacteria 6205
113 Ga0075436_100120864 3300006914 Bacteria 1832
114 Ga0075436_100212388 3300006914 Bacteria 1372
115 Ga0075435_100006855 3300007076 Bacteria 8084
116 Ga0075435_100070890 3300007076 Bacteria 2845
117 Ga0075435_101020369 3300007076 Bacteria 722
118 Ga0105240_10222299 3300009093 Bacteria 2199
119 Ga0111539_10003022 3300009094 Bacteria 22297
120 Ga0111539_10022731 3300009094 Bacteria 7701
121 Ga0111539_10238866 3300009094 Bacteria 2115
122 Ga0105245_10031103 3300009098 Bacteria 4722
123 Ga0105245_10169949 3300009098 Bacteria 2075
124 Ga0105245_10255104 3300009098 Bacteria 1705
125 Ga0105245_10327020 3300009098 Bacteria 1512
126 Ga0114129_10075219 3300009147 Bacteria 4703
127 Ga0114129_10157661 3300009147 Bacteria 3103
128 Ga0114129_10392368 3300009147 Bacteria 1830
129 Ga0114129_11328050 3300009147 Bacteria 890
130 Ga0105243_10027809 3300009148 Bacteria 4337
131 Ga0105241_10056394 3300009174 Bacteria 3012
132 Ga0105242_10126638 3300009176 Bacteria 2199
133 Ga0105249_10017937 3300009553 Bacteria 6290
134 Ga0105249_10055481 3300009553 Bacteria 3625
135 Ga0105249_10224492 3300009553 Bacteria 1850
136 Ga0105239_10032872 3300010375 Bacteria 5699
137 Ga0105239_10072141 3300010375 Bacteria 3795
138 Ga0105246_10206024 3300011119 Bacteria 1532
139 Ga0157373_10148110 3300013100 Bacteria 1651
140 Ga0157371_10111244 3300013102 Bacteria 1944
141 Ga0157370_10699374 3300013104 Bacteria 925
142 Ga0157369_10900898 3300013105 Bacteria 907
143 Ga0157378_10562137 3300013297 Bacteria 1147
144 Ga0163162_10223345 3300013306 Bacteria 2013
145 Ga0163162_10469737 3300013306 Bacteria 1389
146 Ga0157372_10110171 3300013307 Bacteria 3153
147 Ga0157375_10805173 3300013308 Bacteria 1088
148 Ga0182008_10001911 3300014497 Bacteria 13473
149 Ga0182008_10099737 3300014497 Bacteria 1435
150 Ga0182008_10372789 3300014497 Unclassified 761
151 Ga0157377_10080330 3300014745 Bacteria 1905
152 Ga0157377_10669195 3300014745 Bacteria 750
153 Ga0157376_10178780 3300014969 Bacteria 1938
154 Ga0206353_10993826 3300020082 Bacteria 1027
155 Ga0206353_11919178 3300020082 Bacteria 3388
156 Ga0207653_10012209 3300025885 Bacteria 2682
157 Ga0207682_10076569 3300025893 Bacteria 1426
158 Ga0207692_10058552 3300025898 Bacteria 1985
159 Ga0207692_10117843 3300025898 Bacteria 1482
160 Ga0207692_10188256 3300025898 Unclassified 1206
161 Ga0207688_10194902 3300025901 Bacteria 1213
162 Ga0207688_10262639 3300025901 Bacteria 1048
163 Ga0207685_10095402 3300025905 Unclassified 1262
164 Ga0207699_10078019 3300025906 Bacteria 2045
165 Ga0207699_10137288 3300025906 Bacteria 1603
166 Ga0207699_10394369 3300025906 Bacteria 985
167 Ga0207707_10014186 3300025912 Bacteria 6942
168 Ga0207695_10557261 3300025913 Bacteria 1028
169 Ga0207693_10028688 3300025915 Bacteria 4398
170 Ga0207693_10029723 3300025915 Bacteria 4313
171 Ga0207693_10077428 3300025915 Bacteria 2604
172 Ga0207693_10324495 3300025915 Bacteria 1205
173 Ga0207663_10013999 3300025916 Bacteria 4378
174 Ga0207663_10171272 3300025916 Bacteria 1542
175 Ga0207663_10322068 3300025916 Bacteria 1162
176 Ga0207660_10067304 3300025917 Bacteria 2594
177 Ga0207660_10075245 3300025917 Bacteria 2466
178 Ga0207662_10335917 3300025918 Bacteria 1011
179 Ga0207657_10065893 3300025919 Bacteria 3085
180 Ga0207657_10113587 3300025919 Bacteria 2234
181 Ga0207652_10167938 3300025921 Bacteria 1968
182 Ga0207652_10257266 3300025921 Bacteria 1575
183 Ga0207646_10146239 3300025922 Bacteria 2130
184 Ga0207687_10018145 3300025927 Bacteria 4642
185 Ga0207687_10244661 3300025927 Bacteria 1423
186 Ga0207700_10598425 3300025928 Bacteria 981
187 Ga0207664_10021537 3300025929 Bacteria 4796
188 Ga0207664_10072867 3300025929 Bacteria 2770
189 Ga0207664_10215189 3300025929 Bacteria 1664
190 Ga0207664_10240850 3300025929 Bacteria 1575
191 Ga0207664_10298693 3300025929 Bacteria 1416
192 Ga0207664_10322502 3300025929 Unclassified 1363
193 Ga0207706_10018632 3300025933 Bacteria 6246
194 Ga0207706_10067987 3300025933 Bacteria 3136
195 Ga0207686_10317220 3300025934 Unclassified 1163
196 Ga0207709_10984426 3300025935 Unclassified 689
197 Ga0207704_10425452 3300025938 Unclassified 1054
198 Ga0207665_10001017 3300025939 Bacteria 18936
199 Ga0207661_10089762 3300025944 Bacteria 2558
200 Ga0207667_10614009 3300025949 Unclassified 1095
201 Ga0207712_10033424 3300025961 Bacteria 3477
202 Ga0207712_10384467 3300025961 Unclassified 1176
203 Ga0207712_10482396 3300025961 Bacteria 1057
204 Ga0207668_10174021 3300025972 Bacteria 1691
205 Ga0207668_10261310 3300025972 Bacteria 1411
206 Ga0207640_10173928 3300025981 Bacteria 1608
207 Ga0207677_10341330 3300026023 Bacteria 1251
208 Ga0207639_10186546 3300026041 Bacteria 1769
209 Ga0207678_10429275 3300026067 Bacteria 1147
210 Ga0207708_10108582 3300026075 Bacteria 2152
211 Ga0207702_10547234 3300026078 Bacteria 1132
212 Ga0207702_10827434 3300026078 Bacteria 916
213 Ga0207674_10004342 3300026116 Bacteria 17098
214 Ga0207675_100007509 3300026118 Bacteria 10300
215 Ga0207675_100271040 3300026118 Bacteria 1647
216 Ga0207675_101212394 3300026118 Bacteria 775
217 Ga0207683_10004227 3300026121 Bacteria 12401
218 Ga0207428_10014285 3300027907 Bacteria 6911
219 Ga0207428_10047609 3300027907 Bacteria 3443
220 Ga0265337_1073516 3300028556 Archaea 938
221 Ga0265336_10079082 3300028666 Bacteria 982
222 Ga0265338_10034539 3300028800 Bacteria 4884
223 Ga0265330_10067882 3300031235 Bacteria 1545
224 Ga0265325_10026896 3300031241 Bacteria 3113
225 Ga0265339_10198533 3300031249 Bacteria 991
226 Ga0265316_10141543 3300031344 Bacteria 1806
227 Ga0307408_100091020 3300031548 Bacteria 2303
228 Ga0265313_10011881 3300031595 Bacteria 5378
229 Ga0307405_10017180 3300031731 Bacteria 3964
230 Ga0307405_10507320 3300031731 Bacteria 968
231 Ga0307410_10044124 3300031852 Bacteria 2959
232 Ga0307406_10040839 3300031901 Bacteria 2887
233 Ga0307407_10079163 3300031903 Bacteria 1982
234 Ga0307407_10327847 3300031903 Bacteria 1077
235 Ga0307409_100004903 3300031995 Bacteria 7613
236 Ga0307409_100005036 3300031995 Bacteria 7527
237 Ga0307416_100007365 3300032002 Bacteria 6990
238 Ga0307416_100448481 3300032002 Bacteria 1342
239 Ga0307414_10075805 3300032004 Bacteria 2442
240 Ga0307411_10020534 3300032005 Bacteria 3844
241 Ga0307411_10465424 3300032005 Unclassified 1061
242 Ga0307415_100029447 3300032126 Bacteria 3509
243 Ga0373958_0062690 3300034819 Bacteria 809
244 Ga0373959_0078015 3300034820 Bacteria 759
245 Ga0373928_0069391 3300035084 Bacteria 868
246 Ga0373951_0002870 3300035091 Bacteria 4285
247 Ga0373941_0057054 3300035115 Bacteria 1260
248 Ga0373957_0388238 3300035120 Bacteria 600
249 Ga0373960_0060044 3300035121 Bacteria 1151
250 Ga0373943_0109646 3300035170 Bacteria 1454
251 Ga0373942_0059789 3300035207 Unclassified 1090
252 Ga0373961_0019509 3300035241 Bacteria 1782
253 Ga0373962_0069026 3300035242 Unclassified 1052
254 Ga0373937_0382980 3300036401 Bacteria 1334
255 Ga0395899_0318678 3300037312 Bacteria 1048
256 Ga0395899_0767670 3300037312 Bacteria 598
257 Ga0395900_0462306 3300037418 Bacteria 1223
258 Ga0395898_0307226 3300037466 Bacteria 1513
259 Ga0395898_0557789 3300037466 Bacteria 1088
260 Ga0395905_1088326 3300037471 Bacteria 702
261 Ga0395905_1104890 3300037471 Bacteria 696
262 Ga0395905_1138908 3300037471 Bacteria 683
263 Ga0395901_0251795 3300038443 Bacteria 1840
264 Ga0395901_0753609 3300038443 Bacteria 966
265 Ga0242420_073782 3300038996 Bacteria 697
266 Ga0436360_0903022 3300039438 Bacteria 2760
267 Ga0439453_0050433 3300041408 Bacteria 840
268 Ga0451789_0116118 3300041443 Unclassified 805
269 Ga0451789_0662885 3300041443 Bacteria 1417
270 Ga0451791_1870565 3300041451 Bacteria 1247
271 Ga0451793_0173770 3300041452 Bacteria 1823
272 Ga0451797_0016269 3300041453 Unclassified 650
273 Ga0451795_1586022 3300041456 Bacteria 2186
274 Ga0451800_1078486 3300041459 Bacteria 1836
275 Ga0451833_0621089 3300041491 Bacteria 872
276 Ga0451833_0669844 3300041491 Bacteria 1329
277 Ga0451837_0350162 3300041494 Bacteria 3147
278 Ga0451839_0796626 3300041496 Bacteria 1490
279 Ga0451847_0565797 3300041503 Bacteria 1788
280 Ga0451849_0621177 3300041505 Bacteria 1665
281 Ga0451843_0923497 3300041509 Bacteria 1449
282 Ga0451855_0476695 3300041511 Bacteria 2217
283 Ga0451853_0200183 3300041512 Bacteria 1811
284 Ga0451853_1864643 3300041512 Bacteria 1305
285 Ga0451853_3996726 3300041512 Bacteria 1513
286 Ga0439448_0024253 3300042005 Bacteria 1896
287 Ga0439451_008709 3300042009 Bacteria 2056
288 Ga0439454_006187 3300042011 Bacteria 1462
289 Ga0439458_0006369 3300042157 Bacteria 2634
290 Ga0439458_0111480 3300042157 Unclassified 716
291 Ga0439460_0145991 3300042461 Bacteria 787
292 Ga0466965_0260724 3300044683 Bacteria 932
293 Ga0466966_0221267 3300044684 Unclassified 1143
294 Ga0466963_0010028 3300044694 Bacteria 5727
295 Ga0466963_0043625 3300044694 Bacteria 2950
296 Ga0466963_0275673 3300044694 Bacteria 1182
297 Ga0466963_0467087 3300044694 Bacteria 890
298 Ga0466963_0685449 3300044694 Bacteria 723
299 Ga0466957_0001359 3300044842 Bacteria 12773
300 Ga0466957_0085936 3300044842 Bacteria 1965
301 Ga0466957_0397861 3300044842 Bacteria 942
302 Ga0466960_0274761 3300044901 Bacteria 943
303 Ga0466960_0396901 3300044901 Unclassified 794
304 Ga0466959_0007939 3300045049 Bacteria 7475
305 Ga0466959_0165502 3300045049 Bacteria 1553
306 Ga0451576_0305237 3300045051 Bacteria 1665
307 Ga0466958_0002922 3300045836 Bacteria 8734
308 Ga0466958_0470621 3300045836 Bacteria 814
309 Ga0466967_0004246 3300045976 Bacteria 9621
310 Ga0466967_0021150 3300045976 Bacteria 5275
311 Ga0466967_0029832 3300045976 Bacteria 4570
312 Ga0466967_0034112 3300045976 Bacteria 4315
313 Ga0466967_0208853 3300045976 Bacteria 1851
314 Ga0466967_0735196 3300045976 Bacteria 978
315 Ga0466967_0861877 3300045976 Bacteria 900
316 Ga0495603_0175572 3300046455 Bacteria 1240
317 Ga0495653_0324773 3300046463 Bacteria 996
318 Ga0495618_0160587 3300046514 Bacteria 1433
319 Ga0495587_0238002 3300046536 Bacteria 1025
320 Ga0495587_0314939 3300046536 Bacteria 874
321 Ga0495659_0028400 3300046664 Bacteria 1936
322 Ga0495659_0093884 3300046664 Bacteria 1155
323 Ga0495581_0161884 3300047315 Bacteria 1308
324 Ga0495604_0073952 3300047317 Bacteria 2570
325 Ga0495680_0308436 3300047322 Bacteria 1110
326 Ga0495673_0289325 3300047469 Unclassified 590
327 Ga0496100_0051345 3300048903 Bacteria 2676
328 Ga0496100_1396930 3300048903 Bacteria 553
329 Ga0496102_0053298 3300048905 Bacteria 3687
330 Ga0496102_0478273 3300048905 Bacteria 1167
331 Ga0496103_0002186 3300048906 Bacteria 12417
332 Ga0496104_0191331 3300048907 Bacteria 1957
333 Ga0496106_0236429 3300048909 Bacteria 1459
334 Ga0496107_0143261 3300048910 Bacteria 1766
335 Ga0496108_0554886 3300048911 Bacteria 1002
336 Ga0496110_0180512 3300048913 Bacteria 1917
337 Ga0496111_0403036 3300048914 Bacteria 1011
338 Ga0496112_0167211 3300048915 Bacteria 2165
339 Ga0496112_0730148 3300048915 Bacteria 917
340 Ga0496112_1685437 3300048915 Unclassified 547
341 Ga0496113_0128949 3300048916 Bacteria 1983
342 Ga0496114_0198302 3300048917 Bacteria 1757
343 Ga0496115_0016217 3300048918 Bacteria 5669
344 Ga0496115_0192587 3300048918 Bacteria 1684
345 Ga0496115_0376037 3300048918 Bacteria 1156
346 Ga0501290_017445 3300049513 Bacteria 962
347 Ga0501031_0354068 3300049568 Bacteria 950
348 Ga0501034_0235738 3300049571 Bacteria 1778
349 Ga0501036_0364463 3300049572 Bacteria 1206
350 Ga0501037_0102172 3300049573 Bacteria 2068
351 Ga0501038_0114936 3300049574 Bacteria 2225
352 Ga0501039_0256901 3300049575 Bacteria 1373
353 Ga0501039_0431640 3300049575 Unclassified 1035
354 Ga0501040_0020093 3300049576 Bacteria 4449
355 Ga0501040_0264289 3300049576 Bacteria 1228
356 Ga0501040_0521487 3300049576 Unclassified 857
357 Ga0501041_0009918 3300049577 Bacteria 5610
358 Ga0501041_0052969 3300049577 Bacteria 2474
359 Ga0501042_0009288 3300049578 Bacteria 6545
360 Ga0501046_0171865 3300049580 Bacteria 1626
361 Ga0501048_0085279 3300049582 Bacteria 2227
362 Ga0501048_0106984 3300049582 Bacteria 1974
363 Ga0501067_0006659 3300049583 Bacteria 6411
364 Ga0501067_0443603 3300049583 Unclassified 725
365 Ga0501067_0634449 3300049583 Bacteria 599
366 Ga0501071_0007642 3300049587 Bacteria 7122
367 Ga0501071_0020568 3300049587 Bacteria 4587
368 Ga0501071_0115430 3300049587 Bacteria 1987
369 Ga0501072_0004916 3300049588 Bacteria 10164
370 Ga0501072_0018865 3300049588 Bacteria 5321
371 Ga0501072_0185153 3300049588 Unclassified 1661
372 Ga0501072_0483108 3300049588 Unclassified 980
373 Ga0501074_0064387 3300049590 Bacteria 2639
374 Ga0501074_0097949 3300049590 Bacteria 2099
375 Ga0501075_0001913 3300049591 Bacteria 13740
376 Ga0501075_0002294 3300049591 Bacteria 12687
377 Ga0501075_0146592 3300049591 Unclassified 1799
378 Ga0501075_0322309 3300049591 Bacteria 1177
379 Ga0501076_0008660 3300049592 Bacteria 7468
380 Ga0501076_0116780 3300049592 Bacteria 2159
381 Ga0501077_0002650 3300049593 Bacteria 10724
382 Ga0501077_0227718 3300049593 Unclassified 1185
383 Ga0501235_125294 3300049669 Bacteria 646
384 Ga0501079_0011840 3300049741 Bacteria 6659
385 Ga0501079_0081406 3300049741 Bacteria 2503
386 Ga0501079_0298493 3300049741 Bacteria 1260
387 Ga0501080_0064767 3300049742 Bacteria 3400
388 Ga0501081_0015271 3300049743 Bacteria 5065
389 Ga0501083_0553773 3300049744 Bacteria 748
390 Ga0501035_0692794 3300049822 Bacteria 822
391 Ga0501044_0506599 3300049823 Bacteria 1108
392 Ga0501045_0000821 3300049824 Bacteria 20089
393 Ga0501045_0012676 3300049824 Bacteria 5935
394 Ga0501045_0206634 3300049824 Bacteria 1463
395 Ga0501204_021690 3300049850 Bacteria 843
396 nmdc:mga05p37_549652_c1 3300050507 Bacteria 1315
397 nmdc:mga05p37_610337_c1 3300050507 Bacteria 1230
398 nmdc:mga05p37_87286_c1 3300050507 Bacteria 3845
399 nmdc:mga09592_12779_c1 3300050508 Bacteria 6844
400 nmdc:mga06r32_674425_c1 3300050510 Bacteria 1001
401 nmdc:mga08y16_302491_c1 3300050511 Bacteria 1648
402 nmdc:mga08y16_9952_c1 3300050511 Bacteria 9981
403 nmdc:mga0n895_334440_c1 3300050512 Bacteria 1534
404 nmdc:mga0rr50_11664_c1 3300050513 Bacteria 5639
405 nmdc:mga0rr50_1270877_c1 3300050513 Unclassified 625
406 nmdc:mga0rr50_153619_c1 3300050513 Bacteria 1863
407 nmdc:mga0rr50_560957_c1 3300050513 Unclassified 973
408 nmdc:mga08x19_10277_c1 3300050514 Bacteria 5618
409 nmdc:mga08x19_61257_c2 3300050514 Bacteria 1441
410 nmdc:mga0a205_570915_c1 3300050515 Bacteria 986
411 nmdc:mga0a205_596538_c1 3300050515 Bacteria 958
412 nmdc:mga0a205_68513_c1 3300050515 Bacteria 3427
413 nmdc:mga0a205_865865_c1 3300050515 Bacteria 751
414 Ga0495595_0170301 3300053084 Bacteria 1078
415 Ga0501084_0019447 3300054114 Bacteria 5658
416 Ga0501084_0152865 3300054114 Bacteria 1945
417 Ga0501084_0225572 3300054114 Bacteria 1581
418 Ga0501084_0476746 3300054114 Unclassified 1055
419 Ga0501082_0001799 3300060353 Bacteria 18877
420 Ga0501082_0242153 3300060353 Bacteria 1570
421 Ga0501082_0719866 3300060353 Bacteria 873
422 Ga0530510_0002953 3300061734 Bacteria 11664
423 Ga0530510_0075348 3300061734 Bacteria 2450
424 Ga0530510_0108113 3300061734 Unclassified 2036
425 Ga0530510_0170264 3300061734 Bacteria 1613
426 Ga0530510_0845757 3300061734 Bacteria 699
427 Ga0495584_0029652
428 rootL2_10131179
429 rootH1_10146211
430 JGI25407J50210_10022652
431 Ga0070676_10394569
432 Ga0070683_100183954
433 Ga0070683_100254087
434 Ga0070683_100352445
435 Ga0070683_100408826
436 Ga0070680_100210474
437 Ga0070680_100324244
438 Ga0070680_100350200
439 Ga0070682_100000785
440 Ga0070682_100023210
441 Ga0068868_100014906
442 Ga0068868_100498916
443 Ga0070660_100017792
444 Ga0070660_100241033
445 Ga0070660_100758881
446 Ga0070689_100870487
447 Ga0070661_100100774
448 Ga0070668_100239074
449 Ga0070673_101593609
450 Ga0070659_100423792
451 Ga0070659_100698783
452 Ga0070709_10436144
453 Ga0070709_10458042
454 Ga0070709_11253662
455 Ga0070714_100001136
456 Ga0070714_100022234
457 Ga0070714_100092310
458 Ga0070714_100198078
459 Ga0070713_100251699
460 Ga0070713_100273578
461 Ga0070710_10051132
462 Ga0070710_10645033
463 Ga0070701_10602037
464 Ga0070711_100366300
465 Ga0070711_100576069
466 Ga0070705_100487096
467 Ga0070678_100029329
468 Ga0070662_100035393
469 Ga0070662_100079559
470 Ga0070662_100783475
471 Ga0068867_100852740
472 Ga0070707_100151293
473 Ga0070698_100065859
474 Ga0070698_100093394
475 Ga0070698_100330024
476 Ga0070679_100056224
477 Ga0070679_100468073
478 Ga0068853_100162698
479 Ga0070686_100516923
480 Ga0070695_100471362
481 Ga0070696_100053043
482 Ga0070693_100010921
483 Ga0070704_100528583
484 Ga0068855_100209078
485 Ga0068855_100413277
486 Ga0068855_100575855
487 Ga0068857_100003516
488 Ga0068857_100447596
489 Ga0068854_100193399
490 Ga0068856_100067232
491 Ga0070702_100015171
492 Ga0068861_100053478
493 Ga0068861_100251536
494 Ga0068861_101235860
495 Ga0068861_101387592
496 Ga0068858_101772003
497 Ga0068860_101457045
498 Ga0081455_10003924
499 Ga0081455_10018451
500 Ga0081455_10025192
501 Ga0081455_10035948
502 Ga0081455_10049328
503 Ga0081455_10156582
504 Ga0081455_10370589
505 Ga0081455_10635149
506 Ga0081538_10001861
507 Ga0081538_10004939
508 Ga0081538_10039759
509 Ga0081538_10077175
510 Ga0081538_10133812
511 Ga0081540_1012448
512 Ga0081539_10000427
513 Ga0070717_10247919
514 Ga0070717_10308006
515 Ga0075432_10003234
516 Ga0075432_10024649
517 Ga0075432_10041109
518 Ga0070715_10128544
519 Ga0070716_100170566
520 Ga0070716_100260050
521 Ga0070716_100611775
522 Ga0070712_100611298
523 Ga0070712_100997332
524 Ga0097621_100019548
525 Ga0068871_100045611
526 Ga0075428_100261983
527 Ga0075428_100271021
528 Ga0075428_100781763
529 Ga0075430_100031417
530 Ga0075431_100066572
531 Ga0075431_100073286
532 Ga0075431_100217955
533 Ga0075433_10071780
534 Ga0075433_10561385
535 Ga0075434_100378181
536 Ga0075434_100395270
537 Ga0075429_100498819
538 Ga0075436_100011019
539 Ga0075436_100120864
540 Ga0075436_100212388
541 Ga0075435_100006855
542 Ga0075435_100070890
543 Ga0075435_101020369
544 Ga0105240_10222299
545 Ga0111539_10003022
546 Ga0111539_10022731
547 Ga0111539_10238866
548 Ga0105245_10031103
549 Ga0105245_10169949
550 Ga0105245_10255104
551 Ga0105245_10327020
552 Ga0114129_10075219
553 Ga0114129_10157661
554 Ga0114129_10392368
555 Ga0114129_11328050
556 Ga0105243_10027809
557 Ga0105241_10056394
558 Ga0105242_10126638
559 Ga0105249_10017937
560 Ga0105249_10055481
561 Ga0105249_10224492
562 Ga0105239_10032872
563 Ga0105239_10072141
564 Ga0105246_10206024
565 Ga0157373_10148110
566 Ga0157371_10111244
567 Ga0157370_10699374
568 Ga0157369_10900898
569 Ga0157378_10562137
570 Ga0163162_10223345
571 Ga0163162_10469737
572 Ga0157372_10110171
573 Ga0157375_10805173
574 Ga0182008_10001911
575 Ga0182008_10099737
576 Ga0182008_10372789
577 Ga0157377_10080330
578 Ga0157377_10669195
579 Ga0157376_10178780
580 Ga0206353_10993826
581 Ga0206353_11919178
582 Ga0207653_10012209
583 Ga0207682_10076569
584 Ga0207692_10058552
585 Ga0207692_10117843
586 Ga0207692_10188256
587 Ga0207688_10194902
588 Ga0207688_10262639
589 Ga0207685_10095402
590 Ga0207699_10078019
591 Ga0207699_10137288
592 Ga0207699_10394369
593 Ga0207707_10014186
594 Ga0207695_10557261
595 Ga0207693_10028688
596 Ga0207693_10029723
597 Ga0207693_10077428
598 Ga0207693_10324495
599 Ga0207663_10013999
600 Ga0207663_10171272
601 Ga0207663_10322068
602 Ga0207660_10067304
603 Ga0207660_10075245
604 Ga0207662_10335917
605 Ga0207657_10065893
606 Ga0207657_10113587
607 Ga0207652_10167938
608 Ga0207652_10257266
609 Ga0207646_10146239
610 Ga0207687_10018145
611 Ga0207687_10244661
612 Ga0207700_10598425
613 Ga0207664_10021537
614 Ga0207664_10072867
615 Ga0207664_10215189
616 Ga0207664_10240850
617 Ga0207664_10298693
618 Ga0207664_10322502
619 Ga0207706_10018632
620 Ga0207706_10067987
621 Ga0207686_10317220
622 Ga0207709_10984426
623 Ga0207704_10425452
624 Ga0207665_10001017
625 Ga0207661_10089762
626 Ga0207667_10614009
627 Ga0207712_10033424
628 Ga0207712_10384467
629 Ga0207712_10482396
630 Ga0207668_10174021
631 Ga0207668_10261310
632 Ga0207640_10173928
633 Ga0207677_10341330
634 Ga0207639_10186546
635 Ga0207678_10429275
636 Ga0207708_10108582
637 Ga0207702_10547234
638 Ga0207702_10827434
639 Ga0207674_10004342
640 Ga0207675_100007509
641 Ga0207675_100271040
642 Ga0207675_101212394
643 Ga0207683_10004227
644 Ga0207428_10014285
645 Ga0207428_10047609
646 Ga0265337_1073516
647 Ga0265336_10079082
648 Ga0265338_10034539
649 Ga0265330_10067882
650 Ga0265325_10026896
651 Ga0265339_10198533
652 Ga0265316_10141543
653 Ga0307408_100091020
654 Ga0265313_10011881
655 Ga0307405_10017180
656 Ga0307405_10507320
657 Ga0307410_10044124
658 Ga0307406_10040839
659 Ga0307407_10079163
660 Ga0307407_10327847
661 Ga0307409_100004903
662 Ga0307409_100005036
663 Ga0307416_100007365
664 Ga0307416_100448481
665 Ga0307414_10075805
666 Ga0307411_10020534
667 Ga0307411_10465424
668 Ga0307415_100029447
669 Ga0373958_0062690
670 Ga0373959_0078015
671 Ga0373928_0069391
672 Ga0373951_0002870
673 Ga0373941_0057054
674 Ga0373957_0388238
675 Ga0373960_0060044
676 Ga0373943_0109646
677 Ga0373942_0059789
678 Ga0373961_0019509
679 Ga0373962_0069026
680 Ga0373937_0382980
681 Ga0395899_0318678
682 Ga0395899_0767670
683 Ga0395900_0462306
684 Ga0395898_0307226
685 Ga0395898_0557789
686 Ga0395905_1088326
687 Ga0395905_1104890
688 Ga0395905_1138908
689 Ga0395901_0251795
690 Ga0395901_0753609
691 Ga0242420_073782
692 Ga0436360_0903022
693 Ga0439453_0050433
694 Ga0451789_0116118
695 Ga0451789_0662885
696 Ga0451791_1870565
697 Ga0451793_0173770
698 Ga0451797_0016269
699 Ga0451795_1586022
700 Ga0451800_1078486
701 Ga0451833_0621089
702 Ga0451833_0669844
703 Ga0451837_0350162
704 Ga0451839_0796626
705 Ga0451847_0565797
706 Ga0451849_0621177
707 Ga0451843_0923497
708 Ga0451855_0476695
709 Ga0451853_0200183
710 Ga0451853_1864643
711 Ga0451853_3996726
712 Ga0439448_0024253
713 Ga0439451_008709
714 Ga0439454_006187
715 Ga0439458_0006369
716 Ga0439458_0111480
717 Ga0439460_0145991
718 Ga0466965_0260724
719 Ga0466966_0221267
720 Ga0466963_0010028
721 Ga0466963_0043625
722 Ga0466963_0275673
723 Ga0466963_0467087
724 Ga0466963_0685449
725 Ga0466957_0001359
726 Ga0466957_0085936
727 Ga0466957_0397861
728 Ga0466960_0274761
729 Ga0466960_0396901
730 Ga0466959_0007939
731 Ga0466959_0165502
732 Ga0451576_0305237
733 Ga0466958_0002922
734 Ga0466958_0470621
735 Ga0466967_0004246
736 Ga0466967_0021150
737 Ga0466967_0029832
738 Ga0466967_0034112
739 Ga0466967_0208853
740 Ga0466967_0735196
741 Ga0466967_0861877
742 Ga0495603_0175572
743 Ga0495653_0324773
744 Ga0495618_0160587
745 Ga0495587_0238002
746 Ga0495587_0314939
747 Ga0495659_0028400
748 Ga0495659_0093884
749 Ga0495581_0161884
750 Ga0495604_0073952
751 Ga0495680_0308436
752 Ga0495673_0289325
753 Ga0496100_0051345
754 Ga0496100_1396930
755 Ga0496102_0053298
756 Ga0496102_0478273
757 Ga0496103_0002186
758 Ga0496104_0191331
759 Ga0496106_0236429
760 Ga0496107_0143261
761 Ga0496108_0554886
762 Ga0496110_0180512
763 Ga0496111_0403036
764 Ga0496112_0167211
765 Ga0496112_0730148
766 Ga0496112_1685437
767 Ga0496113_0128949
768 Ga0496114_0198302
769 Ga0496115_0016217
770 Ga0496115_0192587
771 Ga0496115_0376037
772 Ga0501290_017445
773 Ga0501031_0354068
774 Ga0501034_0235738
775 Ga0501036_0364463
776 Ga0501037_0102172
777 Ga0501038_0114936
778 Ga0501039_0256901
779 Ga0501039_0431640
780 Ga0501040_0020093
781 Ga0501040_0264289
782 Ga0501040_0521487
783 Ga0501041_0009918
784 Ga0501041_0052969
785 Ga0501042_0009288
786 Ga0501046_0171865
787 Ga0501048_0085279
788 Ga0501048_0106984
789 Ga0501067_0006659
790 Ga0501067_0443603
791 Ga0501067_0634449
792 Ga0501071_0007642
793 Ga0501071_0020568
794 Ga0501071_0115430
795 Ga0501072_0004916
796 Ga0501072_0018865
797 Ga0501072_0185153
798 Ga0501072_0483108
799 Ga0501074_0064387
800 Ga0501074_0097949
801 Ga0501075_0001913
802 Ga0501075_0002294
803 Ga0501075_0146592
804 Ga0501075_0322309
805 Ga0501076_0008660
806 Ga0501076_0116780
807 Ga0501077_0002650
808 Ga0501077_0227718
809 Ga0501235_125294
810 Ga0501079_0011840
811 Ga0501079_0081406
812 Ga0501079_0298493
813 Ga0501080_0064767
814 Ga0501081_0015271
815 Ga0501083_0553773
816 Ga0501035_0692794
817 Ga0501044_0506599
818 Ga0501045_0000821
819 Ga0501045_0012676
820 Ga0501045_0206634
821 Ga0501204_021690
822 nmdc:mga05p37_549652_c1
823 nmdc:mga05p37_610337_c1
824 nmdc:mga05p37_87286_c1
825 nmdc:mga09592_12779_c1
826 nmdc:mga06r32_674425_c1
827 nmdc:mga08y16_302491_c1
828 nmdc:mga08y16_9952_c1
829 nmdc:mga0n895_334440_c1
830 nmdc:mga0rr50_11664_c1
831 nmdc:mga0rr50_1270877_c1
832 nmdc:mga0rr50_153619_c1
833 nmdc:mga0rr50_560957_c1
834 nmdc:mga08x19_10277_c1
835 nmdc:mga08x19_61257_c2
836 nmdc:mga0a205_570915_c1
837 nmdc:mga0a205_596538_c1
838 nmdc:mga0a205_68513_c1
839 nmdc:mga0a205_865865_c1
840 Ga0495595_0170301
841 Ga0501084_0019447
842 Ga0501084_0152865
843 Ga0501084_0225572
844 Ga0501084_0476746
845 Ga0501082_0001799
846 Ga0501082_0242153
847 Ga0501082_0719866
848 Ga0530510_0002953
849 Ga0530510_0075348
850 Ga0530510_0108113
851 Ga0530510_0170264
852 Ga0530510_0845757

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02620

YceD

Large ribosomal RNA subunit accumulation protein YceD

91

198

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wxu-assembly1.cif.gz_D cryoem structure of mouse duox1-duoxa1 complex in the dimer-of-dimer state 0.5654 12 89
6hxv-assembly1.cif.gz_A crystal structure of the head and coiled-coil domains of zebrafish ccdc61 (f129e/d130a) 0.5171 11 81
4z3t-assembly2.cif.gz_B meningococcal factor h binding protein mutant l130r/g133d 0.5066 11 89
4z3t-assembly1.cif.gz_A meningococcal factor h binding protein mutant l130r/g133d 0.495 12 89
6hxv-assembly1.cif.gz_B crystal structure of the head and coiled-coil domains of zebrafish ccdc61 (f129e/d130a) 0.4851 12 65
ID Description Score Start End Superfamily
3ijlB01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.6491 15 61 3.30.390.10
af_Q2FWQ7_1_86_3.10.110.10 Alpha Beta;Roll;Ubiquitin Conjugating Enzyme;Ubiquitin Conjugating Enzyme 0.6242 9 59 3.10.110.10
5npcA04 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.574 16 61 2.60.40.1180
af_Q1HG44_10_286_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5709 16 124 1.20.140.150
3zgiC00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.5504 10 65 2.60.40.3400
ID Description Score Start End GO Terms
AF-A0A538FS42-F1-model_v4 Nitroreductase domain-containing protein 0.9418 2 169 GO:0016491
AF-A0A538I007-F1-model_v4 DUF177 domain-containing protein 0.9315 1 169
AF-A0A538I007-F1-model_v4 DUF177 domain-containing protein 0.9263 1 169
AF-A0A538FS42-F1-model_v4 Nitroreductase domain-containing protein 0.9256 2 169 GO:0016491
AF-A0A7V9BEM1-F1-model_v4 DUF177 domain-containing protein 0.907 1 169

Map