F441084

General Info

Members Datasets Scaffolds Average Seq Length
425 278 850 465

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2671180195|2671833762
Length 525
Sequence RRRGAQTGRLLVKDWTQPVQLCMGGVRPPDAQSFRLGSPAMTTATLLPPPCRDPGVRKSSKKGPRVADTAAGPVDLVILGGGSGGYAAALRAAELGLRVVLIEKDKLGGTCLHRGCIPTKALLHAAEVADTVADSAAFGVHATLGGIDPAGVARYRDSVVDGLYKGLTGLVHSRGIEVVAGAGQVVSPTAVAVGDRLIEGRHLLLATGSAPRTLPGLEIDHRTVIDSDDALALGRVPASVVVLGGGAIGCEFASVWRSFGAEVTIVEALPHLVPAEDEASSKLLERAFGRRGISLRLGVPFADAKTTDRGVTVVLEDGATIDAELLLVAVGRGPVSAGLGLERIGVTTDRGHVVVDPQLRTNLPTVSALGDLRPGLQLAHVAFAEGILVAERLAGLDPVPVDYVNVPRVTYSHPEVASVGLTVAAARKRFGEVDTATYHLAGNGKARILRSSGAVTVVSAQDGPVLGVHMVGDRVGELIAEAQLITNWEXYPTDVAQLIHPHPTLSEALGEAHLALAGKPLHVHS

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
65 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
103 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
104 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
105 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
108 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
116 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
117 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 2671180195 Frankia sp. CcI49 Isolate Nodule
230 2506783011 Frankia datiscae Dg1 Isolate Nodule
231 2527291627 Frankia casuarinae Thr Isolate Nodule
232 2527291629 Frankia sp. BMG5.23 Isolate Nodule
233 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
234 2558860280 Kutzneria sp. 744 Isolate Unclassified
235 2576861822 Frankia sp. CeD Isolate Nodule
236 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
237 2582580736 Prauserella sp. Am3 Isolate Unclassified
238 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
239 2619618881 Frankia sp. ACN1ag Isolate Unclassified
240 2619619003 Frankia sp. CpI1-P Isolate Nodule
241 2626541554 Frankia sp. AvcI.1 Isolate Nodule
242 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
243 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
244 2684623036 Frankia sp. CgIM4 Isolate Nodule
245 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
246 2710264753 Frankia sp. KB5 Isolate Nodule
247 2773857922 Frankia sp. CcI49 Isolate Nodule
248 2773857924 Frankia sp. CgIS1 Isolate Nodule
249 2773857933 Frankia sp. BMG5.30 Isolate Nodule
250 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
251 2818991441 Niallia circulans 3243 Isolate Rhizosphere
252 2818991459 Paenibacillus sp. 597 Isolate Unclassified
253 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
254 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
255 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
256 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
257 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
258 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
259 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
260 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
261 2891562705 Microbispora tritici MT50 Isolate Unclassified
262 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
263 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
264 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
265 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
266 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
267 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
268 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
269 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
270 637000116 Frankia casuarinae CcI3 Isolate Nodule
271 8002775197 Frankia nepalensis CN7 Isolate Nodule
272 8002784119 Frankia sp. AgB1.9 Isolate Nodule
273 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
274 8054920844 Frankia tisae Agncl-8 Isolate Nodule
275 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
276 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
277 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
278 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.12
Metatranscriptomes 2.12
Isolates 11.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 4.47
Rhizoplane 3.06
Rhizosphere 81.65
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10010398 3300003373 Bacteria 2367
2 Ga0058862_10039324 3300004803 Bacteria 1791
3 Ga0068869_100002448 3300005334 Bacteria 11191
4 Ga0070661_100044695 3300005344 Bacteria 3236
5 Ga0070669_100043741 3300005353 Bacteria 3263
6 Ga0070675_100034697 3300005354 Bacteria 4095
7 Ga0070710_10000049 3300005437 Bacteria 56819
8 Ga0070711_100050213 3300005439 Bacteria 2859
9 Ga0070711_100088629 3300005439 Bacteria 2224
10 Ga0070708_100046651 3300005445 Bacteria 3823
11 Ga0070663_100057129 3300005455 Bacteria 2798
12 Ga0070662_100006466 3300005457 Bacteria 7556
13 Ga0070681_10203528 3300005458 Bacteria 1897
14 Ga0068867_100023374 3300005459 Bacteria 4425
15 Ga0070706_100003263 3300005467 Bacteria 16040
16 Ga0070706_100006933 3300005467 Bacteria 10691
17 Ga0070706_100041628 3300005467 Bacteria 4241
18 Ga0070706_100062403 3300005467 Bacteria 3443
19 Ga0070707_100000118 3300005468 Bacteria 73941
20 Ga0070707_100011560 3300005468 Bacteria 8234
21 Ga0070707_100052194 3300005468 Bacteria 3919
22 Ga0070707_100117055 3300005468 Bacteria 2587
23 Ga0070698_100000233 3300005471 Bacteria 55119
24 Ga0070698_100006080 3300005471 Bacteria 13149
25 Ga0070698_100017668 3300005471 Bacteria 7514
26 Ga0070679_100170387 3300005530 Bacteria 2150
27 Ga0070684_100013548 3300005535 Bacteria 6580
28 Ga0070684_100238495 3300005535 Bacteria 1661
29 Ga0070697_100010070 3300005536 Bacteria 7376
30 Ga0070697_100068748 3300005536 Bacteria 2900
31 Ga0068853_100065842 3300005539 Bacteria 3145
32 Ga0068853_100248047 3300005539 Bacteria 1633
33 Ga0070696_100003167 3300005546 Bacteria 10952
34 Ga0070665_100127803 3300005548 Bacteria 2544
35 Ga0068855_100313798 3300005563 Bacteria 1734
36 Ga0070664_100021520 3300005564 Bacteria 5316
37 Ga0070664_100175871 3300005564 Bacteria 1900
38 Ga0068857_100084318 3300005577 Bacteria 2839
39 Ga0068856_100094733 3300005614 Bacteria 2973
40 Ga0068859_100028552 3300005617 Bacteria 5593
41 Ga0068861_100084167 3300005719 Bacteria 2497
42 Ga0068858_100000004 3300005842 Bacteria 336234
43 Ga0068862_100041534 3300005844 Bacteria 3913
44 Ga0081455_10000090 3300005937 Bacteria 97813
45 Ga0081455_10000136 3300005937 Bacteria 85921
46 Ga0081538_10000025 3300005981 Bacteria 129366
47 Ga0081540_1012289 3300005983 Bacteria 5652
48 Ga0070717_10002001 3300006028 Bacteria 14252
49 Ga0070717_10044644 3300006028 Bacteria 3621
50 Ga0075432_10001336 3300006058 Bacteria 7981
51 Ga0070716_100000836 3300006173 Bacteria 13283
52 Ga0070716_100003825 3300006173 Bacteria 7143
53 Ga0070716_100006493 3300006173 Bacteria 5715
54 Ga0070712_100001208 3300006175 Bacteria 15617
55 Ga0070712_100005731 3300006175 Bacteria 7681
56 Ga0075428_100004160 3300006844 Bacteria 15929
57 Ga0075433_10001153 3300006852 Bacteria 19198
58 Ga0075433_10001855 3300006852 Bacteria 15881
59 Ga0075434_100000935 3300006871 Bacteria 23462
60 Ga0075434_100003386 3300006871 Bacteria 14270
61 Ga0075434_100010596 3300006871 Bacteria 8649
62 Ga0068865_100022704 3300006881 Bacteria 4097
63 Ga0075436_100037507 3300006914 Bacteria 3346
64 Ga0075435_100004364 3300007076 Bacteria 9717
65 Ga0075435_100024654 3300007076 Bacteria 4671
66 Ga0075435_100027168 3300007076 Bacteria 4473
67 Ga0075435_100040255 3300007076 Bacteria 3731
68 Ga0105251_10038152 3300009011 Bacteria 2354
69 Ga0111539_10024731 3300009094 Bacteria 7366
70 Ga0111539_10083216 3300009094 Bacteria 3764
71 Ga0105245_10008030 3300009098 Bacteria 9231
72 Ga0105245_10013971 3300009098 Bacteria 6992
73 Ga0105247_10000013 3300009101 Bacteria 287863
74 Ga0105247_10000448 3300009101 Bacteria 34932
75 Ga0105247_10099409 3300009101 Bacteria 1858
76 Ga0114129_10006659 3300009147 Bacteria 16405
77 Ga0105243_10003549 3300009148 Bacteria 12606
78 Ga0105243_10047408 3300009148 Bacteria 3383
79 Ga0105242_10024344 3300009176 Bacteria 4781
80 Ga0105248_10010171 3300009177 Bacteria 10362
81 Ga0105248_10047387 3300009177 Bacteria 4819
82 Ga0105238_10219594 3300009551 Bacteria 1877
83 Ga0105249_10031536 3300009553 Bacteria 4793
84 Ga0105239_10220395 3300010375 Bacteria 2127
85 Ga0157369_10035046 3300013105 Bacteria 5504
86 Ga0163162_10018194 3300013306 Bacteria 6881
87 Ga0163162_10082440 3300013306 Bacteria 3288
88 Ga0157372_10005682 3300013307 Bacteria 13271
89 Ga0157372_10195202 3300013307 Bacteria 2345
90 Ga0157380_10031062 3300014326 Bacteria 4098
91 Ga0157377_10013090 3300014745 Bacteria 4191
92 Ga0157379_10000001 3300014968 Bacteria 180484
93 Ga0157379_10000280 3300014968 Bacteria 40342
94 Ga0163161_10042258 3300017792 Bacteria 3278
95 Ga0197907_10436456 3300020069 Bacteria 4023
96 Ga0206349_1260217 3300020075 Bacteria 2676
97 Ga0206355_1715402 3300020076 Bacteria 2331
98 Ga0206350_11315808 3300020080 Bacteria 2057
99 Ga0206354_10113325 3300020081 Bacteria 3862
100 Ga0154015_1469392 3300020610 Bacteria 2280
101 Ga0213875_10000155 3300021388 Bacteria 72442
102 Ga0224712_10005527 3300022467 Bacteria 3528
103 Ga0224712_10010730 3300022467 Bacteria 2813
104 Ga0209566_102251 3300025225 Bacteria 3768
105 Ga0207692_10000060 3300025898 Bacteria 32399
106 Ga0207692_10011178 3300025898 Bacteria 3808
107 Ga0207710_10000030 3300025900 Bacteria 287870
108 Ga0207699_10000450 3300025906 Bacteria 21070
109 Ga0207699_10002020 3300025906 Bacteria 9579
110 Ga0207699_10005010 3300025906 Bacteria 6335
111 Ga0207699_10017003 3300025906 Bacteria 3817
112 Ga0207645_10026547 3300025907 Bacteria 3742
113 Ga0207705_10010789 3300025909 Bacteria 6632
114 Ga0207684_10003966 3300025910 Bacteria 14170
115 Ga0207684_10006469 3300025910 Bacteria 10680
116 Ga0207684_10006600 3300025910 Bacteria 10555
117 Ga0207684_10013313 3300025910 Bacteria 7116
118 Ga0207707_10024830 3300025912 Bacteria 5242
119 Ga0207693_10043022 3300025915 Bacteria 3556
120 Ga0207693_10159364 3300025915 Bacteria 1775
121 Ga0207663_10012719 3300025916 Bacteria 4557
122 Ga0207663_10061549 3300025916 Bacteria 2382
123 Ga0207660_10032068 3300025917 Bacteria 3624
124 Ga0207649_10052932 3300025920 Bacteria 2520
125 Ga0207652_10040662 3300025921 Bacteria 3949
126 Ga0207652_10106677 3300025921 Bacteria 2480
127 Ga0207652_10128621 3300025921 Bacteria 2257
128 Ga0207652_10176326 3300025921 Bacteria 1920
129 Ga0207646_10000235 3300025922 Bacteria 76449
130 Ga0207646_10001227 3300025922 Bacteria 32208
131 Ga0207646_10021253 3300025922 Bacteria 5999
132 Ga0207646_10046296 3300025922 Bacteria 3902
133 Ga0207687_10028571 3300025927 Bacteria 3746
134 Ga0207700_10001898 3300025928 Bacteria 11872
135 Ga0207700_10008877 3300025928 Bacteria 6252
136 Ga0207664_10005164 3300025929 Bacteria 8897
137 Ga0207664_10015296 3300025929 Bacteria 5563
138 Ga0207664_10022329 3300025929 Bacteria 4723
139 Ga0207706_10002325 3300025933 Bacteria 18554
140 Ga0207706_10006479 3300025933 Bacteria 10869
141 Ga0207706_10067596 3300025933 Bacteria 3144
142 Ga0207709_10085737 3300025935 Unclassified 2043
143 Ga0207665_10000934 3300025939 Bacteria 19786
144 Ga0207665_10002362 3300025939 Bacteria 12743
145 Ga0207665_10026432 3300025939 Bacteria 3831
146 Ga0207711_10021617 3300025941 Bacteria 5375
147 Ga0207711_10026716 3300025941 Bacteria 4846
148 Ga0207689_10005625 3300025942 Bacteria 11167
149 Ga0207661_10004276 3300025944 Bacteria 9999
150 Ga0207661_10081450 3300025944 Bacteria 2674
151 Ga0207661_10095086 3300025944 Bacteria 2490
152 Ga0207679_10012867 3300025945 Bacteria 5472
153 Ga0207677_10115046 3300026023 Bacteria 2011
154 Ga0207703_10000003 3300026035 Bacteria 532213
155 Ga0207703_10000011 3300026035 Bacteria 336248
156 Ga0207678_10052247 3300026067 Bacteria 3526
157 Ga0207674_10025300 3300026116 Bacteria 6334
158 Ga0207675_100004599 3300026118 Bacteria 13296
159 Ga0207675_100013817 3300026118 Bacteria 7529
160 Ga0207698_10013554 3300026142 Bacteria 5384
161 Ga0207698_10120528 3300026142 Bacteria 2219
162 Ga0207428_10029077 3300027907 Bacteria 4585
163 Ga0207428_10089955 3300027907 Bacteria 2385
164 Ga0265338_10001471 3300028800 Bacteria 38153
165 Ga0307511_10002128 3300030521 Bacteria 20773
166 Ga0316177_1126820 3300030731 Bacteria 4200
167 Ga0316176_1187338 3300030732 Bacteria 12774
168 Ga0314311_1047880 3300030733 Bacteria 7928
169 Ga0307509_10078145 3300031507 Bacteria 3430
170 Ga0316579_10000160 3300031691 Bacteria 19217
171 Ga0307518_10032532 3300031838 Bacteria 3781
172 Ga0307410_10031283 3300031852 Bacteria 3413
173 Ga0307406_10001181 3300031901 Bacteria 14603
174 Ga0307407_10002935 3300031903 Bacteria 6826
175 Ga0307409_100027665 3300031995 Bacteria 4023
176 Ga0307409_100034551 3300031995 Bacteria 3694
177 Ga0307414_10026846 3300032004 Bacteria 3711
178 Ga0307415_100056723 3300032126 Bacteria 2687
179 Ga0307507_10049212 3300033179 Bacteria 4088
180 Ga0373926_0000275 3300035083 Bacteria 12506
181 Ga0373923_0006675 3300035111 Bacteria 4007
182 Ga0373923_0017847 3300035111 Bacteria 2720
183 Ga0373936_0017241 3300035113 Bacteria 2779
184 Ga0373945_0054341 3300035116 Bacteria 1480
185 Ga0373953_0007904 3300035117 Bacteria 3586
186 Ga0373954_0000649 3300035118 Bacteria 13294
187 Ga0373956_0010281 3300035119 Bacteria 3830
188 Ga0373957_0000066 3300035120 Bacteria 25795
189 Ga0373957_0011118 3300035120 Bacteria 2995
190 Ga0373957_0021191 3300035120 Bacteria 2304
191 Ga0373955_0000076 3300035172 Bacteria 40449
192 Ga0373955_0016604 3300035172 Bacteria 3627
193 Ga0316574_0010401 3300035398 Bacteria 5258
194 Ga0316574_0023853 3300035398 Bacteria 3656
195 Ga0373924_0000342 3300035410 Bacteria 14305
196 Ga0373924_0007691 3300035410 Bacteria 3895
197 Ga0373924_0024513 3300035410 Bacteria 2377
198 Ga0373935_0108902 3300035692 Bacteria 1836
199 Ga0373933_0000166 3300035724 Bacteria 42891
200 Ga0373933_0010226 3300035724 Bacteria 5140
201 Ga0373947_0000001 3300035725 Bacteria 510932
202 Ga0373947_0028512 3300035725 Bacteria 3274
203 Ga0373937_0000229 3300036401 Bacteria 54651
204 Ga0373937_0049636 3300036401 Bacteria 3842
205 Ga0373937_0093302 3300036401 Bacteria 2791
206 Ga0373937_0140715 3300036401 Bacteria 2257
207 Ga0373925_0001383 3300037068 Bacteria 21127
208 Ga0373925_0023683 3300037068 Bacteria 4480
209 Ga0395900_0165471 3300037418 Bacteria 2254
210 Ga0436364_1232097 3300037853 Bacteria 76315
211 Ga0436364_1350774 3300037853 Bacteria 1971
212 Ga0395901_0033434 3300038443 Bacteria 5310
213 Ga0439463_000659 3300042016 Bacteria 9569
214 Ga0466969_0009304 3300044656 Bacteria 5209
215 Ga0466972_0001173 3300044658 Bacteria 12565
216 Ga0466972_0018108 3300044658 Bacteria 3523
217 Ga0466972_0029377 3300044658 Bacteria 2706
218 Ga0466972_0071770 3300044658 Bacteria 1651
219 Ga0466965_0047659 3300044683 Bacteria 2122
220 Ga0466965_0089613 3300044683 Bacteria 1563
221 Ga0466966_0045753 3300044684 Bacteria 2797
222 Ga0466961_0002135 3300044693 Bacteria 12300
223 Ga0466961_0015203 3300044693 Bacteria 4943
224 Ga0466963_0009549 3300044694 Bacteria 5844
225 Ga0466963_0096525 3300044694 Bacteria 2019
226 Ga0466963_0115872 3300044694 Bacteria 1841
227 Ga0466968_0017483 3300044735 Bacteria 2866
228 Ga0466970_0039754 3300044765 Bacteria 2497
229 Ga0466970_0069647 3300044765 Bacteria 1891
230 Ga0466970_0101560 3300044765 Bacteria 1566
231 Ga0466957_0033286 3300044842 Bacteria 3091
232 Ga0466960_0008086 3300044901 Bacteria 4296
233 Ga0466960_0025453 3300044901 Bacteria 2678
234 Ga0466959_0002680 3300045049 Bacteria 11428
235 Ga0466959_0019299 3300045049 Bacteria 5014
236 Ga0466959_0055605 3300045049 Bacteria 2889
237 Ga0466967_0024656 3300045976 Bacteria 4949
238 Ga0466967_0111507 3300045976 Bacteria 2514
239 Ga0495592_0000187 3300046454 Bacteria 54651
240 Ga0495592_0041831 3300046454 Bacteria 3433
241 Ga0495592_0044495 3300046454 Bacteria 3316
242 Ga0495629_0019293 3300046459 Bacteria 4874
243 Ga0495629_0104374 3300046459 Bacteria 1977
244 Ga0495629_0151887 3300046459 Bacteria 1609
245 Ga0495641_0011914 3300046461 Bacteria 4906
246 Ga0495651_0000228 3300046462 Bacteria 42891
247 Ga0495651_0023838 3300046462 Bacteria 4758
248 Ga0495651_0029694 3300046462 Bacteria 4263
249 Ga0495653_0001827 3300046463 Bacteria 16775
250 Ga0495653_0003557 3300046463 Bacteria 12557
251 Ga0495653_0053645 3300046463 Bacteria 3083
252 Ga0495653_0067771 3300046463 Bacteria 2678
253 Ga0495582_0025467 3300046473 Bacteria 3240
254 Ga0495639_0022267 3300046475 Bacteria 2779
255 Ga0495664_0074591 3300046477 Bacteria 2029
256 Ga0495606_0005305 3300046507 Bacteria 12412
257 Ga0495608_0000196 3300046511 Bacteria 42870
258 Ga0495618_0005879 3300046514 Bacteria 7459
259 Ga0495628_0000330 3300046516 Bacteria 42869
260 Ga0495628_0018478 3300046516 Bacteria 5773
261 Ga0495628_0040065 3300046516 Bacteria 3745
262 Ga0495630_0026822 3300046517 Bacteria 4267
263 Ga0495648_0023414 3300046524 Bacteria 4230
264 Ga0495652_0000577 3300046529 Bacteria 42863
265 Ga0495652_0006643 3300046529 Bacteria 10740
266 Ga0495652_0037056 3300046529 Bacteria 4234
267 Ga0495652_0090131 3300046529 Bacteria 2509
268 Ga0495665_0016799 3300046531 Bacteria 3939
269 Ga0495640_0052983 3300046533 Bacteria 2783
270 Ga0495587_0000214 3300046536 Bacteria 42891
271 Ga0495587_0003201 3300046536 Bacteria 10936
272 Ga0495587_0029713 3300046536 Bacteria 3316
273 Ga0495667_0000139 3300046559 Bacteria 49720
274 Ga0495667_0028575 3300046559 Bacteria 3755
275 Ga0495668_0003360 3300046616 Bacteria 12060
276 Ga0495634_0017217 3300046642 Bacteria 5160
277 Ga0495634_0020901 3300046642 Bacteria 4636
278 Ga0495625_0003326 3300046660 Bacteria 16202
279 Ga0495635_0025186 3300046663 Bacteria 4143
280 Ga0495635_0029840 3300046663 Bacteria 3792
281 Ga0495635_0043663 3300046663 Bacteria 3093
282 Ga0495635_0045828 3300046663 Bacteria 3017
283 Ga0495657_0000348 3300046675 Bacteria 42816
284 Ga0495657_0033049 3300046675 Bacteria 3605
285 Ga0495657_0033694 3300046675 Bacteria 3564
286 Ga0495599_0000445 3300046678 Bacteria 23551
287 Ga0495599_0065252 3300046678 Bacteria 2274
288 Ga0495623_0001491 3300046679 Bacteria 15872
289 Ga0495623_0020499 3300046679 Bacteria 4272
290 Ga0495646_0005665 3300046680 Bacteria 7910
291 Ga0495647_0016890 3300046681 Bacteria 2576
292 Ga0495658_0005202 3300046683 Bacteria 6399
293 Ga0495658_0012178 3300046683 Bacteria 4346
294 Ga0495624_0024873 3300046690 Bacteria 3939
295 Ga0495600_0016832 3300046809 Bacteria 4647
296 Ga0495600_0039344 3300046809 Bacteria 3079
297 Ga0495600_0041453 3300046809 Bacteria 3000
298 Ga0495581_0009583 3300047315 Bacteria 5600
299 Ga0495581_0012197 3300047315 Bacteria 4976
300 Ga0495604_0000197 3300047317 Bacteria 54653
301 Ga0495674_0002932 3300047319 Bacteria 16608
302 Ga0495676_0044971 3300047321 Bacteria 3598
303 Ga0495680_0000531 3300047322 Bacteria 42855
304 Ga0495680_0011868 3300047322 Bacteria 7689
305 Ga0495680_0018564 3300047322 Bacteria 5896
306 Ga0495680_0024168 3300047322 Bacteria 5043
307 Ga0495675_0001274 3300047444 Bacteria 15266
308 Ga0495684_0011468 3300047471 Bacteria 6845
309 Ga0495684_0165485 3300047471 Bacteria 1647
310 Ga0495602_0000347 3300048088 Bacteria 42891
311 Ga0495602_0027545 3300048088 Bacteria 5459
312 Ga0495626_0000241 3300048091 Bacteria 63323
313 Ga0496102_0024999 3300048905 Bacteria 5314
314 Ga0496102_0233137 3300048905 Bacteria 1735
315 Ga0496104_0000695 3300048907 Bacteria 28932
316 Ga0496105_0011164 3300048908 Bacteria 7085
317 Ga0496106_0055887 3300048909 Bacteria 2984
318 Ga0496109_0011322 3300048912 Bacteria 7662
319 Ga0496109_0021140 3300048912 Bacteria 5753
320 Ga0496110_0136335 3300048913 Bacteria 2218
321 Ga0496110_0160164 3300048913 Bacteria 2040
322 Ga0496111_0118566 3300048914 Bacteria 1954
323 Ga0496112_0000827 3300048915 Bacteria 21989
324 Ga0496114_0084601 3300048917 Bacteria 2686
325 Ga0496116_0000219 3300048919 Bacteria 107443
326 Ga0496117_0031977 3300048920 Bacteria 4008
327 Ga0496117_0041466 3300048920 Bacteria 3372
328 Ga0496118_0007034 3300048921 Bacteria 12106
329 Ga0496118_0010778 3300048921 Bacteria 9011
330 Ga0496119_0001068 3300048922 Bacteria 34793
331 Ga0496119_0001541 3300048922 Bacteria 27533
332 Ga0496119_0003941 3300048922 Bacteria 15047
333 Ga0496119_0004152 3300048922 Bacteria 14566
334 Ga0496120_0000103 3300048923 Bacteria 141601
335 Ga0496121_0014635 3300048924 Bacteria 8298
336 Ga0496122_0000200 3300048925 Bacteria 133548
337 Ga0496123_0000076 3300048926 Bacteria 194050
338 Ga0496124_0021813 3300048927 Bacteria 5890
339 Ga0496126_0047686 3300048929 Bacteria 3921
340 Ga0501034_0008416 3300049571 Bacteria 10898
341 Ga0501036_0060873 3300049572 Bacteria 3197
342 Ga0501036_0070829 3300049572 Bacteria 2948
343 Ga0501037_0024718 3300049573 Bacteria 4442
344 Ga0501040_0050849 3300049576 Bacteria 2835
345 Ga0501042_0009566 3300049578 Bacteria 6464
346 Ga0501042_0045640 3300049578 Bacteria 3123
347 Ga0501047_0006386 3300049581 Bacteria 11085
348 Ga0501047_0020650 3300049581 Bacteria 6323
349 Ga0501048_0005159 3300049582 Bacteria 9954
350 Ga0501048_0020689 3300049582 Bacteria 4823
351 Ga0501074_0035108 3300049590 Bacteria 3633
352 Ga0501076_0004804 3300049592 Bacteria 9645
353 Ga0501079_0088522 3300049741 Bacteria 2397
354 nmdc:mga09592_105117_c1 3300050508 Bacteria 2420
355 nmdc:mga08y16_77375_c1 3300050511 Bacteria 3469
356 nmdc:mga0n895_14171_c1 3300050512 Bacteria 7230
357 nmdc:mga0n895_29023_c1 3300050512 Bacteria 5271
358 nmdc:mga0n895_3439_c1 3300050512 Bacteria 12779
359 nmdc:mga0rr50_10541_c1 3300050513 Bacteria 5871
360 nmdc:mga0rr50_38242_c1 3300050513 Bacteria 3471
361 nmdc:mga0rr50_4066_c1 3300050513 Bacteria 8539
362 nmdc:mga08x19_11760_c1 3300050514 Bacteria 5271
363 nmdc:mga08x19_6598_c1 3300050514 Bacteria 6879
364 nmdc:mga0a205_25166_c1 3300050515 Bacteria 5667
365 nmdc:mga0a205_2539_c1 3300050515 Bacteria 16079
366 nmdc:mga0a205_40907_c1 3300050515 Bacteria 4464
367 Ga0495612_0005838 3300053078 Bacteria 5085
368 Ga0495595_0001123 3300053084 Bacteria 10369
369 Ga0495595_0004487 3300053084 Bacteria 5618
370 Ga0495619_0015195 3300053085 Bacteria 4866
371 Ga0495619_0077334 3300053085 Bacteria 2235
372 Ga0495619_0186172 3300053085 Bacteria 1437
373 Ga0500559_0005194 3300053136 Bacteria 6010
374 Ga0500568_0010837 3300053139 Bacteria 4252
375 Ga0501082_0108588 3300060353 Bacteria 2401
376 2671833762 2671180195 Bacteria 9757215
377 2506867776 2506783011 Bacteria 5323186
378 2528205312 2527291627 Bacteria 5309833
379 2528214806 2527291629 Bacteria 5267418
380 2546951311 2546825537 Bacteria 5389291
381 2559425701 2558860280 Bacteria 11429938
382 2579749302 2576861822 Bacteria 5004595
383 2579857913 2579778521 Bacteria 7624758
384 2583151553 2582580736 Bacteria 5325865
385 2587738625 2585428059 Bacteria 8696589
386 2619858214 2619618881 Bacteria 7521104
387 2620352419 2619619003 Bacteria 7619552
388 2626633862 2626541554 Bacteria 7741902
389 2644426861 2643221676 Bacteria 8119172
390 2686538375 2684623035 Bacteria 8032739
391 2686543170 2684623036 Bacteria 5199090
392 2689993502 2687453743 Bacteria 8361025
393 2710605639 2710264753 Bacteria 5455564
394 2774851918 2773857922 Bacteria 9757215
395 2774866080 2773857924 Bacteria 5256821
396 2774901886 2773857933 Bacteria 5818019
397 2816425004 2816332119 Bacteria 8120218
398 2819570762 2818991441 Bacteria 5062707
399 2819669317 2818991459 Bacteria 8736032
400 2831905698 2831905167 Bacteria 3319172
401 2848552527 2848551377 Bacteria 3720646
402 2856743578 2856741275 Bacteria 8096094
403 2857453714 2857453340 Bacteria 8090534
404 2857721113 2857720070 Bacteria 3189373
405 2887481019 2887478801 Bacteria 8972725
406 2891397778 2891395885 Bacteria 9251614
407 2891554447 2891554331 Bacteria 8812224
408 2891564880 2891562705 Bacteria 8039471
409 2895889556 2895880812 Bacteria 11255272
410 2904761986 2904755435 Bacteria 7986759
411 2917741091 2917736166 Bacteria 9690793
412 2919429838 2919425241 Bacteria 8055701
413 2925331628 2925326138 Bacteria 9652120
414 2928092238 2928090899 Bacteria 3158267
415 2971411050 2971410472 Bacteria 8311090
416 2980189842 2980182181 Bacteria 9454109
417 637880455 637000116 Bacteria 5433628
418 8002779626 8002775197 Bacteria 10728764
419 8002791759 8002784119 Bacteria 9788632
420 8054915084 8054913762 Bacteria 7713009
421 8054921317 8054920844 Bacteria 7068637
422 8055159824 8055157932 Bacteria 6429399
423 8056065779 8056060235 Bacteria 7259403
424 8056536406 8056533031 Bacteria 8964429
425 8057978983 8057977335 Bacteria 5694872
426 JGI25407J50210_10010398
427 Ga0058862_10039324
428 Ga0068869_100002448
429 Ga0070661_100044695
430 Ga0070669_100043741
431 Ga0070675_100034697
432 Ga0070710_10000049
433 Ga0070711_100050213
434 Ga0070711_100088629
435 Ga0070708_100046651
436 Ga0070663_100057129
437 Ga0070662_100006466
438 Ga0070681_10203528
439 Ga0068867_100023374
440 Ga0070706_100003263
441 Ga0070706_100006933
442 Ga0070706_100041628
443 Ga0070706_100062403
444 Ga0070707_100000118
445 Ga0070707_100011560
446 Ga0070707_100052194
447 Ga0070707_100117055
448 Ga0070698_100000233
449 Ga0070698_100006080
450 Ga0070698_100017668
451 Ga0070679_100170387
452 Ga0070684_100013548
453 Ga0070684_100238495
454 Ga0070697_100010070
455 Ga0070697_100068748
456 Ga0068853_100065842
457 Ga0068853_100248047
458 Ga0070696_100003167
459 Ga0070665_100127803
460 Ga0068855_100313798
461 Ga0070664_100021520
462 Ga0070664_100175871
463 Ga0068857_100084318
464 Ga0068856_100094733
465 Ga0068859_100028552
466 Ga0068861_100084167
467 Ga0068858_100000004
468 Ga0068862_100041534
469 Ga0081455_10000090
470 Ga0081455_10000136
471 Ga0081538_10000025
472 Ga0081540_1012289
473 Ga0070717_10002001
474 Ga0070717_10044644
475 Ga0075432_10001336
476 Ga0070716_100000836
477 Ga0070716_100003825
478 Ga0070716_100006493
479 Ga0070712_100001208
480 Ga0070712_100005731
481 Ga0075428_100004160
482 Ga0075433_10001153
483 Ga0075433_10001855
484 Ga0075434_100000935
485 Ga0075434_100003386
486 Ga0075434_100010596
487 Ga0068865_100022704
488 Ga0075436_100037507
489 Ga0075435_100004364
490 Ga0075435_100024654
491 Ga0075435_100027168
492 Ga0075435_100040255
493 Ga0105251_10038152
494 Ga0111539_10024731
495 Ga0111539_10083216
496 Ga0105245_10008030
497 Ga0105245_10013971
498 Ga0105247_10000013
499 Ga0105247_10000448
500 Ga0105247_10099409
501 Ga0114129_10006659
502 Ga0105243_10003549
503 Ga0105243_10047408
504 Ga0105242_10024344
505 Ga0105248_10010171
506 Ga0105248_10047387
507 Ga0105238_10219594
508 Ga0105249_10031536
509 Ga0105239_10220395
510 Ga0157369_10035046
511 Ga0163162_10018194
512 Ga0163162_10082440
513 Ga0157372_10005682
514 Ga0157372_10195202
515 Ga0157380_10031062
516 Ga0157377_10013090
517 Ga0157379_10000001
518 Ga0157379_10000280
519 Ga0163161_10042258
520 Ga0197907_10436456
521 Ga0206349_1260217
522 Ga0206355_1715402
523 Ga0206350_11315808
524 Ga0206354_10113325
525 Ga0154015_1469392
526 Ga0213875_10000155
527 Ga0224712_10005527
528 Ga0224712_10010730
529 Ga0209566_102251
530 Ga0207692_10000060
531 Ga0207692_10011178
532 Ga0207710_10000030
533 Ga0207699_10000450
534 Ga0207699_10002020
535 Ga0207699_10005010
536 Ga0207699_10017003
537 Ga0207645_10026547
538 Ga0207705_10010789
539 Ga0207684_10003966
540 Ga0207684_10006469
541 Ga0207684_10006600
542 Ga0207684_10013313
543 Ga0207707_10024830
544 Ga0207693_10043022
545 Ga0207693_10159364
546 Ga0207663_10012719
547 Ga0207663_10061549
548 Ga0207660_10032068
549 Ga0207649_10052932
550 Ga0207652_10040662
551 Ga0207652_10106677
552 Ga0207652_10128621
553 Ga0207652_10176326
554 Ga0207646_10000235
555 Ga0207646_10001227
556 Ga0207646_10021253
557 Ga0207646_10046296
558 Ga0207687_10028571
559 Ga0207700_10001898
560 Ga0207700_10008877
561 Ga0207664_10005164
562 Ga0207664_10015296
563 Ga0207664_10022329
564 Ga0207706_10002325
565 Ga0207706_10006479
566 Ga0207706_10067596
567 Ga0207709_10085737
568 Ga0207665_10000934
569 Ga0207665_10002362
570 Ga0207665_10026432
571 Ga0207711_10021617
572 Ga0207711_10026716
573 Ga0207689_10005625
574 Ga0207661_10004276
575 Ga0207661_10081450
576 Ga0207661_10095086
577 Ga0207679_10012867
578 Ga0207677_10115046
579 Ga0207703_10000003
580 Ga0207703_10000011
581 Ga0207678_10052247
582 Ga0207674_10025300
583 Ga0207675_100004599
584 Ga0207675_100013817
585 Ga0207698_10013554
586 Ga0207698_10120528
587 Ga0207428_10029077
588 Ga0207428_10089955
589 Ga0265338_10001471
590 Ga0307511_10002128
591 Ga0316177_1126820
592 Ga0316176_1187338
593 Ga0314311_1047880
594 Ga0307509_10078145
595 Ga0316579_10000160
596 Ga0307518_10032532
597 Ga0307410_10031283
598 Ga0307406_10001181
599 Ga0307407_10002935
600 Ga0307409_100027665
601 Ga0307409_100034551
602 Ga0307414_10026846
603 Ga0307415_100056723
604 Ga0307507_10049212
605 Ga0373926_0000275
606 Ga0373923_0006675
607 Ga0373923_0017847
608 Ga0373936_0017241
609 Ga0373945_0054341
610 Ga0373953_0007904
611 Ga0373954_0000649
612 Ga0373956_0010281
613 Ga0373957_0000066
614 Ga0373957_0011118
615 Ga0373957_0021191
616 Ga0373955_0000076
617 Ga0373955_0016604
618 Ga0316574_0010401
619 Ga0316574_0023853
620 Ga0373924_0000342
621 Ga0373924_0007691
622 Ga0373924_0024513
623 Ga0373935_0108902
624 Ga0373933_0000166
625 Ga0373933_0010226
626 Ga0373947_0000001
627 Ga0373947_0028512
628 Ga0373937_0000229
629 Ga0373937_0049636
630 Ga0373937_0093302
631 Ga0373937_0140715
632 Ga0373925_0001383
633 Ga0373925_0023683
634 Ga0395900_0165471
635 Ga0436364_1232097
636 Ga0436364_1350774
637 Ga0395901_0033434
638 Ga0439463_000659
639 Ga0466969_0009304
640 Ga0466972_0001173
641 Ga0466972_0018108
642 Ga0466972_0029377
643 Ga0466972_0071770
644 Ga0466965_0047659
645 Ga0466965_0089613
646 Ga0466966_0045753
647 Ga0466961_0002135
648 Ga0466961_0015203
649 Ga0466963_0009549
650 Ga0466963_0096525
651 Ga0466963_0115872
652 Ga0466968_0017483
653 Ga0466970_0039754
654 Ga0466970_0069647
655 Ga0466970_0101560
656 Ga0466957_0033286
657 Ga0466960_0008086
658 Ga0466960_0025453
659 Ga0466959_0002680
660 Ga0466959_0019299
661 Ga0466959_0055605
662 Ga0466967_0024656
663 Ga0466967_0111507
664 Ga0495592_0000187
665 Ga0495592_0041831
666 Ga0495592_0044495
667 Ga0495629_0019293
668 Ga0495629_0104374
669 Ga0495629_0151887
670 Ga0495641_0011914
671 Ga0495651_0000228
672 Ga0495651_0023838
673 Ga0495651_0029694
674 Ga0495653_0001827
675 Ga0495653_0003557
676 Ga0495653_0053645
677 Ga0495653_0067771
678 Ga0495582_0025467
679 Ga0495639_0022267
680 Ga0495664_0074591
681 Ga0495606_0005305
682 Ga0495608_0000196
683 Ga0495618_0005879
684 Ga0495628_0000330
685 Ga0495628_0018478
686 Ga0495628_0040065
687 Ga0495630_0026822
688 Ga0495648_0023414
689 Ga0495652_0000577
690 Ga0495652_0006643
691 Ga0495652_0037056
692 Ga0495652_0090131
693 Ga0495665_0016799
694 Ga0495640_0052983
695 Ga0495587_0000214
696 Ga0495587_0003201
697 Ga0495587_0029713
698 Ga0495667_0000139
699 Ga0495667_0028575
700 Ga0495668_0003360
701 Ga0495634_0017217
702 Ga0495634_0020901
703 Ga0495625_0003326
704 Ga0495635_0025186
705 Ga0495635_0029840
706 Ga0495635_0043663
707 Ga0495635_0045828
708 Ga0495657_0000348
709 Ga0495657_0033049
710 Ga0495657_0033694
711 Ga0495599_0000445
712 Ga0495599_0065252
713 Ga0495623_0001491
714 Ga0495623_0020499
715 Ga0495646_0005665
716 Ga0495647_0016890
717 Ga0495658_0005202
718 Ga0495658_0012178
719 Ga0495624_0024873
720 Ga0495600_0016832
721 Ga0495600_0039344
722 Ga0495600_0041453
723 Ga0495581_0009583
724 Ga0495581_0012197
725 Ga0495604_0000197
726 Ga0495674_0002932
727 Ga0495676_0044971
728 Ga0495680_0000531
729 Ga0495680_0011868
730 Ga0495680_0018564
731 Ga0495680_0024168
732 Ga0495675_0001274
733 Ga0495684_0011468
734 Ga0495684_0165485
735 Ga0495602_0000347
736 Ga0495602_0027545
737 Ga0495626_0000241
738 Ga0496102_0024999
739 Ga0496102_0233137
740 Ga0496104_0000695
741 Ga0496105_0011164
742 Ga0496106_0055887
743 Ga0496109_0011322
744 Ga0496109_0021140
745 Ga0496110_0136335
746 Ga0496110_0160164
747 Ga0496111_0118566
748 Ga0496112_0000827
749 Ga0496114_0084601
750 Ga0496116_0000219
751 Ga0496117_0031977
752 Ga0496117_0041466
753 Ga0496118_0007034
754 Ga0496118_0010778
755 Ga0496119_0001068
756 Ga0496119_0001541
757 Ga0496119_0003941
758 Ga0496119_0004152
759 Ga0496120_0000103
760 Ga0496121_0014635
761 Ga0496122_0000200
762 Ga0496123_0000076
763 Ga0496124_0021813
764 Ga0496126_0047686
765 Ga0501034_0008416
766 Ga0501036_0060873
767 Ga0501036_0070829
768 Ga0501037_0024718
769 Ga0501040_0050849
770 Ga0501042_0009566
771 Ga0501042_0045640
772 Ga0501047_0006386
773 Ga0501047_0020650
774 Ga0501048_0005159
775 Ga0501048_0020689
776 Ga0501074_0035108
777 Ga0501076_0004804
778 Ga0501079_0088522
779 nmdc:mga09592_105117_c1
780 nmdc:mga08y16_77375_c1
781 nmdc:mga0n895_14171_c1
782 nmdc:mga0n895_29023_c1
783 nmdc:mga0n895_3439_c1
784 nmdc:mga0rr50_10541_c1
785 nmdc:mga0rr50_38242_c1
786 nmdc:mga0rr50_4066_c1
787 nmdc:mga08x19_11760_c1
788 nmdc:mga08x19_6598_c1
789 nmdc:mga0a205_25166_c1
790 nmdc:mga0a205_2539_c1
791 nmdc:mga0a205_40907_c1
792 Ga0495612_0005838
793 Ga0495595_0001123
794 Ga0495595_0004487
795 Ga0495619_0015195
796 Ga0495619_0077334
797 Ga0495619_0186172
798 Ga0500559_0005194
799 Ga0500568_0010837
800 Ga0501082_0108588
801 2671833762
802 2506867776
803 2528205312
804 2528214806
805 2546951311
806 2559425701
807 2579749302
808 2579857913
809 2583151553
810 2587738625
811 2619858214
812 2620352419
813 2626633862
814 2644426861
815 2686538375
816 2686543170
817 2689993502
818 2710605639
819 2774851918
820 2774866080
821 2774901886
822 2816425004
823 2819570762
824 2819669317
825 2831905698
826 2848552527
827 2856743578
828 2857453714
829 2857721113
830 2887481019
831 2891397778
832 2891554447
833 2891564880
834 2895889556
835 2904761986
836 2917741091
837 2919429838
838 2925331628
839 2928092238
840 2971411050
841 2980189842
842 637880455
843 8002779626
844 8002791759
845 8054915084
846 8054921317
847 8055159824
848 8056065779
849 8056536406
850 8057978983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

74

386

0.98

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

239

318

0.96

PF02852

Pyr_redox_dim

Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain

406

513

0.96

PF00890

FAD_binding_2

FAD binding domain

75

166

0.9

PF01134

GIDA

Glucose inhibited division protein A

75

140

0.86

PF12831

FAD_oxidored

FAD dependent oxidoreductase

75

209

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mif-assembly1.cif.gz_D pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source 0.9823 18 48
6aon-assembly1.cif.gz_B 1.72 angstrom resolution crystal structure of 2-oxoglutarate dehydrogenase complex subunit dihydrolipoamide dehydrogenase from bordetella pertussis in complex with fad 0.9502 17 475
3urh-assembly1.cif.gz_A crystal structure of a dihydrolipoamide dehydrogenase from sinorhizobium meliloti 1021 0.9486 20 467
3rnm-assembly2.cif.gz_D the crystal structure of the subunit binding of human dihydrolipoamide transacylase (e2b) bound to human dihydrolipoamide dehydrogenase (e3) 0.9482 18 475
5j5z-assembly1.cif.gz_B crystal structure of the d444v disease-causing mutant of the human dihydrolipoamide dehydrogenase 0.9465 18 475
ID Description Score Start End Superfamily
af_P27306_158_276_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9705 170 283 3.50.50.60
1ebdB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9665 170 277 3.50.50.60
af_A0A1D6LYX0_29_117_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9656 163 245 3.50.50.60
1ebdA03 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;FAD/NAD-linked reductase, C-terminal dimerisation domain 0.9637 359 466 3.30.390.30
2yquB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9626 165 277 3.50.50.60
ID Description Score Start End GO Terms
AF-Q83G31-F1-model_v4 Dihydrolipoyl dehydrogenase (EC 1.8.1.4) 0.9779 19 477 GO:0004148
GO:0006090
GO:0006103
GO:0050660
AF-A0A357R3S4-F1-model_v4 Dihydrolipoyl dehydrogenase 0.9738 19 113 GO:0004148
GO:0006090
GO:0006103
GO:0050660
AF-Q83G31-F1-model_v4 Dihydrolipoyl dehydrogenase (EC 1.8.1.4) 0.9714 19 477 GO:0004148
GO:0006090
GO:0006103
GO:0050660
AF-A0A3D3A7C8-F1-model_v4 Dihydrolipoyl dehydrogenase (EC 1.8.1.4) 0.9695 153 279 GO:0004148
GO:0006090
GO:0006103
GO:0050660
AF-A0A535E2J9-F1-model_v4 Dihydrolipoyl dehydrogenase (EC 1.8.1.4) 0.9682 112 475 GO:0004148
GO:0006090
GO:0006103
GO:0050660

Map