F441188

General Info

Members Datasets Scaffolds Average Seq Length
426 294 356 354

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10013695|Ga0105241_100136952
Length 405
Sequence MRIAQLAPLAESVPPKLYGGTERVVAWLVDELVELGHEVTLFASGDSRTRGKLHPVWPRALRLGRKGADPSAACSLSLEAIAKCAADFDVIHSHVDWLPLPLLSRLGVPFLTTAHGRLDLPGLPDVAREFSGAQFVSISDNQRRQLPDAKWIATVHHGLPSSLFSPSYGHGSYLAFLGRLTVEKGPEDAIRIAEAAGMPLRIAAKIPRAETAYFKRQLQPHIDGERVTLVGEVDDQKKQPFLAGAAALLFPIDWPEPFGLVMIEAMACGTPVIAYRSGSVPEVIEHGVTGFIVDGEEDAVRAVREVSRLDRRAIRARFEERFTAVRMAREYEARYRELVTEAXXXXRVLVGQMKGQQMRSPRTKLICVALAAVLAASSSHDAINSAEPSKKSLSKDKATPAGVRL

Samples

Sample ID Description Type Environment
1 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
7 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
8 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
9 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
10 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
11 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
12 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
13 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
14 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
15 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
16 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
17 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
18 2904699407
19 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
20 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
21 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
22 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
23 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
24 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
25 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
26 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
27 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
28 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
29 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
30 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
31 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
32 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
33 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
34 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
35 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
36 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
37 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
38 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
39 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
40 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
41 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
42 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
43 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
44 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
45 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
46 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
47 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
48 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
49 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
50 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
51 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
52 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
53 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
67 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
110 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
174 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
175 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
176 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
189 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
208 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
221 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
222 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
234 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
235 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
236 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
237 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
276 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
279 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
280 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
281 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
282 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
285 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
286 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
287 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
288 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
289 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
290 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
291 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
292 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
293 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
294 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.76
Metatranscriptomes 0
Isolates 16.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.92
Nodule 17.37
Rhizoplane 8.69
Rhizosphere 61.74
Stem 0
Stem Tuber 0
Unclassified 3.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10036662 3300003203 Bacteria 1777
2 Ga0055542_1004608 3300003762 Bacteria 3302
3 Ga0070683_100033482 3300005329 Bacteria 4686
4 Ga0070670_100017068 3300005331 Bacteria 6229
5 Ga0068869_100002570 3300005334 Bacteria 10957
6 Ga0068869_100003422 3300005334 Bacteria 9699
7 Ga0068868_100017659 3300005338 Bacteria 5319
8 Ga0070660_100091043 3300005339 Bacteria 2405
9 Ga0070661_100111865 3300005344 Bacteria 2040
10 Ga0070668_100105024 3300005347 Bacteria 2243
11 Ga0070671_100113709 3300005355 Bacteria 2275
12 Ga0070659_100090774 3300005366 Bacteria 2448
13 Ga0070709_10001696 3300005434 Bacteria 11976
14 Ga0070714_100065257 3300005435 Bacteria 3135
15 Ga0070710_10027587 3300005437 Bacteria 3030
16 Ga0070710_10137594 3300005437 Bacteria 1495
17 Ga0070701_10079061 3300005438 Bacteria 1776
18 Ga0070700_100088152 3300005441 Bacteria 2019
19 Ga0070663_100007700 3300005455 Bacteria 6576
20 Ga0070663_100076749 3300005455 Bacteria 2444
21 Ga0070678_100022323 3300005456 Bacteria 4192
22 Ga0070662_100049592 3300005457 Bacteria 3028
23 Ga0068853_100282684 3300005539 Bacteria 1530
24 Ga0070693_100012023 3300005547 Bacteria 4370
25 Ga0070693_100048593 3300005547 Bacteria 2417
26 Ga0070665_100027116 3300005548 Bacteria 5770
27 Ga0070665_100145207 3300005548 Bacteria 2376
28 Ga0068855_100028003 3300005563 Bacteria 6741
29 Ga0068855_100481083 3300005563 Bacteria 1351
30 Ga0070664_100065613 3300005564 Bacteria 3098
31 Ga0068857_100031403 3300005577 Bacteria 4693
32 Ga0068857_100192226 3300005577 Bacteria 1859
33 Ga0068856_100016373 3300005614 Bacteria 7173
34 Ga0068856_100102376 3300005614 Bacteria 2857
35 Ga0070702_100014416 3300005615 Bacteria 4010
36 Ga0068852_100128872 3300005616 Bacteria 2327
37 Ga0068852_100229479 3300005616 Bacteria 1769
38 Ga0068859_100082281 3300005617 Bacteria 3262
39 Ga0068864_100009984 3300005618 Bacteria 7834
40 Ga0068851_10147219 3300005834 Bacteria 1285
41 Ga0068870_10062335 3300005840 Bacteria 2008
42 Ga0068863_100029792 3300005841 Bacteria 5211
43 Ga0068863_100049616 3300005841 Bacteria 3980
44 Ga0068860_100012775 3300005843 Bacteria 8256
45 Ga0068860_100035219 3300005843 Bacteria 4802
46 Ga0081455_10009356 3300005937 Bacteria 10086
47 Ga0081455_10026905 3300005937 Bacteria 5279
48 Ga0081539_10011464 3300005985 Bacteria 7000
49 Ga0075365_10070391 3300006038 Bacteria 2353
50 Ga0075368_10004994 3300006042 Bacteria 4533
51 Ga0075363_100000263 3300006048 Bacteria 15122
52 Ga0075363_100113619 3300006048 Bacteria 1507
53 Ga0075364_10000633 3300006051 Bacteria 18144
54 Ga0070715_10025327 3300006163 Bacteria 2348
55 Ga0070716_100017421 3300006173 Bacteria 3724
56 Ga0070716_100057822 3300006173 Bacteria 2230
57 Ga0070712_100136895 3300006175 Bacteria 1863
58 Ga0070712_100140995 3300006175 Bacteria 1839
59 Ga0075367_10008758 3300006178 Bacteria 5257
60 Ga0075367_10033994 3300006178 Bacteria 2942
61 Ga0075369_10020095 3300006186 Bacteria 2733
62 Ga0075366_10007277 3300006195 Bacteria 6104
63 Ga0075370_10005939 3300006353 Bacteria 6109
64 Ga0068871_100013711 3300006358 Bacteria 6025
65 Ga0075428_100033960 3300006844 Bacteria 5627
66 Ga0075430_100014438 3300006846 Bacteria 6728
67 Ga0075430_100017843 3300006846 Bacteria 6041
68 Ga0075431_100003738 3300006847 Bacteria 14789
69 Ga0075431_100066791 3300006847 Bacteria 3713
70 Ga0075431_100210675 3300006847 Bacteria 1985
71 Ga0075433_10002189 3300006852 Bacteria 14810
72 Ga0075433_10031696 3300006852 Bacteria 4521
73 Ga0075434_100008638 3300006871 Bacteria 9489
74 Ga0075434_100041370 3300006871 Bacteria 4566
75 Ga0075429_100016678 3300006880 Bacteria 6362
76 Ga0068865_100011082 3300006881 Bacteria 5631
77 Ga0097620_100082285 3300006931 Bacteria 3262
78 Ga0099824_1021502 3300006942 Bacteria 4489
79 Ga0099823_1000010 3300006944 Bacteria 98544
80 Ga0075435_100003257 3300007076 Bacteria 10997
81 Ga0075435_100065232 3300007076 Bacteria 2960
82 Ga0099795_10029571 3300007788 Bacteria 1873
83 Ga0099795_10053271 3300007788 Bacteria 1480
84 Ga0105240_10028080 3300009093 Bacteria 7357
85 Ga0111539_10006741 3300009094 Bacteria 14777
86 Ga0111539_10085014 3300009094 Bacteria 3719
87 Ga0111539_10290843 3300009094 Bacteria 1901
88 Ga0105245_10021209 3300009098 Bacteria 5695
89 Ga0105245_10108129 3300009098 Bacteria 2582
90 Ga0105247_10014660 3300009101 Bacteria 4699
91 Ga0105247_10044307 3300009101 Bacteria 2728
92 Ga0105247_10109466 3300009101 Bacteria 1776
93 Ga0105247_10304415 3300009101 Bacteria 1107
94 Ga0114129_10000124 3300009147 Bacteria 77871
95 Ga0114129_10204244 3300009147 Bacteria 2674
96 Ga0105243_10181405 3300009148 Bacteria 1831
97 Ga0105241_10013695 3300009174 Bacteria 5941
98 Ga0105241_10026300 3300009174 Bacteria 4329
99 Ga0105248_10011150 3300009177 Bacteria 9919
100 Ga0105237_10024220 3300009545 Bacteria 6211
101 Ga0105237_10142490 3300009545 Bacteria 2391
102 Ga0105238_10440657 3300009551 Bacteria 1299
103 Ga0099796_10000619 3300010159 Bacteria 6172
104 Ga0105239_10005231 3300010375 Bacteria 15267
105 Ga0105239_10107472 3300010375 Bacteria 3091
106 Ga0105246_10007015 3300011119 Bacteria 6895
107 Ga0105246_10007480 3300011119 Bacteria 6694
108 Ga0105246_10070173 3300011119 Bacteria 2464
109 Ga0157369_10075397 3300013105 Bacteria 3617
110 Ga0157374_10010439 3300013296 Bacteria 7986
111 Ga0157374_10013821 3300013296 Bacteria 7053
112 Ga0157378_10006953 3300013297 Bacteria 9870
113 Ga0163162_10145448 3300013306 Bacteria 2486
114 Ga0157372_10012987 3300013307 Bacteria 8884
115 Ga0157375_10004049 3300013308 Bacteria 12710
116 Ga0157375_10059186 3300013308 Bacteria 3794
117 Ga0163163_10022513 3300014325 Bacteria 5968
118 Ga0163163_10052293 3300014325 Bacteria 4030
119 Ga0163163_10649352 3300014325 Bacteria 1119
120 Ga0157377_10004783 3300014745 Bacteria 6278
121 Ga0157377_10195374 3300014745 Bacteria 1281
122 Ga0157379_10024891 3300014968 Bacteria 5314
123 Ga0157379_10191465 3300014968 Bacteria 1848
124 Ga0157376_10033867 3300014969 Bacteria 4118
125 Ga0163161_10280728 3300017792 Bacteria 1306
126 Ga0209563_101166 3300025230 Bacteria 7379
127 Ga0209677_100214 3300025253 Bacteria 42726
128 Ga0209148_1000864 3300025254 Bacteria 21203
129 Ga0209455_1001398 3300025272 Bacteria 10954
130 Ga0209758_1029065 3300025297 Bacteria 2322
131 Ga0207697_10026098 3300025315 Bacteria 2389
132 Ga0207688_10185384 3300025901 Bacteria 1242
133 Ga0207699_10017193 3300025906 Bacteria 3800
134 Ga0207643_10099724 3300025908 Bacteria 1702
135 Ga0207654_10049397 3300025911 Bacteria 2413
136 Ga0207671_10015898 3300025914 Bacteria 5870
137 Ga0207671_10018080 3300025914 Bacteria 5417
138 Ga0207671_10103115 3300025914 Bacteria 2163
139 Ga0207671_10304537 3300025914 Bacteria 1259
140 Ga0207693_10019059 3300025915 Bacteria 5461
141 Ga0207693_10036858 3300025915 Bacteria 3856
142 Ga0207663_10000994 3300025916 Bacteria 12947
143 Ga0207663_10166329 3300025916 Bacteria 1562
144 Ga0207663_10281557 3300025916 Bacteria 1235
145 Ga0207657_10100947 3300025919 Bacteria 2395
146 Ga0207649_10041241 3300025920 Bacteria 2810
147 Ga0207687_10003818 3300025927 Bacteria 10126
148 Ga0207687_10008587 3300025927 Bacteria 6680
149 Ga0207700_10045323 3300025928 Bacteria 3244
150 Ga0207644_10084104 3300025931 Bacteria 2358
151 Ga0207706_10017486 3300025933 Bacteria 6463
152 Ga0207704_10025618 3300025938 Bacteria 3221
153 Ga0207704_10281761 3300025938 Bacteria 1264
154 Ga0207665_10005890 3300025939 Bacteria 8156
155 Ga0207665_10046529 3300025939 Bacteria 2907
156 Ga0207665_10184855 3300025939 Bacteria 1511
157 Ga0207691_10345308 3300025940 Bacteria 1274
158 Ga0207711_10006468 3300025941 Bacteria 9861
159 Ga0207689_10001257 3300025942 Bacteria 24435
160 Ga0207689_10220042 3300025942 Bacteria 1569
161 Ga0207667_10034384 3300025949 Bacteria 5442
162 Ga0207667_10058158 3300025949 Bacteria 4056
163 Ga0207667_10193943 3300025949 Bacteria 2084
164 Ga0207668_10282963 3300025972 Bacteria 1361
165 Ga0207677_10014152 3300026023 Bacteria 4648
166 Ga0207677_10026467 3300026023 Bacteria 3639
167 Ga0207703_10028127 3300026035 Bacteria 4428
168 Ga0207703_10079510 3300026035 Bacteria 2728
169 Ga0207678_10016714 3300026067 Bacteria 6445
170 Ga0207678_10039724 3300026067 Bacteria 4082
171 Ga0207678_10055358 3300026067 Bacteria 3417
172 Ga0207708_10065674 3300026075 Bacteria 2774
173 Ga0207702_10022566 3300026078 Bacteria 5218
174 Ga0207702_10024976 3300026078 Bacteria 4957
175 Ga0207641_10017041 3300026088 Bacteria 5946
176 Ga0207648_10064635 3300026089 Bacteria 3189
177 Ga0207676_10008925 3300026095 Bacteria 7133
178 Ga0207676_10020473 3300026095 Bacteria 4841
179 Ga0207674_10062326 3300026116 Bacteria 3766
180 Ga0207683_10018382 3300026121 Bacteria 5963
181 Ga0207683_10095801 3300026121 Bacteria 2646
182 Ga0209389_1000028 3300027296 Bacteria 140401
183 Ga0209389_1000216 3300027296 Bacteria 40414
184 Ga0209389_1014188 3300027296 Bacteria 7238
185 Ga0209489_100027 3300027361 Bacteria 188074
186 Ga0209489_102145 3300027361 Bacteria 40414
187 Ga0209489_112870 3300027361 Bacteria 7238
188 Ga0209700_100022 3300027363 Bacteria 229977
189 Ga0209700_111287 3300027363 Bacteria 8435
190 Ga0209813_10002719 3300027866 Bacteria 4075
191 Ga0207428_10002690 3300027907 Bacteria 17709
192 Ga0207428_10018624 3300027907 Bacteria 5927
193 Ga0207428_10141285 3300027907 Bacteria 1837
194 Ga0207428_10244138 3300027907 Bacteria 1341
195 Ga0268266_10005999 3300028379 Bacteria 11214
196 Ga0268266_10033253 3300028379 Bacteria 4385
197 Ga0268266_10057792 3300028379 Bacteria 3338
198 Ga0268264_10018692 3300028381 Bacteria 5665
199 Ga0307412_10077708 3300031911 Bacteria 2284
200 Ga0315911_1000003 3300033442 Bacteria 502217
201 Ga0373947_0117703 3300035725 Bacteria 1686
202 Ga0373925_0226015 3300037068 Bacteria 1495
203 Ga0395899_0024268 3300037312 Bacteria 4586
204 Ga0395899_0174397 3300037312 Bacteria 1513
205 Ga0395900_0026833 3300037418 Bacteria 5894
206 Ga0395900_0163519 3300037418 Bacteria 2269
207 Ga0395905_0048469 3300037471 Bacteria 3981
208 Ga0395901_0004599 3300038443 Bacteria 13932
209 Ga0395901_0061019 3300038443 Bacteria 3924
210 Ga0395901_0095068 3300038443 Bacteria 3123
211 Ga0436360_1173027 3300039438 Bacteria 3946
212 Ga0436361_0884332 3300039447 Bacteria 4032
213 Ga0436363_0353331 3300039450 Bacteria 1353
214 Ga0439448_0018649 3300042005 Bacteria 2130
215 Ga0466972_0004191 3300044658 Bacteria 7202
216 Ga0466957_0047268 3300044842 Bacteria 2615
217 Ga0466960_0050546 3300044901 Bacteria 2005
218 Ga0466959_0117404 3300045049 Bacteria 1894
219 Ga0466967_0079376 3300045976 Bacteria 2958
220 Ga0495617_013023 3300046452 Bacteria 2834
221 Ga0495603_0149649 3300046455 Bacteria 1356
222 Ga0495590_0010475 3300046457 Bacteria 3484
223 Ga0495629_0018348 3300046459 Bacteria 5009
224 Ga0495651_0005977 3300046462 Bacteria 9287
225 Ga0495651_0087657 3300046462 Bacteria 2340
226 Ga0495650_0041475 3300046471 Bacteria 1967
227 Ga0495580_0147347 3300046472 Bacteria 1631
228 Ga0495605_0012866 3300046474 Bacteria 4631
229 Ga0495639_0038168 3300046475 Bacteria 2156
230 Ga0495664_0007428 3300046477 Bacteria 6086
231 Ga0495584_0016927 3300046491 Bacteria 3715
232 Ga0495596_0016183 3300046500 Bacteria 3102
233 Ga0495583_0040335 3300046506 Bacteria 2194
234 Ga0495606_0012483 3300046507 Bacteria 6804
235 Ga0495630_0065244 3300046517 Bacteria 2736
236 Ga0495631_0012104 3300046518 Bacteria 4225
237 Ga0495632_0097717 3300046519 Bacteria 1386
238 Ga0495643_0092681 3300046522 Bacteria 1557
239 Ga0495644_0080251 3300046523 Bacteria 1229
240 Ga0495652_0065524 3300046529 Bacteria 3052
241 Ga0495665_0068331 3300046531 Bacteria 1874
242 Ga0495640_0065326 3300046533 Bacteria 2457
243 Ga0495587_0008994 3300046536 Bacteria 6411
244 Ga0495609_0008667 3300046538 Bacteria 4963
245 Ga0495609_0053615 3300046538 Bacteria 1792
246 Ga0495597_0010637 3300046542 Bacteria 4487
247 Ga0495622_0012408 3300046557 Bacteria 3945
248 Ga0495625_0035688 3300046660 Bacteria 3662
249 Ga0495635_0000945 3300046663 Bacteria 19172
250 Ga0495661_0053708 3300046665 Bacteria 2422
251 Ga0495657_0130510 3300046675 Bacteria 1574
252 Ga0495623_0007803 3300046679 Bacteria 6959
253 Ga0495669_0012724 3300046684 Bacteria 3582
254 Ga0495624_0040156 3300046690 Bacteria 2998
255 Ga0495624_0075061 3300046690 Bacteria 2100
256 Ga0495660_0066857 3300046810 Bacteria 1916
257 Ga0495604_0000425 3300047317 Bacteria 37942
258 Ga0495604_0093210 3300047317 Bacteria 2229
259 Ga0495604_0145299 3300047317 Bacteria 1690
260 Ga0495676_0017217 3300047321 Bacteria 6396
261 Ga0495676_0075746 3300047321 Bacteria 2572
262 Ga0495676_0191520 3300047321 Bacteria 1426
263 Ga0495683_0024146 3300047323 Bacteria 3121
264 Ga0495677_0025042 3300047445 Bacteria 2165
265 Ga0495685_044702 3300047447 Bacteria 1510
266 Ga0495673_0016304 3300047469 Bacteria 3801
267 Ga0495681_0093971 3300047470 Bacteria 1320
268 Ga0495593_0036754 3300047673 Bacteria 2654
269 Ga0495602_0037651 3300048088 Bacteria 4485
270 Ga0495602_0136254 3300048088 Bacteria 1950
271 Ga0496101_0220920 3300048904 Bacteria 1470
272 Ga0496102_0004300 3300048905 Bacteria 12040
273 Ga0496102_0009668 3300048905 Bacteria 8294
274 Ga0496102_0016352 3300048905 Bacteria 6481
275 Ga0496102_0130620 3300048905 Bacteria 2351
276 Ga0496103_0053587 3300048906 Bacteria 2500
277 Ga0496103_0054236 3300048906 Bacteria 2485
278 Ga0496103_0130658 3300048906 Bacteria 1604
279 Ga0496103_0143250 3300048906 Bacteria 1529
280 Ga0496104_0016800 3300048907 Bacteria 6652
281 Ga0496104_0031480 3300048907 Bacteria 4934
282 Ga0496104_0045029 3300048907 Bacteria 4148
283 Ga0496105_0001854 3300048908 Bacteria 15154
284 Ga0496105_0122963 3300048908 Bacteria 2140
285 Ga0496105_0189433 3300048908 Bacteria 1682
286 Ga0496106_0022422 3300048909 Bacteria 4690
287 Ga0496106_0028562 3300048909 Bacteria 4155
288 Ga0496107_0009341 3300048910 Bacteria 6798
289 Ga0496107_0069169 3300048910 Bacteria 2562
290 Ga0496109_0040676 3300048912 Bacteria 4210
291 Ga0496109_0040834 3300048912 Bacteria 4202
292 Ga0496109_0164310 3300048912 Bacteria 2081
293 Ga0496110_0033568 3300048913 Bacteria 4440
294 Ga0496110_0082417 3300048913 Bacteria 2869
295 Ga0496110_0181348 3300048913 Bacteria 1912
296 Ga0496111_0040227 3300048914 Bacteria 3353
297 Ga0496112_0000323 3300048915 Bacteria 30795
298 Ga0496112_0098270 3300048915 Bacteria 2897
299 Ga0496112_0167704 3300048915 Bacteria 2161
300 Ga0496112_0292124 3300048915 Bacteria 1576
301 Ga0496113_0090892 3300048916 Bacteria 2352
302 Ga0496114_0056554 3300048917 Bacteria 3274
303 Ga0496114_0083878 3300048917 Bacteria 2697
304 Ga0496114_0211675 3300048917 Bacteria 1700
305 Ga0496115_0044374 3300048918 Bacteria 3546
306 Ga0496115_0122711 3300048918 Bacteria 2138
307 Ga0496115_0267217 3300048918 Bacteria 1406
308 Ga0496119_0002529 3300048922 Bacteria 19930
309 Ga0496121_0016702 3300048924 Bacteria 7553
310 Ga0496124_0141264 3300048927 Bacteria 1900
311 Ga0496125_0046983 3300048928 Bacteria 3616
312 Ga0496126_0009502 3300048929 Bacteria 10318
313 Ga0496126_0139416 3300048929 Bacteria 2089
314 Ga0495682_0019716 3300049460 Bacteria 2534
315 Ga0501034_0170886 3300049571 Bacteria 2141
316 nmdc:mga03n38_5867_c1 3300050490 Bacteria 4221
317 nmdc:mga00v17_1491_c1 3300050491 Bacteria 12242
318 nmdc:mga0yw44_190651_c1 3300050492 Bacteria 1352
319 nmdc:mga0k408_143773_c1 3300050493 Bacteria 1419
320 nmdc:mga0k408_16027_c1 3300050493 Bacteria 4151
321 nmdc:mga0k408_50781_c1 3300050493 Bacteria 2401
322 nmdc:mga06z11_12469_c1 3300050494 Bacteria 3698
323 nmdc:mga06z11_9547_c1 3300050494 Bacteria 4093
324 nmdc:mga04h51_643_c1 3300050495 Bacteria 8174
325 nmdc:mga07m45_69150_c1 3300050496 Bacteria 2007
326 nmdc:mga07m45_9687_c1 3300050496 Bacteria 5007
327 nmdc:mga05p37_218079_c1 3300050507 Bacteria 2304
328 nmdc:mga05p37_274_c1 3300050507 Bacteria 53645
329 nmdc:mga09592_14701_c1 3300050508 Bacteria 6388
330 nmdc:mga09592_24739_c1 3300050508 Bacteria 4965
331 nmdc:mga0qj67_12037_c1 3300050509 Bacteria 6503
332 nmdc:mga0qj67_20813_c1 3300050509 Bacteria 5024
333 nmdc:mga06r32_12381_c1 3300050510 Bacteria 7696
334 nmdc:mga06r32_27659_c1 3300050510 Bacteria 5301
335 nmdc:mga06r32_3269_c1 3300050510 Bacteria 14509
336 nmdc:mga08y16_3838_c1 3300050511 Bacteria 15634
337 nmdc:mga08y16_393518_c1 3300050511 Bacteria 1419
338 nmdc:mga08y16_54101_c1 3300050511 Bacteria 4194
339 nmdc:mga08y16_94479_c1 3300050511 Bacteria 3115
340 nmdc:mga0n895_11489_c1 3300050512 Bacteria 7902
341 nmdc:mga0n895_450_c1 3300050512 Bacteria 22652
342 nmdc:mga0rr50_1936_c1 3300050513 Bacteria 11499
343 nmdc:mga0rr50_93579_c1 3300050513 Bacteria 2345
344 nmdc:mga0a205_1149_c1 3300050515 Bacteria 21996
345 nmdc:mga0a205_51202_c1 3300050515 Bacteria 3986
346 nmdc:mga0sz30_1387_c1 3300050516 Bacteria 8651
347 nmdc:mga0sz30_39796_c1 3300050516 Bacteria 1974
348 Ga0495619_0091207 3300053085 Bacteria 2063
349 Ga0500578_0152564 3300053086 Bacteria 1438
350 Ga0500643_000622 3300053087 Bacteria 24002
351 Ga0500569_003980 3300053109 Bacteria 3069
352 Ga0500561_0002995 3300053137 Bacteria 2903
353 Ga0500577_0008052 3300053142 Bacteria 2985
354 Ga0500616_0000057 3300053153 Bacteria 278571
355 Ga0500627_0027337 3300053158 Bacteria 2360
356 Ga0500634_0020924 3300053161 Bacteria 3541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025916 Ga0207663_10281557 Ga0207663_102815572 311
2 3300005937 Ga0081455_10026905 Ga0081455_100269055 321
3 3300048916 Ga0496113_0090892 Ga0496113_0090892_53_1093 321
4 3300053087 Ga0500643_000622 Ga0500643_000622_5797_6852 325
5 3300046519 Ga0495632_0097717 Ga0495632_0097717_12_1085 326
6 3300050508 nmdc:mga09592_24739_c1 nmdc:mga09592_24739_c1_848_1849 326
7 3300005331 Ga0070670_100017068 Ga0070670_1000170689 330
8 3300005334 Ga0068869_100003422 Ga0068869_1000034229 330
9 3300005338 Ga0068868_100017659 Ga0068868_1000176597 330
10 3300005344 Ga0070661_100111865 Ga0070661_1001118653 330
11 3300005355 Ga0070671_100113709 Ga0070671_1001137093 330
12 3300005366 Ga0070659_100090774 Ga0070659_1000907741 330
13 3300005438 Ga0070701_10079061 Ga0070701_100790613 330
14 3300005455 Ga0070663_100076749 Ga0070663_1000767491 330
15 3300005457 Ga0070662_100049592 Ga0070662_1000495922 330
16 3300005547 Ga0070693_100048593 Ga0070693_1000485933 330
17 3300005548 Ga0070665_100027116 Ga0070665_1000271167 330
18 3300005563 Ga0068855_100028003 Ga0068855_1000280034 330
19 3300005577 Ga0068857_100192226 Ga0068857_1001922262 330
20 3300005615 Ga0070702_100014416 Ga0070702_1000144163 330
21 3300005616 Ga0068852_100128872 Ga0068852_1001288725 330
22 3300005834 Ga0068851_10147219 Ga0068851_101472192 330
23 3300005841 Ga0068863_100049616 Ga0068863_1000496162 330
24 3300005843 Ga0068860_100012775 Ga0068860_1000127758 330
25 3300006178 Ga0075367_10008758 Ga0075367_100087588 330
26 3300006195 Ga0075366_10007277 Ga0075366_100072774 330
27 3300006353 Ga0075370_10005939 Ga0075370_100059398 330
28 3300006358 Ga0068871_100013711 Ga0068871_10001371111 330
29 3300009098 Ga0105245_10021209 Ga0105245_100212096 330
30 3300009101 Ga0105247_10014660 Ga0105247_100146601 330
31 3300009177 Ga0105248_10011150 Ga0105248_100111504 330
32 3300009545 Ga0105237_10024220 Ga0105237_1002422010 330
33 3300010375 Ga0105239_10005231 Ga0105239_1000523110 330
34 3300011119 Ga0105246_10070173 Ga0105246_100701733 330
35 3300013297 Ga0157378_10006953 Ga0157378_100069533 330
36 3300014325 Ga0163163_10022513 Ga0163163_100225132 330
37 3300025914 Ga0207671_10015898 Ga0207671_100158989 330
38 3300025927 Ga0207687_10003818 Ga0207687_1000381816 330
39 3300025931 Ga0207644_10084104 Ga0207644_100841043 330
40 3300025933 Ga0207706_10017486 Ga0207706_100174862 330
41 3300025938 Ga0207704_10281761 Ga0207704_102817612 330
42 3300025941 Ga0207711_10006468 Ga0207711_1000646812 330
43 3300025949 Ga0207667_10034384 Ga0207667_100343846 330
44 3300026035 Ga0207703_10079510 Ga0207703_100795103 330
45 3300026067 Ga0207678_10016714 Ga0207678_1001671410 330
46 3300026067 Ga0207678_10039724 Ga0207678_100397242 330
47 3300026088 Ga0207641_10017041 Ga0207641_100170414 330
48 3300026089 Ga0207648_10064635 Ga0207648_100646354 330
49 3300026095 Ga0207676_10008925 Ga0207676_100089259 330
50 3300028379 Ga0268266_10005999 Ga0268266_100059993 330
51 3300028381 Ga0268264_10018692 Ga0268264_100186924 330
52 3300048905 Ga0496102_0016352 Ga0496102_0016352_2292_3359 330
53 3300048906 Ga0496103_0054236 Ga0496103_0054236_205_1272 330
54 3300048906 Ga0496103_0130658 Ga0496103_0130658_284_1360 330
55 3300048907 Ga0496104_0045029 Ga0496104_0045029_80_1156 330
56 3300048910 Ga0496107_0069169 Ga0496107_0069169_1416_2492 330
57 3300048913 Ga0496110_0181348 Ga0496110_0181348_63_1139 330
58 3300048915 Ga0496112_0167704 Ga0496112_0167704_158_1225 330
59 3300048924 Ga0496121_0016702 Ga0496121_0016702_4688_5755 330
60 3300048927 Ga0496124_0141264 Ga0496124_0141264_398_1465 330
61 3300048929 Ga0496126_0139416 Ga0496126_0139416_673_1740 330
62 3300050493 nmdc:mga0k408_50781_c1 nmdc:mga0k408_50781_c1_1136_2203 330
63 3300050494 nmdc:mga06z11_9547_c1 nmdc:mga06z11_9547_c1_1196_2263 330
64 3300050496 nmdc:mga07m45_9687_c1 nmdc:mga07m45_9687_c1_3855_4922 330
65 3300048917 Ga0496114_0083878 Ga0496114_0083878_1488_2564 331
66 3300046477 Ga0495664_0007428 Ga0495664_0007428_1859_2932 332
67 iso_pu_bacteria 2513237139 2513877015 334
68 iso_pu_bacteria 2791355196 2793065094 334
69 iso_pu_bacteria 2824696289 2824698313 334
70 iso_pu_bacteria 2903748898 2903750631 334
71 3300025914 Ga0207671_10103115 Ga0207671_101031154 335
72 3300005339 Ga0070660_100091043 Ga0070660_1000910434 336
73 3300025949 Ga0207667_10193943 Ga0207667_101939432 336
74 iso_pu_bacteria 2824661429 2824662049 336
75 iso_pu_bacteria 2879099564 2879103837 336
76 iso_pu_bacteria 2932784394 2932793656 336
77 iso_pu_bacteria 2932809354 2932815732 336
78 iso_pu_bacteria 2932828146 2932837232 336
79 iso_pu_bacteria 2935616580 2935619974 336
80 iso_pu_bacteria 2935638405 2935642200 336
81 iso_pu_bacteria 2935665750 2935668496 336
82 iso_pu_bacteria 2935703347 2935706356 336
83 iso_pu_bacteria 2935801545 2935810307 336
84 iso_pu_bacteria 2935810662 2935814671 336
85 iso_pu_bacteria 2935810662 2935819494 336
86 iso_pu_bacteria 2935827899 2935831809 336
87 iso_pu_bacteria 2935837841 2935838850 336
88 iso_pu_bacteria 2935855204 2935857711 336
89 iso_pu_bacteria 2935864058 2935868948 336
90 iso_pu_bacteria 2935873716 2935874363 336
91 iso_pu_bacteria 2935916978 2935918170 336
92 iso_pu_bacteria 2935992306 2935998909 336
93 iso_pu_bacteria 2936002035 2936007762 336
94 iso_pu_bacteria 2936037263 2936040228 336
95 iso_pu_bacteria 2936037263 2936046057 336
96 iso_pu_bacteria 2941538514 2941538552 336
97 iso_pu_bacteria 8016511872 8016514346 336
98 iso_pu_bacteria 8016630954 8016638333 336
99 iso_pu_bacteria 8017057580 8017062077 336
100 iso_pu_bacteria 8019576017 8019582441 336
101 iso_pu_bacteria 8019586578 8019590224 336
102 iso_pu_bacteria 8019597564 8019601123 336
103 iso_pu_bacteria 8056967851 8056976436 336
104 iso_pu_bacteria 2513237092 2513628654 337
105 iso_pu_bacteria 2528768022 2528858447 337
106 iso_pu_bacteria 2842038055 2842042899 337
107 iso_pu_bacteria 2842038055 2842045645 337
108 iso_pu_bacteria 2842045827 2842050940 337
109 iso_pu_bacteria 2842045827 2842053244 337
110 iso_pu_bacteria 2879099564 2879103663 337
111 iso_pu_bacteria 2888419890 2888422237 337
112 3300005329 Ga0070683_100033482 Ga0070683_1000334823 338
113 3300005539 Ga0068853_100282684 Ga0068853_1002826842 338
114 3300005563 Ga0068855_100481083 Ga0068855_1004810832 338
115 3300005564 Ga0070664_100065613 Ga0070664_1000656132 338
116 3300005614 Ga0068856_100102376 Ga0068856_1001023761 338
117 3300006038 Ga0075365_10070391 Ga0075365_100703912 338
118 3300007788 Ga0099795_10029571 Ga0099795_100295711 338
119 3300010375 Ga0105239_10107472 Ga0105239_101074722 338
120 3300013105 Ga0157369_10075397 Ga0157369_100753972 338
121 3300013307 Ga0157372_10012987 Ga0157372_100129878 338
122 3300025919 Ga0207657_10100947 Ga0207657_101009473 338
123 3300025939 Ga0207665_10046529 Ga0207665_100465293 338
124 3300026078 Ga0207702_10022566 Ga0207702_100225666 338
125 3300035725 Ga0373947_0117703 Ga0373947_0117703_156_1196 338
126 3300037068 Ga0373925_0226015 Ga0373925_0226015_69_1169 338
127 3300037312 Ga0395899_0024268 Ga0395899_0024268_3425_4456 338
128 3300037418 Ga0395900_0026833 Ga0395900_0026833_2084_3115 338
129 3300038443 Ga0395901_0004599 Ga0395901_0004599_2430_3461 338
130 3300039450 Ga0436363_0353331 Ga0436363_0353331_27_1088 338
131 3300042005 Ga0439448_0018649 Ga0439448_0018649_656_1687 338
132 3300044842 Ga0466957_0047268 Ga0466957_0047268_748_1779 338
133 3300045976 Ga0466967_0079376 Ga0466967_0079376_1711_2742 338
134 3300046455 Ga0495603_0149649 Ga0495603_0149649_22_1062 338
135 3300046472 Ga0495580_0147347 Ga0495580_0147347_124_1164 338
136 3300046475 Ga0495639_0038168 Ga0495639_0038168_695_1735 338
137 3300046517 Ga0495630_0065244 Ga0495630_0065244_1418_2458 338
138 3300046531 Ga0495665_0068331 Ga0495665_0068331_591_1691 338
139 3300046690 Ga0495624_0075061 Ga0495624_0075061_425_1465 338
140 3300047321 Ga0495676_0191520 Ga0495676_0191520_67_1143 338
141 3300047673 Ga0495593_0036754 Ga0495593_0036754_635_1675 338
142 3300048918 Ga0496115_0044374 Ga0496115_0044374_242_1318 338
143 iso_pu_bacteria 2932818245 2932827066 338
144 iso_pu_bacteria 2935810662 2935819481 338
145 iso_pu_bacteria 2936037263 2936046070 338
146 3300048918 Ga0496115_0267217 Ga0496115_0267217_230_1297 339
147 3300003762 Ga0055542_1004608 Ga0055542_10046082 340
148 3300009093 Ga0105240_10028080 Ga0105240_100280804 340
149 3300014325 Ga0163163_10649352 Ga0163163_106493521 340
150 3300025230 Ga0209563_101166 Ga0209563_1011663 340
151 3300025253 Ga0209677_100214 Ga0209677_10021455 340
152 3300025254 Ga0209148_1000864 Ga0209148_100086414 340
153 3300025272 Ga0209455_1001398 Ga0209455_10013982 340
154 3300046459 Ga0495629_0018348 Ga0495629_0018348_369_1445 340
155 3300046462 Ga0495651_0087657 Ga0495651_0087657_923_1999 340
156 3300046529 Ga0495652_0065524 Ga0495652_0065524_1163_2239 340
157 3300046533 Ga0495640_0065326 Ga0495640_0065326_399_1475 340
158 3300046557 Ga0495622_0012408 Ga0495622_0012408_1689_2765 340
159 3300046663 Ga0495635_0000945 Ga0495635_0000945_14712_15788 340
160 3300046690 Ga0495624_0040156 Ga0495624_0040156_1171_2247 340
161 3300047317 Ga0495604_0000425 Ga0495604_0000425_8257_9333 340
162 3300047321 Ga0495676_0017217 Ga0495676_0017217_1352_2428 340
163 3300048088 Ga0495602_0136254 Ga0495602_0136254_79_1155 340
164 3300048908 Ga0496105_0001854 Ga0496105_0001854_11993_13069 340
165 3300048922 Ga0496119_0002529 Ga0496119_0002529_5868_6944 340
166 3300048928 Ga0496125_0046983 Ga0496125_0046983_2010_3086 340
167 iso_pu_bacteria 2935908558 2935915348 340
168 iso_pu_bacteria 2935926038 2935933692 340
169 iso_pu_bacteria 2935934488 2935941335 340
170 iso_pu_bacteria 2935942939 2935949606 340
171 iso_pu_bacteria 2935951376 2935958219 340
172 iso_pu_bacteria 2935967501 2935975162 340
173 iso_pu_bacteria 8019687851 8019695894 340
174 3300005434 Ga0070709_10001696 Ga0070709_100016965 341
175 3300005437 Ga0070710_10137594 Ga0070710_101375942 341
176 3300006173 Ga0070716_100057822 Ga0070716_1000578221 341
177 3300006175 Ga0070712_100140995 Ga0070712_1001409952 341
178 3300025297 Ga0209758_1029065 Ga0209758_10290653 341
179 3300025906 Ga0207699_10017193 Ga0207699_100171939 341
180 3300025915 Ga0207693_10019059 Ga0207693_100190593 341
181 3300025916 Ga0207663_10166329 Ga0207663_101663292 341
182 3300025928 Ga0207700_10045323 Ga0207700_100453233 341
183 3300050493 nmdc:mga0k408_143773_c1 nmdc:mga0k408_143773_c1_116_1156 341
184 3300050496 nmdc:mga07m45_69150_c1 nmdc:mga07m45_69150_c1_694_1734 341
185 iso_pu_bacteria 2513237096 2513660598 341
186 iso_pu_bacteria 2513237137 2513863775 341
187 iso_pu_bacteria 2513237145 2513922353 341
188 iso_pu_bacteria 2841941048 2841948737 341
189 iso_pu_bacteria 2857524615 2857530784 341
190 iso_pu_bacteria 2879083081 2879084725 341
191 iso_pu_bacteria 2904699407 2904704382 341
192 iso_pu_bacteria 2906660503 2906662325 341
193 iso_pu_bacteria 2935684952 2935690872 341
194 iso_pu_bacteria 2935713505 2935718253 341
195 iso_pu_bacteria 2935722832 2935727766 341
196 iso_pu_bacteria 2935732158 2935736470 341
197 iso_pu_bacteria 2935741537 2935745849 341
198 iso_pu_bacteria 2935750917 2935756230 341
199 iso_pu_bacteria 2940556831 2940561795 341
200 iso_pu_bacteria 8016630954 8016633168 341
201 iso_pu_bacteria 8019597564 8019602531 341
202 iso_pu_bacteria 8019608314 8019616027 341
203 3300009094 Ga0111539_10290843 Ga0111539_102908431 342
204 3300050511 nmdc:mga08y16_393518_c1 nmdc:mga08y16_393518_c1_298_1350 342
205 3300009147 Ga0114129_10204244 Ga0114129_102042442 343
206 3300050507 nmdc:mga05p37_218079_c1 nmdc:mga05p37_218079_c1_892_1977 343
207 3300050513 nmdc:mga0rr50_93579_c1 nmdc:mga0rr50_93579_c1_915_2000 343
208 3300005347 Ga0070668_100105024 Ga0070668_1001050242 344
209 3300005455 Ga0070663_100007700 Ga0070663_1000077008 344
210 3300005841 Ga0068863_100029792 Ga0068863_1000297922 344
211 3300013308 Ga0157375_10059186 Ga0157375_100591866 344
212 3300014325 Ga0163163_10052293 Ga0163163_100522933 344
213 3300017792 Ga0163161_10280728 Ga0163161_102807281 344
214 3300025315 Ga0207697_10026098 Ga0207697_100260982 344
215 3300025901 Ga0207688_10185384 Ga0207688_101853841 344
216 3300025972 Ga0207668_10282963 Ga0207668_102829631 344
217 3300026121 Ga0207683_10018382 Ga0207683_100183826 344
218 3300046452 Ga0495617_013023 Ga0495617_013023_1710_2774 344
219 3300046457 Ga0495590_0010475 Ga0495590_0010475_532_1596 344
220 3300046471 Ga0495650_0041475 Ga0495650_0041475_467_1531 344
221 3300046474 Ga0495605_0012866 Ga0495605_0012866_2653_3717 344
222 3300046491 Ga0495584_0016927 Ga0495584_0016927_890_1954 344
223 3300046500 Ga0495596_0016183 Ga0495596_0016183_553_1617 344
224 3300046506 Ga0495583_0040335 Ga0495583_0040335_857_1921 344
225 3300046507 Ga0495606_0012483 Ga0495606_0012483_2718_3782 344
226 3300046518 Ga0495631_0012104 Ga0495631_0012104_2912_3976 344
227 3300046523 Ga0495644_0080251 Ga0495644_0080251_109_1173 344
228 3300046538 Ga0495609_0053615 Ga0495609_0053615_124_1188 344
229 3300046542 Ga0495597_0010637 Ga0495597_0010637_3141_4205 344
230 3300046660 Ga0495625_0035688 Ga0495625_0035688_170_1234 344
231 3300046665 Ga0495661_0053708 Ga0495661_0053708_607_1671 344
232 3300046684 Ga0495669_0012724 Ga0495669_0012724_905_1969 344
233 3300046810 Ga0495660_0066857 Ga0495660_0066857_685_1749 344
234 3300047323 Ga0495683_0024146 Ga0495683_0024146_1757_2821 344
235 3300047445 Ga0495677_0025042 Ga0495677_0025042_428_1492 344
236 3300047447 Ga0495685_044702 Ga0495685_044702_149_1213 344
237 3300047469 Ga0495673_0016304 Ga0495673_0016304_1644_2708 344
238 3300047470 Ga0495681_0093971 Ga0495681_0093971_196_1260 344
239 3300048905 Ga0496102_0130620 Ga0496102_0130620_461_1609 344
240 3300048917 Ga0496114_0056554 Ga0496114_0056554_1573_2634 344
241 3300049460 Ga0495682_0019716 Ga0495682_0019716_1228_2292 344
242 3300053086 Ga0500578_0152564 Ga0500578_0152564_283_1347 344
243 3300053109 Ga0500569_003980 Ga0500569_003980_1049_2113 344
244 3300053137 Ga0500561_0002995 Ga0500561_0002995_906_1970 344
245 3300053142 Ga0500577_0008052 Ga0500577_0008052_1592_2656 344
246 3300053158 Ga0500627_0027337 Ga0500627_0027337_739_1803 344
247 3300053161 Ga0500634_0020924 Ga0500634_0020924_213_1277 344
248 3300003203 JGI25406J46586_10036662 JGI25406J46586_100366622 345
249 3300005334 Ga0068869_100002570 Ga0068869_1000025704 345
250 3300005435 Ga0070714_100065257 Ga0070714_1000652573 345
251 3300005437 Ga0070710_10027587 Ga0070710_100275872 345
252 3300005441 Ga0070700_100088152 Ga0070700_1000881522 345
253 3300005456 Ga0070678_100022323 Ga0070678_1000223238 345
254 3300005547 Ga0070693_100012023 Ga0070693_1000120233 345
255 3300005548 Ga0070665_100145207 Ga0070665_1001452071 345
256 3300005577 Ga0068857_100031403 Ga0068857_1000314039 345
257 3300005614 Ga0068856_100016373 Ga0068856_1000163737 345
258 3300005616 Ga0068852_100229479 Ga0068852_1002294793 345
259 3300005617 Ga0068859_100082281 Ga0068859_1000822813 345
260 3300005618 Ga0068864_100009984 Ga0068864_1000099845 345
261 3300005840 Ga0068870_10062335 Ga0068870_100623353 345
262 3300005843 Ga0068860_100035219 Ga0068860_1000352192 345
263 3300005937 Ga0081455_10009356 Ga0081455_100093565 345
264 3300005985 Ga0081539_10011464 Ga0081539_100114649 345
265 3300006042 Ga0075368_10004994 Ga0075368_100049944 345
266 3300006048 Ga0075363_100000263 Ga0075363_1000002634 345
267 3300006048 Ga0075363_100113619 Ga0075363_1001136192 345
268 3300006051 Ga0075364_10000633 Ga0075364_100006338 345
269 3300006163 Ga0070715_10025327 Ga0070715_100253273 345
270 3300006173 Ga0070716_100017421 Ga0070716_1000174214 345
271 3300006175 Ga0070712_100136895 Ga0070712_1001368951 345
272 3300006178 Ga0075367_10033994 Ga0075367_100339942 345
273 3300006186 Ga0075369_10020095 Ga0075369_100200952 345
274 3300006844 Ga0075428_100033960 Ga0075428_1000339602 345
275 3300006846 Ga0075430_100014438 Ga0075430_1000144383 345
276 3300006846 Ga0075430_100017843 Ga0075430_1000178436 345
277 3300006847 Ga0075431_100003738 Ga0075431_1000037388 345
278 3300006847 Ga0075431_100066791 Ga0075431_1000667912 345
279 3300006847 Ga0075431_100210675 Ga0075431_1002106752 345
280 3300006852 Ga0075433_10002189 Ga0075433_100021893 345
281 3300006852 Ga0075433_10031696 Ga0075433_100316961 345
282 3300006871 Ga0075434_100008638 Ga0075434_1000086383 345
283 3300006871 Ga0075434_100041370 Ga0075434_1000413702 345
284 3300006880 Ga0075429_100016678 Ga0075429_1000166782 345
285 3300006881 Ga0068865_100011082 Ga0068865_10001108210 345
286 3300006931 Ga0097620_100082285 Ga0097620_1000822853 345
287 3300006942 Ga0099824_1021502 Ga0099824_10215022 345
288 3300006944 Ga0099823_1000010 Ga0099823_100001054 345
289 3300007076 Ga0075435_100003257 Ga0075435_1000032577 345
290 3300007076 Ga0075435_100065232 Ga0075435_1000652323 345
291 3300007788 Ga0099795_10053271 Ga0099795_100532711 345
292 3300009094 Ga0111539_10006741 Ga0111539_100067419 345
293 3300009094 Ga0111539_10085014 Ga0111539_100850144 345
294 3300009098 Ga0105245_10108129 Ga0105245_101081292 345
295 3300009101 Ga0105247_10044307 Ga0105247_100443072 345
296 3300009101 Ga0105247_10109466 Ga0105247_101094662 345
297 3300009101 Ga0105247_10304415 Ga0105247_103044151 345
298 3300009147 Ga0114129_10000124 Ga0114129_1000012478 345
299 3300009148 Ga0105243_10181405 Ga0105243_101814052 345
300 3300009174 Ga0105241_10013695 Ga0105241_100136952 345
301 3300009174 Ga0105241_10026300 Ga0105241_100263002 345
302 3300009545 Ga0105237_10142490 Ga0105237_101424904 345
303 3300009551 Ga0105238_10440657 Ga0105238_104406571 345
304 3300010159 Ga0099796_10000619 Ga0099796_100006196 345
305 3300011119 Ga0105246_10007015 Ga0105246_100070153 345
306 3300011119 Ga0105246_10007480 Ga0105246_100074806 345
307 3300013296 Ga0157374_10010439 Ga0157374_100104392 345
308 3300013296 Ga0157374_10013821 Ga0157374_100138213 345
309 3300013306 Ga0163162_10145448 Ga0163162_101454482 345
310 3300013308 Ga0157375_10004049 Ga0157375_1000404913 345
311 3300014745 Ga0157377_10004783 Ga0157377_100047836 345
312 3300014745 Ga0157377_10195374 Ga0157377_101953741 345
313 3300014968 Ga0157379_10024891 Ga0157379_100248914 345
314 3300014968 Ga0157379_10191465 Ga0157379_101914652 345
315 3300014969 Ga0157376_10033867 Ga0157376_100338675 345
316 3300025908 Ga0207643_10099724 Ga0207643_100997241 345
317 3300025911 Ga0207654_10049397 Ga0207654_100493972 345
318 3300025914 Ga0207671_10018080 Ga0207671_100180807 345
319 3300025914 Ga0207671_10304537 Ga0207671_103045371 345
320 3300025915 Ga0207693_10036858 Ga0207693_100368583 345
321 3300025916 Ga0207663_10000994 Ga0207663_100009942 345
322 3300025920 Ga0207649_10041241 Ga0207649_100412412 345
323 3300025927 Ga0207687_10008587 Ga0207687_1000858711 345
324 3300025938 Ga0207704_10025618 Ga0207704_100256182 345
325 3300025939 Ga0207665_10005890 Ga0207665_100058908 345
326 3300025939 Ga0207665_10184855 Ga0207665_101848552 345
327 3300025940 Ga0207691_10345308 Ga0207691_103453082 345
328 3300025942 Ga0207689_10001257 Ga0207689_1000125712 345
329 3300025942 Ga0207689_10220042 Ga0207689_102200421 345
330 3300025949 Ga0207667_10058158 Ga0207667_100581586 345
331 3300026023 Ga0207677_10014152 Ga0207677_100141522 345
332 3300026023 Ga0207677_10026467 Ga0207677_100264673 345
333 3300026035 Ga0207703_10028127 Ga0207703_100281273 345
334 3300026067 Ga0207678_10055358 Ga0207678_100553582 345
335 3300026075 Ga0207708_10065674 Ga0207708_100656743 345
336 3300026078 Ga0207702_10024976 Ga0207702_100249763 345
337 3300026095 Ga0207676_10020473 Ga0207676_100204734 345
338 3300026116 Ga0207674_10062326 Ga0207674_100623267 345
339 3300026121 Ga0207683_10095801 Ga0207683_100958013 345
340 3300027296 Ga0209389_1000028 Ga0209389_100002889 345
341 3300027296 Ga0209389_1000216 Ga0209389_100021642 345
342 3300027296 Ga0209389_1014188 Ga0209389_10141885 345
343 3300027361 Ga0209489_100027 Ga0209489_10002757 345
344 3300027361 Ga0209489_102145 Ga0209489_10214542 345
345 3300027361 Ga0209489_112870 Ga0209489_1128705 345
346 3300027363 Ga0209700_100022 Ga0209700_10002290 345
347 3300027363 Ga0209700_111287 Ga0209700_1112877 345
348 3300027866 Ga0209813_10002719 Ga0209813_100027194 345
349 3300027907 Ga0207428_10002690 Ga0207428_1000269013 345
350 3300027907 Ga0207428_10018624 Ga0207428_100186244 345
351 3300027907 Ga0207428_10141285 Ga0207428_101412852 345
352 3300027907 Ga0207428_10244138 Ga0207428_102441381 345
353 3300028379 Ga0268266_10033253 Ga0268266_100332532 345
354 3300028379 Ga0268266_10057792 Ga0268266_100577922 345
355 3300031911 Ga0307412_10077708 Ga0307412_100777082 345
356 3300033442 Ga0315911_1000003 Ga0315911_100000320 345
357 3300037312 Ga0395899_0174397 Ga0395899_0174397_74_1162 345
358 3300037418 Ga0395900_0163519 Ga0395900_0163519_580_1668 345
359 3300037471 Ga0395905_0048469 Ga0395905_0048469_2343_3428 345
360 3300038443 Ga0395901_0061019 Ga0395901_0061019_1609_2697 345
361 3300038443 Ga0395901_0095068 Ga0395901_0095068_912_1997 345
362 3300039438 Ga0436360_1173027 Ga0436360_1173027_2436_3548 345
363 3300039447 Ga0436361_0884332 Ga0436361_0884332_20_1195 345
364 3300044658 Ga0466972_0004191 Ga0466972_0004191_2937_4028 345
365 3300044901 Ga0466960_0050546 Ga0466960_0050546_585_1676 345
366 3300045049 Ga0466959_0117404 Ga0466959_0117404_162_1382 345
367 3300046462 Ga0495651_0005977 Ga0495651_0005977_1386_2495 345
368 3300046522 Ga0495643_0092681 Ga0495643_0092681_281_1339 345
369 3300046536 Ga0495587_0008994 Ga0495587_0008994_2078_3187 345
370 3300046538 Ga0495609_0008667 Ga0495609_0008667_3101_4216 345
371 3300046675 Ga0495657_0130510 Ga0495657_0130510_192_1301 345
372 3300046679 Ga0495623_0007803 Ga0495623_0007803_2990_4099 345
373 3300047317 Ga0495604_0093210 Ga0495604_0093210_143_1252 345
374 3300047317 Ga0495604_0145299 Ga0495604_0145299_36_1145 345
375 3300047321 Ga0495676_0075746 Ga0495676_0075746_1383_2498 345
376 3300048088 Ga0495602_0037651 Ga0495602_0037651_1686_2795 345
377 3300048904 Ga0496101_0220920 Ga0496101_0220920_343_1419 345
378 3300048905 Ga0496102_0004300 Ga0496102_0004300_9010_10077 345
379 3300048905 Ga0496102_0009668 Ga0496102_0009668_745_1821 345
380 3300048906 Ga0496103_0053587 Ga0496103_0053587_894_1970 345
381 3300048906 Ga0496103_0143250 Ga0496103_0143250_365_1432 345
382 3300048907 Ga0496104_0016800 Ga0496104_0016800_1686_2753 345
383 3300048907 Ga0496104_0031480 Ga0496104_0031480_1788_2864 345
384 3300048908 Ga0496105_0122963 Ga0496105_0122963_281_1348 345
385 3300048908 Ga0496105_0189433 Ga0496105_0189433_98_1174 345
386 3300048909 Ga0496106_0022422 Ga0496106_0022422_1096_2163 345
387 3300048909 Ga0496106_0028562 Ga0496106_0028562_1744_2820 345
388 3300048910 Ga0496107_0009341 Ga0496107_0009341_4241_5317 345
389 3300048912 Ga0496109_0040676 Ga0496109_0040676_2103_3179 345
390 3300048912 Ga0496109_0040834 Ga0496109_0040834_2187_3254 345
391 3300048912 Ga0496109_0164310 Ga0496109_0164310_204_1277 345
392 3300048913 Ga0496110_0033568 Ga0496110_0033568_2692_3768 345
393 3300048913 Ga0496110_0082417 Ga0496110_0082417_1413_2480 345
394 3300048914 Ga0496111_0040227 Ga0496111_0040227_233_1300 345
395 3300048915 Ga0496112_0000323 Ga0496112_0000323_23529_24596 345
396 3300048915 Ga0496112_0098270 Ga0496112_0098270_1650_2723 345
397 3300048915 Ga0496112_0292124 Ga0496112_0292124_301_1401 345
398 3300048917 Ga0496114_0211675 Ga0496114_0211675_594_1658 345
399 3300048918 Ga0496115_0122711 Ga0496115_0122711_362_1438 345
400 3300048929 Ga0496126_0009502 Ga0496126_0009502_7172_8236 345
401 3300049571 Ga0501034_0170886 Ga0501034_0170886_661_1698 345
402 3300050490 nmdc:mga03n38_5867_c1 nmdc:mga03n38_5867_c1_1999_3066 345
403 3300050491 nmdc:mga00v17_1491_c1 nmdc:mga00v17_1491_c1_2250_3317 345
404 3300050492 nmdc:mga0yw44_190651_c1 nmdc:mga0yw44_190651_c1_216_1253 345
405 3300050493 nmdc:mga0k408_16027_c1 nmdc:mga0k408_16027_c1_254_1321 345
406 3300050494 nmdc:mga06z11_12469_c1 nmdc:mga06z11_12469_c1_774_1811 345
407 3300050495 nmdc:mga04h51_643_c1 nmdc:mga04h51_643_c1_5392_6459 345
408 3300050507 nmdc:mga05p37_274_c1 nmdc:mga05p37_274_c1_45474_46550 345
409 3300050508 nmdc:mga09592_14701_c1 nmdc:mga09592_14701_c1_4494_5654 345
410 3300050509 nmdc:mga0qj67_12037_c1 nmdc:mga0qj67_12037_c1_4033_5193 345
411 3300050509 nmdc:mga0qj67_20813_c1 nmdc:mga0qj67_20813_c1_2214_3290 345
412 3300050510 nmdc:mga06r32_12381_c1 nmdc:mga06r32_12381_c1_4621_5781 345
413 3300050510 nmdc:mga06r32_27659_c1 nmdc:mga06r32_27659_c1_2368_3483 345
414 3300050510 nmdc:mga06r32_3269_c1 nmdc:mga06r32_3269_c1_6754_7830 345
415 3300050511 nmdc:mga08y16_3838_c1 nmdc:mga08y16_3838_c1_1608_2684 345
416 3300050511 nmdc:mga08y16_54101_c1 nmdc:mga08y16_54101_c1_662_1783 345
417 3300050511 nmdc:mga08y16_94479_c1 nmdc:mga08y16_94479_c1_1349_2509 345
418 3300050512 nmdc:mga0n895_11489_c1 nmdc:mga0n895_11489_c1_5125_6192 345
419 3300050512 nmdc:mga0n895_450_c1 nmdc:mga0n895_450_c1_12720_13880 345
420 3300050513 nmdc:mga0rr50_1936_c1 nmdc:mga0rr50_1936_c1_5192_6352 345
421 3300050515 nmdc:mga0a205_1149_c1 nmdc:mga0a205_1149_c1_7891_9051 345
422 3300050515 nmdc:mga0a205_51202_c1 nmdc:mga0a205_51202_c1_2786_3907 345
423 3300050516 nmdc:mga0sz30_1387_c1 nmdc:mga0sz30_1387_c1_896_1933 345
424 3300050516 nmdc:mga0sz30_39796_c1 nmdc:mga0sz30_39796_c1_48_1115 345
425 3300053085 Ga0495619_0091207 Ga0495619_0091207_432_1541 345
426 3300053153 Ga0500616_0000057 Ga0500616_0000057_54457_55515 345

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

165

323

0.89

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

171

309

0.79

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

18

181

0.77

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

19

137

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7fg9-assembly1.cif.gz_B-2 alpha-1,2-glucosyltransferase_udp_tll1591 0.9275 1 339
7fg9-assembly1.cif.gz_B-2 alpha-1,2-glucosyltransferase_udp_tll1591 0.9172 1 339
5ze7-assembly1.cif.gz_B udp glucose alpha tetrahydrobiopterin glycosyltransferase from synechococcus species pcc 7942 - apo form 0.8253 2 338
2f9f-assembly1.cif.gz_A crystal structure of the putative mannosyl transferase (wbaz-1)from archaeoglobus fulgidus, northeast structural genomics target gr29a. 0.8103 159 330
5ze7-assembly1.cif.gz_B udp glucose alpha tetrahydrobiopterin glycosyltransferase from synechococcus species pcc 7942 - apo form 0.8055 2 338
ID Description Score Start End Superfamily
af_Q84QB1_230_385_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8306 169 319 3.40.50.2000
af_A4HWZ0_269_461_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8079 170 337 3.40.50.2000
af_G5ECB6_188_358_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8078 167 307 3.40.50.2000
2iv3B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8046 158 320 3.40.50.2000
af_Q84QB1_230_385_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8011 169 319 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A410V3U5-F1-model_v4 Glycosyl transferase 0.9885 1 339 GO:0016758
AF-A0A7S7W5R6-F1-model_v4 Glycosyltransferase family 4 protein 0.987 1 339 GO:0016757
AF-A0A6P1BMX7-F1-model_v4 Glycosyltransferase family 4 protein 0.9864 1 341 GO:0016758
AF-A0A7C2LR55-F1-model_v4 Glycosyltransferase family 4 protein 0.9857 1 344 GO:0016757
AF-A2W603-F1-model_v4 deleted 0.9852 1 167

Feature Viewer

pLDDT pTM Quality
91.45 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map