F441219

General Info

Members Datasets Scaffolds Average Seq Length
426 222 426 377

Family's Representative Sequence

Representative Sequence 3300025908|Ga0207643_10052373|Ga0207643_100523732
Length 424
Sequence MREFLQLVIAGAATGAIYSLIAAGLTVSYTATGIFNLAYGAIAFDSALLYYELNTGLGWSIVPAFLFVITTVVFFHELGHFWVARRFGVKVEVFSVGFGKEIFGWTDRLGTRWKVSWLPIGGYVKFAGDANAASQPDAAMAASMSDEERKGALLFKPLYQRALVAASGPLANFLLAIVILTGLSLYAGHTVIAPVIGQVTKGSPAEAAGIKPGDRVTRIDGTKITDFQQLPEIISISGGVPLEIGIHRGNQDLTFHISPRLMKTRDMLGNDTSQMVIGVRPDPKSPVTREHYGPVGALTQACADTWGIIKNTLLGIGQMIGGHASADQLRGPVGIANMTRQVADFGFLALLNLAAILSVSIGLANLFPIPLLDGGHLLYYACEAVLGRPLGARAQDVGFRLGLVVVLGLMLLTTWNDLVRLNLF

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
168 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
215 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
216 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
219 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
220 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.93
Nodule 0
Rhizoplane 0.47
Rhizosphere 91.78
Stem 0
Stem Tuber 0
Unclassified 2.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1006148 3300001915 Bacteria 2442
2 JGI24739J22299_10015693 3300001989 Bacteria 2751
3 JGI24737J22298_10001903 3300001990 Bacteria 7459
4 JGI24737J22298_10006075 3300001990 Bacteria 4140
5 JGI24738J21930_10001089 3300002075 Bacteria 7681
6 JGI25165J46597_1000003 3300003214 Bacteria 694080
7 JGI25153J46596_10001837 3300003215 Bacteria 12595
8 rootH1_10040959 3300003316 Bacteria 3903
9 rootH2_10019557 3300003320 Bacteria 10201
10 rootH2_10065308 3300003320 Bacteria 5460
11 rootH1_10057681 3300003323 Bacteria 2378
12 Ga0055536_1015755 3300003781 Bacteria 2568
13 Ga0055530_10005055 3300003791 Bacteria 6476
14 Ga0055543_1005495 3300004625 Bacteria 3220
15 Ga0065165_1000552 3300005262 Bacteria 56291
16 Ga0065165_1015362 3300005262 Bacteria 2922
17 Ga0070658_10005004 3300005327 Bacteria 10791
18 Ga0070658_10012724 3300005327 Bacteria 6748
19 Ga0070658_10019562 3300005327 Bacteria 5421
20 Ga0070658_10023596 3300005327 Bacteria 4936
21 Ga0070658_10050424 3300005327 Bacteria 3374
22 Ga0070658_10124262 3300005327 Bacteria 2147
23 Ga0070658_10134040 3300005327 Bacteria 2066
24 Ga0070658_10158104 3300005327 Bacteria 1900
25 Ga0070676_10005367 3300005328 Bacteria 6825
26 Ga0070676_10145003 3300005328 Bacteria 1515
27 Ga0070683_100101204 3300005329 Bacteria 2713
28 Ga0070670_100013846 3300005331 Bacteria 6916
29 Ga0068869_100002536 3300005334 Bacteria 11024
30 Ga0068869_100023876 3300005334 Bacteria 4231
31 Ga0070666_10007147 3300005335 Bacteria 6882
32 Ga0070680_100068039 3300005336 Bacteria 2923
33 Ga0070680_100093909 3300005336 Bacteria 2486
34 Ga0068868_100002195 3300005338 Bacteria 13466
35 Ga0068868_100144613 3300005338 Bacteria 1954
36 Ga0070660_100002162 3300005339 Bacteria 13542
37 Ga0070660_100009246 3300005339 Bacteria 6924
38 Ga0070660_100023488 3300005339 Bacteria 4567
39 Ga0070660_100027027 3300005339 Bacteria 4280
40 Ga0070660_100099572 3300005339 Bacteria 2302
41 Ga0070660_100120172 3300005339 Bacteria 2096
42 Ga0070660_100273826 3300005339 Bacteria 1380
43 Ga0070691_10000423 3300005341 Bacteria 15521
44 Ga0070661_100135344 3300005344 Bacteria 1854
45 Ga0070675_100021094 3300005354 Bacteria 5202
46 Ga0070675_100247582 3300005354 Bacteria 1559
47 Ga0070671_100019541 3300005355 Bacteria 5516
48 Ga0070673_100000007 3300005364 Bacteria 177157
49 Ga0070673_100010280 3300005364 Bacteria 6329
50 Ga0070659_100007064 3300005366 Bacteria 8135
51 Ga0070659_100050840 3300005366 Bacteria 3258
52 Ga0070659_100050954 3300005366 Bacteria 3254
53 Ga0070659_100063711 3300005366 Bacteria 2917
54 Ga0070667_100039076 3300005367 Bacteria 3977
55 Ga0070667_100091013 3300005367 Bacteria 2622
56 Ga0070714_100177360 3300005435 Bacteria 1937
57 Ga0070714_100436750 3300005435 Bacteria 1242
58 Ga0070663_100000403 3300005455 Bacteria 22668
59 Ga0070678_100015257 3300005456 Bacteria 4878
60 Ga0070678_100068442 3300005456 Bacteria 2647
61 Ga0070678_100084118 3300005456 Bacteria 2421
62 Ga0070678_100099642 3300005456 Bacteria 2249
63 Ga0070662_100029080 3300005457 Bacteria 3854
64 Ga0070681_10062911 3300005458 Bacteria 3683
65 Ga0068867_100000134 3300005459 Bacteria 47761
66 Ga0068867_100187490 3300005459 Bacteria 1648
67 Ga0070706_100189814 3300005467 Bacteria 1920
68 Ga0070707_100003620 3300005468 Bacteria 14574
69 Ga0070698_100088549 3300005471 Bacteria 3081
70 Ga0070679_100008702 3300005530 Bacteria 9567
71 Ga0070679_100082315 3300005530 Bacteria 3208
72 Ga0070684_100011438 3300005535 Bacteria 7071
73 Ga0070684_100041331 3300005535 Bacteria 3974
74 Ga0070684_100051432 3300005535 Bacteria 3579
75 Ga0068853_100032509 3300005539 Bacteria 4420
76 Ga0068853_100172317 3300005539 Bacteria 1959
77 Ga0070672_100047854 3300005543 Bacteria 3320
78 Ga0070672_100269293 3300005543 Bacteria 1438
79 Ga0070696_100017131 3300005546 Bacteria 4890
80 Ga0070693_100107666 3300005547 Bacteria 1709
81 Ga0070665_100000377 3300005548 Bacteria 66234
82 Ga0070665_100037793 3300005548 Bacteria 4853
83 Ga0070665_100049295 3300005548 Bacteria 4226
84 Ga0070665_100179404 3300005548 Bacteria 2119
85 Ga0068855_100000191 3300005563 Bacteria 79120
86 Ga0068855_100006185 3300005563 Bacteria 14593
87 Ga0068855_100013144 3300005563 Bacteria 9985
88 Ga0068855_100070161 3300005563 Bacteria 4077
89 Ga0068855_100080119 3300005563 Bacteria 3787
90 Ga0068855_100108976 3300005563 Bacteria 3181
91 Ga0068855_100445913 3300005563 Bacteria 1413
92 Ga0068857_100085592 3300005577 Bacteria 2818
93 Ga0068857_100145227 3300005577 Bacteria 2146
94 Ga0068857_100294940 3300005577 Bacteria 1494
95 Ga0068854_100000441 3300005578 Bacteria 25694
96 Ga0068854_100038621 3300005578 Bacteria 3359
97 Ga0068854_100054155 3300005578 Bacteria 2884
98 Ga0068854_100093558 3300005578 Bacteria 2240
99 Ga0068856_100028434 3300005614 Bacteria 5460
100 Ga0068856_100029264 3300005614 Bacteria 5380
101 Ga0068852_100001105 3300005616 Bacteria 17765
102 Ga0068852_100040990 3300005616 Bacteria 3911
103 Ga0068852_100332806 3300005616 Bacteria 1478
104 Ga0068859_100006956 3300005617 Bacteria 11487
105 Ga0068859_100074848 3300005617 Bacteria 3425
106 Ga0068864_100050995 3300005618 Bacteria 3563
107 Ga0068861_100099798 3300005719 Bacteria 2306
108 Ga0068851_10016646 3300005834 Bacteria 3522
109 Ga0068851_10062012 3300005834 Bacteria 1917
110 Ga0068863_100084716 3300005841 Bacteria 3004
111 Ga0068863_100096417 3300005841 Bacteria 2808
112 Ga0068858_100024740 3300005842 Bacteria 5591
113 Ga0068860_100087966 3300005843 Bacteria 2957
114 Ga0068862_100001399 3300005844 Bacteria 22376
115 Ga0097621_100015731 3300006237 Bacteria 5701
116 Ga0097621_100062502 3300006237 Bacteria 3057
117 Ga0097621_100188992 3300006237 Unclassified 1783
118 Ga0068871_100013750 3300006358 Bacteria 6017
119 Ga0068871_100090151 3300006358 Bacteria 2553
120 Ga0075428_100204187 3300006844 Bacteria 2136
121 Ga0075430_100009239 3300006846 Bacteria 8332
122 Ga0075431_100012391 3300006847 Bacteria 8605
123 Ga0075431_100028252 3300006847 Bacteria 5760
124 Ga0075434_100139400 3300006871 Bacteria 2444
125 Ga0068865_100000008 3300006881 Bacteria 177158
126 Ga0068865_100003560 3300006881 Bacteria 9349
127 Ga0068865_100007145 3300006881 Bacteria 6856
128 Ga0097620_100006956 3300006931 Bacteria 11487
129 Ga0097620_100074848 3300006931 Bacteria 3425
130 Ga0105240_10003858 3300009093 Bacteria 23159
131 Ga0105240_10010600 3300009093 Bacteria 12951
132 Ga0105240_10023658 3300009093 Bacteria 8116
133 Ga0105240_10171219 3300009093 Bacteria 2572
134 Ga0111539_10053366 3300009094 Bacteria 4812
135 Ga0111539_10163893 3300009094 Bacteria 2600
136 Ga0105245_10012670 3300009098 Bacteria 7343
137 Ga0105245_10018018 3300009098 Bacteria 6168
138 Ga0105243_10000615 3300009148 Bacteria 35494
139 Ga0105243_10311381 3300009148 Bacteria 1431
140 Ga0105241_10019748 3300009174 Bacteria 4973
141 Ga0105241_10152596 3300009174 Bacteria 1891
142 Ga0105241_10208380 3300009174 Bacteria 1637
143 Ga0105242_10002618 3300009176 Bacteria 14117
144 Ga0105248_10019043 3300009177 Bacteria 7589
145 Ga0105248_10022674 3300009177 Bacteria 6968
146 Ga0105248_10098656 3300009177 Bacteria 3291
147 Ga0105237_10017517 3300009545 Bacteria 7424
148 Ga0105237_10052611 3300009545 Bacteria 4087
149 Ga0105237_10133529 3300009545 Bacteria 2477
150 Ga0105237_10168581 3300009545 Bacteria 2189
151 Ga0105237_10181124 3300009545 Bacteria 2107
152 Ga0105238_10001957 3300009551 Bacteria 20734
153 Ga0105238_10088058 3300009551 Bacteria 3091
154 Ga0105238_10130683 3300009551 Bacteria 2489
155 Ga0105238_10238314 3300009551 Bacteria 1796
156 Ga0105239_10027853 3300010375 Bacteria 6216
157 Ga0105239_10082413 3300010375 Bacteria 3542
158 Ga0105239_10209781 3300010375 Bacteria 2183
159 Ga0105246_10002695 3300011119 Bacteria 10753
160 Ga0105246_10003704 3300011119 Bacteria 9252
161 Ga0157373_10042202 3300013100 Bacteria 3261
162 Ga0157373_10052967 3300013100 Bacteria 2886
163 Ga0157373_10160476 3300013100 Bacteria 1582
164 Ga0157370_10005885 3300013104 Bacteria 13673
165 Ga0157370_10047045 3300013104 Bacteria 4136
166 Ga0157370_10080066 3300013104 Bacteria 3076
167 Ga0157369_10113966 3300013105 Bacteria 2872
168 Ga0157369_10139420 3300013105 Bacteria 2567
169 Ga0157374_10003392 3300013296 Bacteria 13393
170 Ga0157374_10210711 3300013296 Bacteria 1905
171 Ga0157378_10004056 3300013297 Bacteria 12933
172 Ga0157378_10023956 3300013297 Bacteria 5369
173 Ga0157378_10227457 3300013297 Bacteria 1776
174 Ga0157372_10004098 3300013307 Bacteria 15629
175 Ga0157372_10108748 3300013307 Bacteria 3174
176 Ga0157375_10002835 3300013308 Bacteria 15009
177 Ga0157375_10061646 3300013308 Bacteria 3725
178 Ga0163163_10000374 3300014325 Bacteria 42870
179 Ga0157379_10042284 3300014968 Bacteria 4068
180 Ga0157376_10000315 3300014969 Bacteria 32437
181 Ga0157376_10007887 3300014969 Bacteria 7636
182 Ga0163161_10043984 3300017792 Bacteria 3215
183 Ga0163161_10084813 3300017792 Bacteria 2336
184 Ga0163161_10223642 3300017792 Bacteria 1458
185 Ga0213872_10000084 3300021361 Bacteria 86548
186 Ga0209026_1000864 3300025250 Bacteria 15837
187 Ga0209148_1000858 3300025254 Bacteria 21270
188 Ga0209233_1000015 3300025261 Bacteria 980563
189 Ga0209676_1000159 3300025292 Bacteria 161731
190 Ga0209758_1000013 3300025297 Bacteria 873003
191 Ga0209257_1004863 3300025304 Bacteria 9928
192 Ga0207688_10040507 3300025901 Bacteria 2589
193 Ga0207680_10017715 3300025903 Bacteria 3768
194 Ga0207647_10011032 3300025904 Bacteria 6355
195 Ga0207647_10029151 3300025904 Bacteria 3575
196 Ga0207647_10051629 3300025904 Bacteria 2540
197 Ga0207645_10040434 3300025907 Bacteria 2986
198 Ga0207645_10144478 3300025907 Bacteria 1551
199 Ga0207643_10052373 3300025908 Bacteria 2318
200 Ga0207705_10000022 3300025909 Bacteria 302232
201 Ga0207705_10000130 3300025909 Bacteria 82082
202 Ga0207705_10003928 3300025909 Bacteria 11299
203 Ga0207705_10005240 3300025909 Bacteria 9721
204 Ga0207705_10036413 3300025909 Bacteria 3522
205 Ga0207654_10005113 3300025911 Bacteria 6616
206 Ga0207707_10000839 3300025912 Bacteria 30215
207 Ga0207695_10003968 3300025913 Bacteria 20443
208 Ga0207695_10005722 3300025913 Bacteria 16380
209 Ga0207695_10010811 3300025913 Bacteria 11124
210 Ga0207671_10170077 3300025914 Bacteria 1692
211 Ga0207660_10000793 3300025917 Bacteria 20929
212 Ga0207660_10107032 3300025917 Bacteria 2098
213 Ga0207657_10000203 3300025919 Bacteria 61390
214 Ga0207657_10001521 3300025919 Bacteria 24853
215 Ga0207657_10002054 3300025919 Bacteria 21785
216 Ga0207657_10016307 3300025919 Bacteria 7170
217 Ga0207657_10061873 3300025919 Bacteria 3207
218 Ga0207657_10094690 3300025919 Bacteria 2486
219 Ga0207657_10107673 3300025919 Bacteria 2305
220 Ga0207657_10194667 3300025919 Bacteria 1634
221 Ga0207649_10158928 3300025920 Bacteria 1564
222 Ga0207652_10001704 3300025921 Bacteria 19206
223 Ga0207652_10056865 3300025921 Bacteria 3368
224 Ga0207646_10336794 3300025922 Bacteria 1363
225 Ga0207681_10076343 3300025923 Bacteria 2353
226 Ga0207694_10007105 3300025924 Bacteria 8508
227 Ga0207694_10025527 3300025924 Bacteria 4491
228 Ga0207694_10177213 3300025924 Bacteria 1727
229 Ga0207650_10054528 3300025925 Bacteria 2965
230 Ga0207650_10125046 3300025925 Bacteria 2006
231 Ga0207659_10049013 3300025926 Bacteria 2994
232 Ga0207687_10004193 3300025927 Bacteria 9642
233 Ga0207687_10017535 3300025927 Bacteria 4715
234 Ga0207664_10070395 3300025929 Bacteria 2815
235 Ga0207690_10030812 3300025932 Bacteria 3426
236 Ga0207686_10001743 3300025934 Bacteria 12088
237 Ga0207686_10120009 3300025934 Bacteria 1788
238 Ga0207709_10000399 3300025935 Bacteria 42600
239 Ga0207709_10020111 3300025935 Bacteria 3763
240 Ga0207670_10056249 3300025936 Bacteria 2662
241 Ga0207669_10121779 3300025937 Bacteria 1773
242 Ga0207704_10000013 3300025938 Bacteria 170478
243 Ga0207704_10025279 3300025938 Bacteria 3237
244 Ga0207704_10193010 3300025938 Bacteria 1483
245 Ga0207691_10017194 3300025940 Bacteria 6861
246 Ga0207691_10086937 3300025940 Bacteria 2805
247 Ga0207711_10014593 3300025941 Bacteria 6528
248 Ga0207711_10040707 3300025941 Bacteria 3954
249 Ga0207689_10000754 3300025942 Bacteria 31063
250 Ga0207667_10000113 3300025949 Bacteria 131083
251 Ga0207667_10018856 3300025949 Bacteria 7722
252 Ga0207667_10031448 3300025949 Bacteria 5730
253 Ga0207667_10067934 3300025949 Bacteria 3713
254 Ga0207667_10078080 3300025949 Bacteria 3432
255 Ga0207651_10000013 3300025960 Bacteria 177573
256 Ga0207651_10006987 3300025960 Bacteria 5976
257 Ga0207712_10008890 3300025961 Bacteria 6353
258 Ga0207640_10007830 3300025981 Bacteria 5898
259 Ga0207640_10018112 3300025981 Bacteria 4132
260 Ga0207640_10019147 3300025981 Bacteria 4039
261 Ga0207658_10201403 3300025986 Bacteria 1662
262 Ga0207677_10000449 3300026023 Bacteria 27867
263 Ga0207677_10008414 3300026023 Bacteria 5758
264 Ga0207703_10064797 3300026035 Bacteria 3001
265 Ga0207639_10005096 3300026041 Bacteria 8856
266 Ga0207678_10000499 3300026067 Bacteria 35709
267 Ga0207678_10016036 3300026067 Bacteria 6580
268 Ga0207702_10084838 3300026078 Bacteria 2759
269 Ga0207702_10147989 3300026078 Bacteria 2133
270 Ga0207641_10028410 3300026088 Bacteria 4622
271 Ga0207641_10085795 3300026088 Bacteria 2744
272 Ga0207648_10000382 3300026089 Bacteria 48961
273 Ga0207648_10055221 3300026089 Bacteria 3468
274 Ga0207648_10082518 3300026089 Bacteria 2803
275 Ga0207648_10113483 3300026089 Bacteria 2380
276 Ga0207676_10013048 3300026095 Bacteria 5966
277 Ga0207676_10049791 3300026095 Bacteria 3262
278 Ga0207676_10310302 3300026095 Bacteria 1444
279 Ga0207674_10024052 3300026116 Bacteria 6515
280 Ga0207674_10074982 3300026116 Bacteria 3394
281 Ga0207674_10185197 3300026116 Bacteria 2033
282 Ga0207675_100049854 3300026118 Bacteria 3906
283 Ga0207675_100101523 3300026118 Bacteria 2710
284 Ga0207683_10008792 3300026121 Bacteria 8622
285 Ga0207683_10143588 3300026121 Bacteria 2152
286 Ga0207683_10146454 3300026121 Bacteria 2130
287 Ga0207698_10063016 3300026142 Bacteria 2899
288 Ga0207698_10079681 3300026142 Bacteria 2635
289 Ga0207698_10192642 3300026142 Bacteria 1818
290 Ga0207698_10292554 3300026142 Bacteria 1512
291 Ga0268266_10000727 3300028379 Bacteria 44221
292 Ga0268266_10037054 3300028379 Bacteria 4155
293 Ga0268266_10063555 3300028379 Bacteria 3186
294 Ga0268266_10161343 3300028379 Bacteria 2028
295 Ga0268266_10161363 3300028379 Bacteria 2028
296 Ga0268266_10215418 3300028379 Bacteria 1763
297 Ga0268266_10360154 3300028379 Bacteria 1368
298 Ga0268265_10004064 3300028380 Bacteria 10285
299 Ga0268265_10158515 3300028380 Bacteria 1919
300 Ga0268264_10070859 3300028381 Bacteria 2952
301 Ga0265336_10037854 3300028666 Bacteria 1482
302 Ga0265338_10004191 3300028800 Bacteria 19669
303 Ga0265338_10039377 3300028800 Bacteria 4459
304 Ga0265325_10000677 3300031241 Bacteria 24870
305 Ga0265339_10017279 3300031249 Bacteria 4277
306 Ga0265331_10001999 3300031250 Bacteria 14208
307 Ga0265316_10056140 3300031344 Bacteria 3078
308 Ga0265313_10016352 3300031595 Bacteria 4268
309 Ga0265314_10010539 3300031711 Bacteria 7697
310 Ga0265314_10044776 3300031711 Bacteria 3133
311 Ga0265342_10047500 3300031712 Bacteria 2576
312 Ga0265342_10074587 3300031712 Unclassified 1971
313 Ga0307516_10039077 3300031730 Bacteria 4732
314 Ga0307516_10045580 3300031730 Bacteria 4330
315 Ga0307412_10015956 3300031911 Bacteria 4463
316 Ga0307510_10011693 3300033180 Bacteria 10421
317 Ga0373931_0188846 3300035691 Bacteria 1225
318 Ga0373947_0144687 3300035725 Bacteria 1527
319 Ga0373937_0248776 3300036401 Bacteria 1675
320 Ga0373925_0003618 3300037068 Bacteria 11903
321 Ga0395900_0005115 3300037418 Bacteria 13770
322 Ga0395900_0011629 3300037418 Bacteria 9007
323 Ga0395900_0016611 3300037418 Bacteria 7507
324 Ga0395898_0006645 3300037466 Bacteria 12332
325 Ga0395898_0023177 3300037466 Bacteria 6275
326 Ga0395905_0003634 3300037471 Bacteria 16385
327 Ga0395905_0045706 3300037471 Bacteria 4107
328 Ga0395905_0059030 3300037471 Bacteria 3587
329 Ga0395905_0141608 3300037471 Bacteria 2262
330 Ga0395901_0008989 3300038443 Bacteria 10115
331 Ga0395901_0075654 3300038443 Bacteria 3512
332 Ga0436361_0103120 3300039447 Bacteria 123137
333 Ga0450905_000092 3300042142 Bacteria 8624
334 Ga0450889_000083 3300042144 Bacteria 8655
335 Ga0495629_0020400 3300046459 Bacteria 4733
336 Ga0495582_0079810 3300046473 Unclassified 1817
337 Ga0495585_0051163 3300046492 Bacteria 2290
338 Ga0495665_0113593 3300046531 Unclassified 1420
339 Ga0495587_0022075 3300046536 Bacteria 3921
340 Ga0495609_0039802 3300046538 Bacteria 2115
341 Ga0495668_0054919 3300046616 Bacteria 2200
342 Ga0495657_0093946 3300046675 Bacteria 1919
343 Ga0495599_0127958 3300046678 Bacteria 1578
344 Ga0495658_0004657 3300046683 Bacteria 6749
345 Ga0495669_0006038 3300046684 Bacteria 5053
346 Ga0495589_0037348 3300046794 Bacteria 2434
347 Ga0495686_0006477 3300047472 Bacteria 8953
348 Ga0495602_0033661 3300048088 Bacteria 4804
349 Ga0496108_0000190 3300048911 Bacteria 57059
350 Ga0496108_0020793 3300048911 Bacteria 5396
351 Ga0496119_0102012 3300048922 Bacteria 1609
352 Ga0496120_0016158 3300048923 Bacteria 4887
353 Ga0496121_0001453 3300048924 Bacteria 40007
354 Ga0496125_0046168 3300048928 Bacteria 3657
355 Ga0501031_0013123 3300049568 Bacteria 5405
356 Ga0501031_0079513 3300049568 Bacteria 2137
357 Ga0501032_0002879 3300049569 Bacteria 13385
358 Ga0501032_0144620 3300049569 Bacteria 1565
359 Ga0501033_0014472 3300049570 Bacteria 5990
360 Ga0501033_0022801 3300049570 Bacteria 4720
361 Ga0501033_0028576 3300049570 Bacteria 4189
362 Ga0501033_0035696 3300049570 Bacteria 3727
363 Ga0501033_0039654 3300049570 Bacteria 3518
364 Ga0501033_0046752 3300049570 Bacteria 3218
365 Ga0501034_0238050 3300049571 Bacteria 1767
366 Ga0501036_0025013 3300049572 Bacteria 5035
367 Ga0501036_0112942 3300049572 Bacteria 2296
368 Ga0501037_0131954 3300049573 Bacteria 1791
369 Ga0501038_0004396 3300049574 Bacteria 13117
370 Ga0501038_0057329 3300049574 Bacteria 3345
371 Ga0501038_0059057 3300049574 Bacteria 3286
372 Ga0501038_0102465 3300049574 Bacteria 2382
373 Ga0501038_0209037 3300049574 Bacteria 1562
374 Ga0501039_0001573 3300049575 Bacteria 16801
375 Ga0501043_0080948 3300049579 Bacteria 2551
376 Ga0501043_0194448 3300049579 Bacteria 1576
377 Ga0501047_0010032 3300049581 Bacteria 8955
378 Ga0501047_0010315 3300049581 Bacteria 8835
379 Ga0501047_0039830 3300049581 Bacteria 4545
380 Ga0501047_0066455 3300049581 Bacteria 3476
381 Ga0501047_0124908 3300049581 Bacteria 2454
382 Ga0501047_0194765 3300049581 Bacteria 1889
383 Ga0501047_0251320 3300049581 Bacteria 1616
384 Ga0501048_0003926 3300049582 Bacteria 11295
385 Ga0501067_0003131 3300049583 Bacteria 9134
386 Ga0501067_0015927 3300049583 Bacteria 4159
387 Ga0501068_0116670 3300049584 Bacteria 1663
388 Ga0501070_0000002 3300049586 Bacteria 347524
389 Ga0501072_0036069 3300049588 Bacteria 3876
390 Ga0501073_0000802 3300049589 Bacteria 22364
391 Ga0501074_0000138 3300049590 Bacteria 37896
392 Ga0501079_0007294 3300049741 Bacteria 8348
393 Ga0501080_0001693 3300049742 Bacteria 18802
394 Ga0501080_0008063 3300049742 Bacteria 9546
395 Ga0501083_0011493 3300049744 Bacteria 6212
396 Ga0501035_0012091 3300049822 Bacteria 7980
397 Ga0501035_0016285 3300049822 Bacteria 6859
398 Ga0501035_0025001 3300049822 Bacteria 5476
399 Ga0501035_0048058 3300049822 Bacteria 3827
400 Ga0501035_0049399 3300049822 Bacteria 3770
401 Ga0501035_0161780 3300049822 Bacteria 1937
402 Ga0501044_0005749 3300049823 Bacteria 13727
403 Ga0501044_0010085 3300049823 Bacteria 10265
404 Ga0501044_0011515 3300049823 Bacteria 9583
405 Ga0501044_0021535 3300049823 Bacteria 6875
406 Ga0501044_0024176 3300049823 Bacteria 6454
407 Ga0501044_0081810 3300049823 Bacteria 3268
408 Ga0501044_0147519 3300049823 Bacteria 2336
409 Ga0501044_0179842 3300049823 Bacteria 2082
410 Ga0501044_0431968 3300049823 Bacteria 1226
411 Ga0501045_0034862 3300049824 Bacteria 3653
412 nmdc:mga08y16_435247_c1 3300050511 Bacteria 1339
413 nmdc:mga08y16_49049_c1 3300050511 Bacteria 4418
414 nmdc:mga0n895_136117_c1 3300050512 Bacteria 2483
415 nmdc:mga0sz30_96193_c1 3300050516 Bacteria 1291
416 Ga0500643_000003 3300053087 Bacteria 876659
417 Ga0500555_011904 3300053103 Bacteria 2501
418 Ga0500595_000573 3300053119 Bacteria 21954
419 Ga0500595_024486 3300053119 Bacteria 2106
420 Ga0500568_0017453 3300053139 Bacteria 3169
421 Ga0500573_0000008 3300053140 Bacteria 237795
422 Ga0500637_0000421 3300053178 Bacteria 16209
423 Ga0500645_001797 3300053730 Bacteria 10293
424 Ga0501084_0001765 3300054114 Bacteria 17203
425 Ga0501082_0009503 3300060353 Bacteria 8369
426 Ga0501082_0023627 3300060353 Bacteria 5303

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031712 Ga0265342_10047500 Ga0265342_100475002 339
2 3300006844 Ga0075428_100204187 Ga0075428_1002041872 341
3 3300006846 Ga0075430_100009239 Ga0075430_1000092392 341
4 3300006847 Ga0075431_100012391 Ga0075431_10001239110 341
5 3300006847 Ga0075431_100028252 Ga0075431_1000282521 343
6 3300031911 Ga0307412_10015956 Ga0307412_100159562 343
7 3300049823 Ga0501044_0431968 Ga0501044_0431968_170_1213 343
8 3300050511 nmdc:mga08y16_435247_c1 nmdc:mga08y16_435247_c1_181_1326 343
9 3300031711 Ga0265314_10044776 Ga0265314_100447762 352
10 3300049574 Ga0501038_0102465 Ga0501038_0102465_705_1799 352
11 3300053087 Ga0500643_000003 Ga0500643_000003_501604_502740 353
12 3300033180 Ga0307510_10011693 Ga0307510_100116936 354
13 3300046794 Ga0495589_0037348 Ga0495589_0037348_340_1476 354
14 3300049583 Ga0501067_0015927 Ga0501067_0015927_840_1985 354
15 3300006871 Ga0075434_100139400 Ga0075434_1001394002 355
16 3300013100 Ga0157373_10042202 Ga0157373_100422022 355
17 3300050512 nmdc:mga0n895_136117_c1 nmdc:mga0n895_136117_c1_768_1913 355
18 3300053139 Ga0500568_0017453 Ga0500568_0017453_199_1335 355
19 3300005327 Ga0070658_10023596 Ga0070658_100235962 357
20 3300005335 Ga0070666_10007147 Ga0070666_100071477 357
21 3300005338 Ga0068868_100144613 Ga0068868_1001446132 357
22 3300005367 Ga0070667_100091013 Ga0070667_1000910132 357
23 3300005456 Ga0070678_100015257 Ga0070678_1000152572 357
24 3300005535 Ga0070684_100051432 Ga0070684_1000514322 357
25 3300005547 Ga0070693_100107666 Ga0070693_1001076661 357
26 3300005614 Ga0068856_100028434 Ga0068856_1000284342 357
27 3300005842 Ga0068858_100024740 Ga0068858_1000247406 357
28 3300005843 Ga0068860_100087966 Ga0068860_1000879662 357
29 3300006237 Ga0097621_100062502 Ga0097621_1000625022 357
30 3300006358 Ga0068871_100090151 Ga0068871_1000901512 357
31 3300006881 Ga0068865_100003560 Ga0068865_1000035604 357
32 3300009093 Ga0105240_10171219 Ga0105240_101712192 357
33 3300009174 Ga0105241_10019748 Ga0105241_100197482 357
34 3300009174 Ga0105241_10152596 Ga0105241_101525962 357
35 3300009551 Ga0105238_10130683 Ga0105238_101306832 357
36 3300011119 Ga0105246_10003704 Ga0105246_100037048 357
37 3300013296 Ga0157374_10210711 Ga0157374_102107112 357
38 3300013308 Ga0157375_10061646 Ga0157375_100616463 357
39 3300014969 Ga0157376_10007887 Ga0157376_100078872 357
40 3300017792 Ga0163161_10084813 Ga0163161_100848132 357
41 3300025903 Ga0207680_10017715 Ga0207680_100177152 357
42 3300025909 Ga0207705_10036413 Ga0207705_100364133 357
43 3300025911 Ga0207654_10005113 Ga0207654_100051132 357
44 3300025925 Ga0207650_10125046 Ga0207650_101250462 357
45 3300025938 Ga0207704_10025279 Ga0207704_100252792 357
46 3300026035 Ga0207703_10064797 Ga0207703_100647972 357
47 3300026078 Ga0207702_10084838 Ga0207702_100848382 357
48 3300026089 Ga0207648_10113483 Ga0207648_101134832 357
49 3300026095 Ga0207676_10049791 Ga0207676_100497912 357
50 3300026118 Ga0207675_100101523 Ga0207675_1001015232 357
51 3300026121 Ga0207683_10008792 Ga0207683_100087922 357
52 3300026142 Ga0207698_10292554 Ga0207698_102925541 357
53 3300028381 Ga0268264_10070859 Ga0268264_100708592 357
54 3300005577 Ga0068857_100085592 Ga0068857_1000855922 358
55 3300014968 Ga0157379_10042284 Ga0157379_100422844 358
56 3300025901 Ga0207688_10040507 Ga0207688_100405073 358
57 3300025927 Ga0207687_10017535 Ga0207687_100175352 358
58 3300025936 Ga0207670_10056249 Ga0207670_100562492 358
59 3300025960 Ga0207651_10006987 Ga0207651_100069872 358
60 3300026089 Ga0207648_10055221 Ga0207648_100552212 358
61 3300035691 Ga0373931_0188846 Ga0373931_0188846_25_1122 358
62 3300046675 Ga0495657_0093946 Ga0495657_0093946_29_1126 358
63 3300049569 Ga0501032_0144620 Ga0501032_0144620_146_1285 359
64 3300049570 Ga0501033_0039654 Ga0501033_0039654_1855_2994 359
65 3300049574 Ga0501038_0209037 Ga0501038_0209037_322_1461 359
66 3300049581 Ga0501047_0124908 Ga0501047_0124908_535_1674 359
67 3300049586 Ga0501070_0000002 Ga0501070_0000002_142570_143709 359
68 3300049742 Ga0501080_0001693 Ga0501080_0001693_12616_13755 359
69 3300031250 Ga0265331_10001999 Ga0265331_100019993 360
70 3300003214 JGI25165J46597_1000003 JGI25165J46597_100000342 364
71 3300005366 Ga0070659_100063711 Ga0070659_1000637112 364
72 3300005367 Ga0070667_100039076 Ga0070667_1000390765 364
73 3300005467 Ga0070706_100189814 Ga0070706_1001898142 364
74 3300005468 Ga0070707_100003620 Ga0070707_1000036203 364
75 3300005471 Ga0070698_100088549 Ga0070698_1000885493 364
76 3300005546 Ga0070696_100017131 Ga0070696_1000171313 364
77 3300005563 Ga0068855_100108976 Ga0068855_1001089762 364
78 3300009094 Ga0111539_10053366 Ga0111539_100533662 364
79 3300009148 Ga0105243_10311381 Ga0105243_103113812 364
80 3300025261 Ga0209233_1000015 Ga0209233_1000015737 364
81 3300025922 Ga0207646_10336794 Ga0207646_103367941 364
82 3300025986 Ga0207658_10201403 Ga0207658_102014032 364
83 3300042142 Ga0450905_000092 Ga0450905_000092_2209_3327 364
84 3300042144 Ga0450889_000083 Ga0450889_000083_5436_6554 364
85 3300050511 nmdc:mga08y16_49049_c1 nmdc:mga08y16_49049_c1_2024_3142 364
86 3300050516 nmdc:mga0sz30_96193_c1 nmdc:mga0sz30_96193_c1_45_1178 364
87 3300028379 Ga0268266_10215418 Ga0268266_102154182 365
88 3300035725 Ga0373947_0144687 Ga0373947_0144687_231_1367 365
89 3300036401 Ga0373937_0248776 Ga0373937_0248776_258_1394 365
90 3300037068 Ga0373925_0003618 Ga0373925_0003618_5844_6980 365
91 3300046459 Ga0495629_0020400 Ga0495629_0020400_608_1744 365
92 3300046616 Ga0495668_0054919 Ga0495668_0054919_516_1730 365
93 3300046683 Ga0495658_0004657 Ga0495658_0004657_3961_5097 365
94 3300003215 JGI25153J46596_10001837 JGI25153J46596_1000183711 366
95 3300003320 rootH2_10019557 rootH2_100195577 366
96 3300003781 Ga0055536_1015755 Ga0055536_10157552 366
97 3300005327 Ga0070658_10019562 Ga0070658_100195622 366
98 3300005328 Ga0070676_10145003 Ga0070676_101450032 366
99 3300005334 Ga0068869_100023876 Ga0068869_1000238762 366
100 3300005336 Ga0070680_100093909 Ga0070680_1000939092 366
101 3300005339 Ga0070660_100002162 Ga0070660_1000021627 366
102 3300005339 Ga0070660_100099572 Ga0070660_1000995722 366
103 3300005339 Ga0070660_100120172 Ga0070660_1001201721 366
104 3300005341 Ga0070691_10000423 Ga0070691_100004238 366
105 3300005354 Ga0070675_100247582 Ga0070675_1002475821 366
106 3300005364 Ga0070673_100010280 Ga0070673_1000102804 366
107 3300005366 Ga0070659_100007064 Ga0070659_1000070647 366
108 3300005366 Ga0070659_100050840 Ga0070659_1000508402 366
109 3300005435 Ga0070714_100177360 Ga0070714_1001773602 366
110 3300005435 Ga0070714_100436750 Ga0070714_1004367501 366
111 3300005456 Ga0070678_100084118 Ga0070678_1000841182 366
112 3300005456 Ga0070678_100099642 Ga0070678_1000996421 366
113 3300005459 Ga0068867_100187490 Ga0068867_1001874902 366
114 3300005530 Ga0070679_100008702 Ga0070679_1000087022 366
115 3300005535 Ga0070684_100041331 Ga0070684_1000413312 366
116 3300005548 Ga0070665_100000377 Ga0070665_10000037758 366
117 3300005548 Ga0070665_100037793 Ga0070665_1000377932 366
118 3300005548 Ga0070665_100049295 Ga0070665_1000492954 366
119 3300005548 Ga0070665_100179404 Ga0070665_1001794042 366
120 3300005563 Ga0068855_100006185 Ga0068855_10000618512 366
121 3300005563 Ga0068855_100013144 Ga0068855_1000131443 366
122 3300005563 Ga0068855_100070161 Ga0068855_1000701612 366
123 3300005563 Ga0068855_100445913 Ga0068855_1004459131 366
124 3300005577 Ga0068857_100145227 Ga0068857_1001452272 366
125 3300005577 Ga0068857_100294940 Ga0068857_1002949401 366
126 3300005578 Ga0068854_100054155 Ga0068854_1000541553 366
127 3300005719 Ga0068861_100099798 Ga0068861_1000997982 366
128 3300006237 Ga0097621_100188992 Ga0097621_1001889922 366
129 3300006358 Ga0068871_100013750 Ga0068871_1000137506 366
130 3300009093 Ga0105240_10003858 Ga0105240_100038587 366
131 3300009093 Ga0105240_10010600 Ga0105240_100106008 366
132 3300009093 Ga0105240_10023658 Ga0105240_100236586 366
133 3300009098 Ga0105245_10012670 Ga0105245_100126704 366
134 3300009174 Ga0105241_10208380 Ga0105241_102083802 366
135 3300009177 Ga0105248_10098656 Ga0105248_100986563 366
136 3300009545 Ga0105237_10017517 Ga0105237_100175176 366
137 3300009545 Ga0105237_10133529 Ga0105237_101335292 366
138 3300009545 Ga0105237_10181124 Ga0105237_101811242 366
139 3300009551 Ga0105238_10001957 Ga0105238_1000195712 366
140 3300009551 Ga0105238_10088058 Ga0105238_100880583 366
141 3300009551 Ga0105238_10238314 Ga0105238_102383142 366
142 3300010375 Ga0105239_10027853 Ga0105239_100278532 366
143 3300010375 Ga0105239_10209781 Ga0105239_102097812 366
144 3300013100 Ga0157373_10160476 Ga0157373_101604762 366
145 3300013104 Ga0157370_10005885 Ga0157370_100058859 366
146 3300013104 Ga0157370_10047045 Ga0157370_100470454 366
147 3300013297 Ga0157378_10023956 Ga0157378_100239562 366
148 3300013307 Ga0157372_10004098 Ga0157372_100040987 366
149 3300014325 Ga0163163_10000374 Ga0163163_1000037431 366
150 3300025292 Ga0209676_1000159 Ga0209676_1000159155 366
151 3300025297 Ga0209758_1000013 Ga0209758_1000013391 366
152 3300025907 Ga0207645_10144478 Ga0207645_101444782 366
153 3300025909 Ga0207705_10000130 Ga0207705_1000013041 366
154 3300025909 Ga0207705_10005240 Ga0207705_100052404 366
155 3300025912 Ga0207707_10000839 Ga0207707_1000083915 366
156 3300025913 Ga0207695_10003968 Ga0207695_1000396810 366
157 3300025913 Ga0207695_10005722 Ga0207695_100057221 366
158 3300025913 Ga0207695_10010811 Ga0207695_100108119 366
159 3300025914 Ga0207671_10170077 Ga0207671_101700772 366
160 3300025917 Ga0207660_10000793 Ga0207660_100007938 366
161 3300025917 Ga0207660_10107032 Ga0207660_101070322 366
162 3300025919 Ga0207657_10000203 Ga0207657_1000020312 366
163 3300025919 Ga0207657_10061873 Ga0207657_100618733 366
164 3300025919 Ga0207657_10107673 Ga0207657_101076732 366
165 3300025921 Ga0207652_10001704 Ga0207652_100017048 366
166 3300025921 Ga0207652_10056865 Ga0207652_100568652 366
167 3300025924 Ga0207694_10007105 Ga0207694_100071053 366
168 3300025924 Ga0207694_10025527 Ga0207694_100255273 366
169 3300025924 Ga0207694_10177213 Ga0207694_101772132 366
170 3300025929 Ga0207664_10070395 Ga0207664_100703952 366
171 3300025932 Ga0207690_10030812 Ga0207690_100308122 366
172 3300025934 Ga0207686_10120009 Ga0207686_101200091 366
173 3300025935 Ga0207709_10020111 Ga0207709_100201112 366
174 3300025941 Ga0207711_10040707 Ga0207711_100407072 366
175 3300025949 Ga0207667_10018856 Ga0207667_100188567 366
176 3300025949 Ga0207667_10031448 Ga0207667_100314482 366
177 3300025949 Ga0207667_10078080 Ga0207667_100780803 366
178 3300025961 Ga0207712_10008890 Ga0207712_100088904 366
179 3300025981 Ga0207640_10019147 Ga0207640_100191472 366
180 3300026023 Ga0207677_10008414 Ga0207677_100084142 366
181 3300026088 Ga0207641_10028410 Ga0207641_100284102 366
182 3300026089 Ga0207648_10082518 Ga0207648_100825182 366
183 3300026095 Ga0207676_10310302 Ga0207676_103103022 366
184 3300026116 Ga0207674_10074982 Ga0207674_100749822 366
185 3300026116 Ga0207674_10185197 Ga0207674_101851972 366
186 3300026118 Ga0207675_100049854 Ga0207675_1000498544 366
187 3300026121 Ga0207683_10143588 Ga0207683_101435882 366
188 3300026121 Ga0207683_10146454 Ga0207683_101464542 366
189 3300028379 Ga0268266_10000727 Ga0268266_1000072725 366
190 3300028379 Ga0268266_10037054 Ga0268266_100370542 366
191 3300028379 Ga0268266_10063555 Ga0268266_100635552 366
192 3300028379 Ga0268266_10161343 Ga0268266_101613432 366
193 3300028379 Ga0268266_10161363 Ga0268266_101613632 366
194 3300028379 Ga0268266_10360154 Ga0268266_103601542 366
195 3300028380 Ga0268265_10158515 Ga0268265_101585152 366
196 3300028800 Ga0265338_10004191 Ga0265338_1000419113 366
197 3300031241 Ga0265325_10000677 Ga0265325_1000067711 366
198 3300031249 Ga0265339_10017279 Ga0265339_100172792 366
199 3300031344 Ga0265316_10056140 Ga0265316_100561403 366
200 3300031595 Ga0265313_10016352 Ga0265313_100163524 366
201 3300031712 Ga0265342_10074587 Ga0265342_100745872 366
202 3300031730 Ga0307516_10039077 Ga0307516_100390772 366
203 3300031730 Ga0307516_10045580 Ga0307516_100455805 366
204 3300037418 Ga0395900_0011629 Ga0395900_0011629_5367_6503 366
205 3300037418 Ga0395900_0016611 Ga0395900_0016611_4942_6078 366
206 3300037466 Ga0395898_0006645 Ga0395898_0006645_2152_3288 366
207 3300037466 Ga0395898_0023177 Ga0395898_0023177_3635_4771 366
208 3300038443 Ga0395901_0075654 Ga0395901_0075654_841_1977 366
209 3300046473 Ga0495582_0079810 Ga0495582_0079810_420_1556 366
210 3300046492 Ga0495585_0051163 Ga0495585_0051163_393_1529 366
211 3300046531 Ga0495665_0113593 Ga0495665_0113593_43_1242 366
212 3300046536 Ga0495587_0022075 Ga0495587_0022075_2592_3728 366
213 3300046538 Ga0495609_0039802 Ga0495609_0039802_66_1202 366
214 3300046678 Ga0495599_0127958 Ga0495599_0127958_367_1503 366
215 3300048088 Ga0495602_0033661 Ga0495602_0033661_2023_3159 366
216 3300048924 Ga0496121_0001453 Ga0496121_0001453_18775_19911 366
217 3300049568 Ga0501031_0013123 Ga0501031_0013123_3663_4805 366
218 3300049568 Ga0501031_0079513 Ga0501031_0079513_162_1298 366
219 3300049569 Ga0501032_0002879 Ga0501032_0002879_4269_5411 366
220 3300049570 Ga0501033_0014472 Ga0501033_0014472_2935_4071 366
221 3300049570 Ga0501033_0022801 Ga0501033_0022801_2726_3862 366
222 3300049570 Ga0501033_0028576 Ga0501033_0028576_2575_3717 366
223 3300049570 Ga0501033_0035696 Ga0501033_0035696_1382_2524 366
224 3300049570 Ga0501033_0046752 Ga0501033_0046752_1321_2457 366
225 3300049571 Ga0501034_0238050 Ga0501034_0238050_170_1306 366
226 3300049572 Ga0501036_0025013 Ga0501036_0025013_3651_4793 366
227 3300049572 Ga0501036_0112942 Ga0501036_0112942_419_1555 366
228 3300049573 Ga0501037_0131954 Ga0501037_0131954_96_1238 366
229 3300049574 Ga0501038_0004396 Ga0501038_0004396_7669_8811 366
230 3300049574 Ga0501038_0057329 Ga0501038_0057329_133_1269 366
231 3300049574 Ga0501038_0059057 Ga0501038_0059057_1040_2182 366
232 3300049575 Ga0501039_0001573 Ga0501039_0001573_7229_8371 366
233 3300049579 Ga0501043_0080948 Ga0501043_0080948_1319_2461 366
234 3300049579 Ga0501043_0194448 Ga0501043_0194448_344_1486 366
235 3300049581 Ga0501047_0010032 Ga0501047_0010032_2728_3864 366
236 3300049581 Ga0501047_0010315 Ga0501047_0010315_496_1632 366
237 3300049581 Ga0501047_0039830 Ga0501047_0039830_486_1622 366
238 3300049581 Ga0501047_0066455 Ga0501047_0066455_767_1903 366
239 3300049581 Ga0501047_0194765 Ga0501047_0194765_150_1292 366
240 3300049581 Ga0501047_0251320 Ga0501047_0251320_288_1424 366
241 3300049582 Ga0501048_0003926 Ga0501048_0003926_8026_9168 366
242 3300049583 Ga0501067_0003131 Ga0501067_0003131_308_1450 366
243 3300049588 Ga0501072_0036069 Ga0501072_0036069_767_1909 366
244 3300049589 Ga0501073_0000802 Ga0501073_0000802_16397_17539 366
245 3300049590 Ga0501074_0000138 Ga0501074_0000138_12870_14012 366
246 3300049741 Ga0501079_0007294 Ga0501079_0007294_601_1743 366
247 3300049742 Ga0501080_0008063 Ga0501080_0008063_6478_7620 366
248 3300049744 Ga0501083_0011493 Ga0501083_0011493_4961_6097 366
249 3300049822 Ga0501035_0012091 Ga0501035_0012091_2439_3575 366
250 3300049822 Ga0501035_0016285 Ga0501035_0016285_2879_4015 366
251 3300049822 Ga0501035_0025001 Ga0501035_0025001_2719_3855 366
252 3300049822 Ga0501035_0048058 Ga0501035_0048058_124_1266 366
253 3300049822 Ga0501035_0049399 Ga0501035_0049399_2109_3245 366
254 3300049822 Ga0501035_0161780 Ga0501035_0161780_711_1853 366
255 3300049823 Ga0501044_0005749 Ga0501044_0005749_12558_13694 366
256 3300049823 Ga0501044_0011515 Ga0501044_0011515_3774_4910 366
257 3300049823 Ga0501044_0021535 Ga0501044_0021535_2209_3348 366
258 3300049823 Ga0501044_0024176 Ga0501044_0024176_2338_3474 366
259 3300049823 Ga0501044_0081810 Ga0501044_0081810_1097_2239 366
260 3300049823 Ga0501044_0147519 Ga0501044_0147519_267_1409 366
261 3300049823 Ga0501044_0179842 Ga0501044_0179842_340_1482 366
262 3300049824 Ga0501045_0034862 Ga0501045_0034862_2257_3399 366
263 3300053103 Ga0500555_011904 Ga0500555_011904_1318_2454 366
264 3300053119 Ga0500595_000573 Ga0500595_000573_11294_12430 366
265 3300053119 Ga0500595_024486 Ga0500595_024486_606_1742 366
266 3300053140 Ga0500573_0000008 Ga0500573_0000008_164424_165560 366
267 3300054114 Ga0501084_0001765 Ga0501084_0001765_7455_8597 366
268 3300060353 Ga0501082_0009503 Ga0501082_0009503_1942_3084 366
269 3300060353 Ga0501082_0023627 Ga0501082_0023627_1100_2236 366
270 3300009094 Ga0111539_10163893 Ga0111539_101638932 367
271 3300021361 Ga0213872_10000084 Ga0213872_1000008411 367
272 3300039447 Ga0436361_0103120 Ga0436361_0103120_13047_14183 367
273 3300053178 Ga0500637_0000421 Ga0500637_0000421_11846_12964 367
274 3300003320 rootH2_10065308 rootH2_100653083 368
275 3300005327 Ga0070658_10012724 Ga0070658_100127242 368
276 3300005327 Ga0070658_10050424 Ga0070658_100504242 368
277 3300005327 Ga0070658_10158104 Ga0070658_101581042 368
278 3300005329 Ga0070683_100101204 Ga0070683_1001012042 368
279 3300005336 Ga0070680_100068039 Ga0070680_1000680391 368
280 3300005339 Ga0070660_100023488 Ga0070660_1000234882 368
281 3300005339 Ga0070660_100273826 Ga0070660_1002738262 368
282 3300005457 Ga0070662_100029080 Ga0070662_1000290802 368
283 3300005458 Ga0070681_10062911 Ga0070681_100629112 368
284 3300005530 Ga0070679_100082315 Ga0070679_1000823151 368
285 3300005535 Ga0070684_100011438 Ga0070684_1000114382 368
286 3300005543 Ga0070672_100269293 Ga0070672_1002692932 368
287 3300005578 Ga0068854_100093558 Ga0068854_1000935582 368
288 3300005614 Ga0068856_100029264 Ga0068856_1000292642 368
289 3300005616 Ga0068852_100040990 Ga0068852_1000409902 368
290 3300005616 Ga0068852_100332806 Ga0068852_1003328062 368
291 3300005617 Ga0068859_100074848 Ga0068859_1000748483 368
292 3300005834 Ga0068851_10062012 Ga0068851_100620122 368
293 3300005841 Ga0068863_100096417 Ga0068863_1000964172 368
294 3300006881 Ga0068865_100007145 Ga0068865_1000071456 368
295 3300006931 Ga0097620_100074848 Ga0097620_1000748483 368
296 3300009177 Ga0105248_10019043 Ga0105248_100190438 368
297 3300009177 Ga0105248_10022674 Ga0105248_100226745 368
298 3300009545 Ga0105237_10168581 Ga0105237_101685812 368
299 3300013100 Ga0157373_10052967 Ga0157373_100529672 368
300 3300013104 Ga0157370_10080066 Ga0157370_100800662 368
301 3300013105 Ga0157369_10113966 Ga0157369_101139662 368
302 3300013105 Ga0157369_10139420 Ga0157369_101394203 368
303 3300013297 Ga0157378_10227457 Ga0157378_102274571 368
304 3300017792 Ga0163161_10223642 Ga0163161_102236421 368
305 3300025904 Ga0207647_10011032 Ga0207647_100110326 368
306 3300025904 Ga0207647_10029151 Ga0207647_100291512 368
307 3300025909 Ga0207705_10003928 Ga0207705_100039289 368
308 3300025919 Ga0207657_10002054 Ga0207657_100020547 368
309 3300025919 Ga0207657_10016307 Ga0207657_100163075 368
310 3300025919 Ga0207657_10194667 Ga0207657_101946672 368
311 3300025937 Ga0207669_10121779 Ga0207669_101217792 368
312 3300025938 Ga0207704_10193010 Ga0207704_101930102 368
313 3300025940 Ga0207691_10086937 Ga0207691_100869373 368
314 3300025941 Ga0207711_10014593 Ga0207711_100145936 368
315 3300026067 Ga0207678_10016036 Ga0207678_100160363 368
316 3300026088 Ga0207641_10085795 Ga0207641_100857952 368
317 3300026116 Ga0207674_10024052 Ga0207674_100240525 368
318 3300026142 Ga0207698_10079681 Ga0207698_100796812 368
319 3300026142 Ga0207698_10192642 Ga0207698_101926422 368
320 3300037418 Ga0395900_0005115 Ga0395900_0005115_3401_4528 368
321 3300037471 Ga0395905_0003634 Ga0395905_0003634_5888_7015 368
322 3300037471 Ga0395905_0045706 Ga0395905_0045706_62_1192 368
323 3300038443 Ga0395901_0008989 Ga0395901_0008989_8255_9382 368
324 3300046684 Ga0495669_0006038 Ga0495669_0006038_2285_3412 368
325 3300048911 Ga0496108_0000190 Ga0496108_0000190_28877_30004 368
326 3300048911 Ga0496108_0020793 Ga0496108_0020793_2148_3278 368
327 3300049584 Ga0501068_0116670 Ga0501068_0116670_207_1337 368
328 3300005331 Ga0070670_100013846 Ga0070670_1000138462 369
329 3300005617 Ga0068859_100006956 Ga0068859_10000695610 369
330 3300005844 Ga0068862_100001399 Ga0068862_1000013994 369
331 3300006931 Ga0097620_100006956 Ga0097620_10000695610 369
332 3300025908 Ga0207643_10052373 Ga0207643_100523732 369
333 3300025923 Ga0207681_10076343 Ga0207681_100763431 369
334 3300025925 Ga0207650_10054528 Ga0207650_100545282 369
335 3300028380 Ga0268265_10004064 Ga0268265_100040642 369
336 3300003791 Ga0055530_10005055 Ga0055530_100050556 372
337 3300004625 Ga0055543_1005495 Ga0055543_10054952 372
338 3300005262 Ga0065165_1000552 Ga0065165_100055227 372
339 3300005262 Ga0065165_1015362 Ga0065165_10153621 372
340 3300005618 Ga0068864_100050995 Ga0068864_1000509952 372
341 3300005841 Ga0068863_100084716 Ga0068863_1000847162 372
342 3300025250 Ga0209026_1000864 Ga0209026_100086410 372
343 3300025304 Ga0209257_1004863 Ga0209257_10048633 372
344 3300026095 Ga0207676_10013048 Ga0207676_100130484 372
345 3300037471 Ga0395905_0141608 Ga0395905_0141608_578_1696 372
346 3300047472 Ga0495686_0006477 Ga0495686_0006477_3441_4655 372
347 3300049823 Ga0501044_0010085 Ga0501044_0010085_6307_7521 372
348 3300053730 Ga0500645_001797 Ga0500645_001797_7212_8426 372
349 3300028666 Ga0265336_10037854 Ga0265336_100378542 373
350 3300028800 Ga0265338_10039377 Ga0265338_100393773 373
351 3300031711 Ga0265314_10010539 Ga0265314_100105392 373
352 3300001915 JGI24741J21665_1006148 JGI24741J21665_10061483 377
353 3300001989 JGI24739J22299_10015693 JGI24739J22299_100156933 377
354 3300001990 JGI24737J22298_10001903 JGI24737J22298_100019037 377
355 3300001990 JGI24737J22298_10006075 JGI24737J22298_100060753 377
356 3300002075 JGI24738J21930_10001089 JGI24738J21930_100010896 377
357 3300003316 rootH1_10040959 rootH1_100409595 377
358 3300003323 rootH1_10057681 rootH1_100576812 377
359 3300005327 Ga0070658_10005004 Ga0070658_100050048 377
360 3300005327 Ga0070658_10124262 Ga0070658_101242622 377
361 3300005327 Ga0070658_10134040 Ga0070658_101340402 377
362 3300005328 Ga0070676_10005367 Ga0070676_100053676 377
363 3300005334 Ga0068869_100002536 Ga0068869_1000025366 377
364 3300005338 Ga0068868_100002195 Ga0068868_1000021959 377
365 3300005339 Ga0070660_100009246 Ga0070660_1000092464 377
366 3300005339 Ga0070660_100027027 Ga0070660_1000270274 377
367 3300005344 Ga0070661_100135344 Ga0070661_1001353443 377
368 3300005354 Ga0070675_100021094 Ga0070675_1000210943 377
369 3300005355 Ga0070671_100019541 Ga0070671_1000195413 377
370 3300005364 Ga0070673_100000007 Ga0070673_100000007135 377
371 3300005366 Ga0070659_100050954 Ga0070659_1000509542 377
372 3300005455 Ga0070663_100000403 Ga0070663_10000040318 377
373 3300005456 Ga0070678_100068442 Ga0070678_1000684423 377
374 3300005459 Ga0068867_100000134 Ga0068867_10000013424 377
375 3300005539 Ga0068853_100032509 Ga0068853_1000325095 377
376 3300005539 Ga0068853_100172317 Ga0068853_1001723172 377
377 3300005543 Ga0070672_100047854 Ga0070672_1000478542 377
378 3300005563 Ga0068855_100000191 Ga0068855_10000019151 377
379 3300005563 Ga0068855_100080119 Ga0068855_1000801192 377
380 3300005578 Ga0068854_100000441 Ga0068854_10000044121 377
381 3300005578 Ga0068854_100038621 Ga0068854_1000386214 377
382 3300005616 Ga0068852_100001105 Ga0068852_1000011052 377
383 3300005834 Ga0068851_10016646 Ga0068851_100166461 377
384 3300006237 Ga0097621_100015731 Ga0097621_1000157314 377
385 3300006881 Ga0068865_100000008 Ga0068865_10000000825 377
386 3300009098 Ga0105245_10018018 Ga0105245_100180184 377
387 3300009148 Ga0105243_10000615 Ga0105243_1000061525 377
388 3300009176 Ga0105242_10002618 Ga0105242_1000261810 377
389 3300009545 Ga0105237_10052611 Ga0105237_100526113 377
390 3300010375 Ga0105239_10082413 Ga0105239_100824134 377
391 3300011119 Ga0105246_10002695 Ga0105246_100026959 377
392 3300013296 Ga0157374_10003392 Ga0157374_1000339212 377
393 3300013297 Ga0157378_10004056 Ga0157378_100040564 377
394 3300013307 Ga0157372_10108748 Ga0157372_101087482 377
395 3300013308 Ga0157375_10002835 Ga0157375_100028359 377
396 3300014969 Ga0157376_10000315 Ga0157376_100003159 377
397 3300017792 Ga0163161_10043984 Ga0163161_100439844 377
398 3300025254 Ga0209148_1000858 Ga0209148_10008587 377
399 3300025904 Ga0207647_10051629 Ga0207647_100516294 377
400 3300025907 Ga0207645_10040434 Ga0207645_100404343 377
401 3300025909 Ga0207705_10000022 Ga0207705_100000228 377
402 3300025919 Ga0207657_10001521 Ga0207657_100015214 377
403 3300025919 Ga0207657_10094690 Ga0207657_100946901 377
404 3300025920 Ga0207649_10158928 Ga0207649_101589281 377
405 3300025926 Ga0207659_10049013 Ga0207659_100490133 377
406 3300025927 Ga0207687_10004193 Ga0207687_100041935 377
407 3300025934 Ga0207686_10001743 Ga0207686_100017438 377
408 3300025935 Ga0207709_10000399 Ga0207709_1000039923 377
409 3300025938 Ga0207704_10000013 Ga0207704_1000001320 377
410 3300025940 Ga0207691_10017194 Ga0207691_100171944 377
411 3300025942 Ga0207689_10000754 Ga0207689_1000075425 377
412 3300025949 Ga0207667_10000113 Ga0207667_1000011324 377
413 3300025949 Ga0207667_10067934 Ga0207667_100679342 377
414 3300025960 Ga0207651_10000013 Ga0207651_10000013136 377
415 3300025981 Ga0207640_10007830 Ga0207640_100078304 377
416 3300025981 Ga0207640_10018112 Ga0207640_100181123 377
417 3300026023 Ga0207677_10000449 Ga0207677_100004499 377
418 3300026041 Ga0207639_10005096 Ga0207639_100050965 377
419 3300026067 Ga0207678_10000499 Ga0207678_100004995 377
420 3300026078 Ga0207702_10147989 Ga0207702_101479892 377
421 3300026089 Ga0207648_10000382 Ga0207648_1000038225 377
422 3300026142 Ga0207698_10063016 Ga0207698_100630162 377
423 3300037471 Ga0395905_0059030 Ga0395905_0059030_1441_2574 377
424 3300048922 Ga0496119_0102012 Ga0496119_0102012_179_1312 377
425 3300048923 Ga0496120_0016158 Ga0496120_0016158_3097_4230 377
426 3300048928 Ga0496125_0046168 Ga0496125_0046168_2373_3506 377

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02163

Peptidase_M50

Peptidase family M50

64

409

0.98

PF17820

PDZ_6

PDZ domain

195

248

0.9

PF13180

PDZ_2

PDZ domain

174

258

0.89

PF00595

PDZ

PDZ domain

180

245

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3stj-assembly1.cif.gz_A crystal structure of the protease + pdz1 domain of degq from escherichia coli 0.9497 143 208
4yo1-assembly1.cif.gz_A structure of legionella pneumophila degq (delta pdz2 variant) 0.9395 143 206
7xft-assembly1.cif.gz_A-2 mucp pdz2 domain 0.9306 136 228
5y28-assembly1.cif.gz_C crystal structure of h. pylori htra with pdz2 deletion 0.9289 143 206
4a8d-assembly1.cif.gz_A degp dodecamer with bound omp 0.9271 143 208
ID Description Score Start End Superfamily
af_P0C0V0_287_387_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9334 143 214 2.30.42.10
af_Q9VFJ3_320_421_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9263 143 208 2.30.42.10
af_Q8MNT0_420_501_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9231 143 173 2.30.42.10
3pv4A03 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.922 143 206 2.30.42.10
2p3wB01 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9167 143 206 2.30.42.10
ID Description Score Start End GO Terms
AF-A0A436BIM7-F1-model_v4 RIP metalloprotease RseP 0.971 7 80 GO:0004222
GO:0006508
GO:0016020
AF-A0A836P347-F1-model_v4 Zinc metalloprotease 0.9481 242 363 GO:0004222
GO:0006508
GO:0016020
AF-R6INN4-F1-model_v4 deleted 0.9479 1 366
AF-A0A061QEZ1-F1-model_v4 Zinc metalloprotease (EC 3.4.24.-) 0.9423 8 366 GO:0004222
GO:0006508
GO:0016020
GO:0046872
AF-A0A2A4LFB5-F1-model_v4 Zinc metalloprotease (EC 3.4.24.-) 0.927 2 366 GO:0004222
GO:0006508
GO:0016020
GO:0046872

Feature Viewer

pLDDT pTM Quality
73.57 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map