F441053

General Info

Members Datasets Scaffolds Average Seq Length
425 193 850 484

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0133360|Ga0496114_0133360_66_1829
Length 537
Sequence VSLGRYPELAGGVFGPPRREAEADCVQHWRDLQSWRTSIGTAELARKRARMSDQPTTPAESEPVAPAEPQQKRRFSLPSAYTILFALIVLAAIATWVVPAGVYNLNAVGEPLPGTYHEVPSHPAHILRDSLTAPINGLYGIEDAKGNINYYNSGSLFGAIDIALFILVIGGFLGVTMKTGAIETGIGNLVQRLKGRERLMIPVLMSVFALGGTSYGMAEESLGFYALVITVLIAAGFDALTGAAVVLLGCGIGVIGSTVNPFATGIASGIAGVPISEGLIGRLVILIVGVVIGVFFVLRYADRVKKDPSRSLVYDLKAENEARFRADIGDGDQVALTGVQKAILTVFALAFLVMIYGVIPWSDLGIPFPTWXXXXPEMTASFLLFAIIIGLIGRLSEGELTTSFVDGARDLLGVALIIGIARGITVIMNNGQITDTILHWIENALGGTGEVWFLVLMFLLFLPLSFVIPSSSGLATLAMPIVAPLAGFLGVSTALVVTAYQLAIARVPYGTYLRWVWPLLVLLSGLSIAVLAISAAV

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
125 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0
Rhizoplane 14.12
Rhizosphere 84
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0133360 3300048917 Bacteria 2147
2 Ga0058859_10028464 3300004798 Bacteria 3328
3 Ga0070658_10158514 3300005327 Bacteria 1898
4 Ga0070683_100027878 3300005329 Bacteria 5098
5 Ga0070690_100005045 3300005330 Bacteria 7397
6 Ga0070670_100027803 3300005331 Bacteria 4865
7 Ga0068869_100004531 3300005334 Bacteria 8647
8 Ga0068869_100025717 3300005334 Bacteria 4091
9 Ga0070680_100008816 3300005336 Bacteria 7738
10 Ga0070682_100015963 3300005337 Bacteria 4362
11 Ga0068868_100030444 3300005338 Bacteria 4138
12 Ga0070660_100052345 3300005339 Bacteria 3148
13 Ga0070689_100005548 3300005340 Bacteria 8629
14 Ga0070668_100038427 3300005347 Bacteria 3658
15 Ga0070669_100004470 3300005353 Bacteria 10074
16 Ga0070675_100002887 3300005354 Bacteria 12957
17 Ga0070675_100007055 3300005354 Bacteria 8642
18 Ga0070674_100009211 3300005356 Bacteria 5908
19 Ga0070673_100011963 3300005364 Bacteria 5942
20 Ga0070688_100003576 3300005365 Bacteria 8016
21 Ga0070659_100004713 3300005366 Bacteria 9735
22 Ga0070711_100054435 3300005439 Bacteria 2761
23 Ga0070700_100030587 3300005441 Bacteria 3219
24 Ga0070708_100066410 3300005445 Bacteria 3238
25 Ga0070663_100047854 3300005455 Bacteria 3030
26 Ga0070678_100004673 3300005456 Bacteria 7792
27 Ga0070678_100008519 3300005456 Bacteria 6144
28 Ga0070662_100005240 3300005457 Bacteria 8272
29 Ga0070662_100061207 3300005457 Bacteria 2748
30 Ga0070662_100075746 3300005457 Bacteria 2492
31 Ga0070681_10001982 3300005458 Bacteria 18507
32 Ga0068867_100038598 3300005459 Bacteria 3477
33 Ga0070685_10018533 3300005466 Bacteria 3744
34 Ga0070706_100019341 3300005467 Bacteria 6282
35 Ga0070707_100031969 3300005468 Bacteria 5013
36 Ga0070698_100143083 3300005471 Bacteria 2342
37 Ga0070679_100014285 3300005530 Bacteria 7626
38 Ga0070672_100007168 3300005543 Bacteria 7545
39 Ga0070693_100014647 3300005547 Bacteria 4022
40 Ga0070693_100033773 3300005547 Bacteria 2826
41 Ga0068857_100102047 3300005577 Bacteria 2574
42 Ga0068856_100002508 3300005614 Bacteria 18895
43 Ga0070702_100034568 3300005615 Bacteria 2786
44 Ga0070702_100038086 3300005615 Bacteria 2675
45 Ga0068859_100006774 3300005617 Bacteria 11637
46 Ga0068864_100012424 3300005618 Bacteria 7041
47 Ga0068861_100018346 3300005719 Bacteria 4985
48 Ga0068870_10003161 3300005840 Bacteria 6943
49 Ga0068870_10026157 3300005840 Bacteria 2907
50 Ga0068858_100036941 3300005842 Bacteria 4529
51 Ga0068858_100236397 3300005842 Bacteria 1733
52 Ga0068860_100015505 3300005843 Bacteria 7442
53 Ga0068860_100078229 3300005843 Bacteria 3145
54 Ga0068862_100014517 3300005844 Bacteria 6538
55 Ga0068862_100091495 3300005844 Bacteria 2650
56 Ga0081455_10013652 3300005937 Bacteria 8000
57 Ga0081455_10014969 3300005937 Bacteria 7556
58 Ga0081455_10054323 3300005937 Bacteria 3414
59 Ga0081455_10079425 3300005937 Bacteria 2694
60 Ga0075365_10005473 3300006038 Bacteria 6850
61 Ga0070712_100020713 3300006175 Bacteria 4306
62 Ga0075367_10023145 3300006178 Bacteria 3492
63 Ga0075428_100009716 3300006844 Bacteria 10684
64 Ga0075428_100025958 3300006844 Bacteria 6487
65 Ga0075428_100067525 3300006844 Bacteria 3913
66 Ga0075430_100004739 3300006846 Bacteria 11443
67 Ga0075430_100037296 3300006846 Bacteria 4120
68 Ga0075431_100002207 3300006847 Bacteria 18645
69 Ga0075431_100013244 3300006847 Bacteria 8329
70 Ga0075433_10000145 3300006852 Bacteria 37425
71 Ga0075433_10013612 3300006852 Bacteria 6622
72 Ga0075433_10051202 3300006852 Bacteria 3595
73 Ga0075433_10264497 3300006852 Bacteria 1524
74 Ga0075434_100000512 3300006871 Bacteria 29409
75 Ga0075434_100031552 3300006871 Bacteria 5224
76 Ga0075434_100111752 3300006871 Bacteria 2743
77 Ga0075434_100214154 3300006871 Bacteria 1946
78 Ga0075429_100000455 3300006880 Bacteria 30466
79 Ga0075429_100021122 3300006880 Bacteria 5644
80 Ga0075429_100028883 3300006880 Bacteria 4817
81 Ga0097620_100006775 3300006931 Bacteria 11637
82 Ga0075435_100010124 3300007076 Bacteria 6884
83 Ga0075435_100011615 3300007076 Bacteria 6490
84 Ga0075435_100116286 3300007076 Bacteria 2228
85 Ga0111539_10019165 3300009094 Bacteria 8452
86 Ga0111539_10057498 3300009094 Bacteria 4619
87 Ga0111539_10095480 3300009094 Bacteria 3492
88 Ga0105245_10008851 3300009098 Bacteria 8783
89 Ga0105245_10010711 3300009098 Bacteria 7977
90 Ga0105245_10020308 3300009098 Bacteria 5824
91 Ga0105245_10076369 3300009098 Bacteria 3051
92 Ga0105245_10164794 3300009098 Bacteria 2106
93 Ga0114129_10007959 3300009147 Bacteria 15088
94 Ga0114129_10010571 3300009147 Bacteria 13161
95 Ga0114129_10018534 3300009147 Bacteria 9910
96 Ga0114129_10026099 3300009147 Bacteria 8274
97 Ga0114129_10083283 3300009147 Bacteria 4444
98 Ga0114129_10093121 3300009147 Bacteria 4175
99 Ga0114129_10112452 3300009147 Bacteria 3755
100 Ga0114129_10163018 3300009147 Bacteria 3044
101 Ga0105243_10014582 3300009148 Bacteria 5946
102 Ga0105243_10097913 3300009148 Bacteria 2429
103 Ga0105241_10198938 3300009174 Bacteria 1672
104 Ga0105242_10060348 3300009176 Bacteria 3116
105 Ga0105242_10085462 3300009176 Bacteria 2646
106 Ga0105248_10043731 3300009177 Bacteria 5023
107 Ga0105248_10094528 3300009177 Bacteria 3366
108 Ga0105238_10257416 3300009551 Bacteria 1724
109 Ga0105249_10005918 3300009553 Bacteria 10593
110 Ga0105249_10025303 3300009553 Bacteria 5342
111 Ga0157378_10040305 3300013297 Bacteria 4141
112 Ga0157378_10094568 3300013297 Bacteria 2721
113 Ga0157378_10171466 3300013297 Bacteria 2035
114 Ga0163162_10245175 3300013306 Bacteria 1923
115 Ga0157375_10009347 3300013308 Bacteria 8605
116 Ga0157375_10054486 3300013308 Bacteria 3939
117 Ga0157375_10056079 3300013308 Bacteria 3888
118 Ga0157375_10190226 3300013308 Bacteria 2207
119 Ga0157380_10005766 3300014326 Bacteria 8668
120 Ga0157380_10016505 3300014326 Bacteria 5447
121 Ga0157380_10060024 3300014326 Bacteria 3037
122 Ga0157377_10001597 3300014745 Bacteria 9862
123 Ga0157379_10110319 3300014968 Bacteria 2471
124 Ga0157376_10079355 3300014969 Bacteria 2813
125 Ga0163161_10041043 3300017792 Bacteria 3324
126 Ga0163161_10041492 3300017792 Bacteria 3306
127 Ga0207697_10003360 3300025315 Bacteria 7957
128 Ga0207682_10002946 3300025893 Bacteria 7493
129 Ga0207688_10007115 3300025901 Bacteria 6086
130 Ga0207688_10025259 3300025901 Bacteria 3262
131 Ga0207645_10016598 3300025907 Bacteria 4871
132 Ga0207643_10000821 3300025908 Bacteria 18854
133 Ga0207643_10028645 3300025908 Bacteria 3094
134 Ga0207705_10116996 3300025909 Bacteria 1974
135 Ga0207684_10016802 3300025910 Bacteria 6282
136 Ga0207684_10141159 3300025910 Bacteria 2071
137 Ga0207707_10006727 3300025912 Bacteria 10037
138 Ga0207693_10060514 3300025915 Bacteria 2967
139 Ga0207663_10049810 3300025916 Bacteria 2600
140 Ga0207660_10015843 3300025917 Bacteria 4982
141 Ga0207662_10060206 3300025918 Bacteria 2277
142 Ga0207657_10149519 3300025919 Bacteria 1903
143 Ga0207652_10002985 3300025921 Bacteria 14133
144 Ga0207646_10057194 3300025922 Bacteria 3484
145 Ga0207681_10004255 3300025923 Bacteria 8836
146 Ga0207694_10178585 3300025924 Bacteria 1721
147 Ga0207650_10045496 3300025925 Bacteria 3229
148 Ga0207659_10004202 3300025926 Bacteria 8698
149 Ga0207687_10007466 3300025927 Bacteria 7196
150 Ga0207687_10013450 3300025927 Bacteria 5343
151 Ga0207687_10023600 3300025927 Bacteria 4102
152 Ga0207706_10015538 3300025933 Bacteria 6877
153 Ga0207706_10017173 3300025933 Bacteria 6525
154 Ga0207706_10024715 3300025933 Bacteria 5384
155 Ga0207686_10045781 3300025934 Bacteria 2694
156 Ga0207669_10001293 3300025937 Bacteria 10625
157 Ga0207669_10004123 3300025937 Bacteria 6368
158 Ga0207704_10055894 3300025938 Bacteria 2414
159 Ga0207691_10011440 3300025940 Bacteria 8515
160 Ga0207691_10042689 3300025940 Bacteria 4179
161 Ga0207691_10059221 3300025940 Bacteria 3483
162 Ga0207689_10008934 3300025942 Bacteria 8687
163 Ga0207689_10061720 3300025942 Bacteria 3083
164 Ga0207661_10000856 3300025944 Bacteria 19971
165 Ga0207679_10031975 3300025945 Bacteria 3689
166 Ga0207651_10004656 3300025960 Bacteria 6951
167 Ga0207712_10004101 3300025961 Bacteria 9195
168 Ga0207668_10143092 3300025972 Bacteria 1842
169 Ga0207677_10062495 3300026023 Bacteria 2583
170 Ga0207703_10018372 3300026035 Bacteria 5459
171 Ga0207708_10029905 3300026075 Bacteria 4130
172 Ga0207708_10034780 3300026075 Bacteria 3833
173 Ga0207702_10081611 3300026078 Bacteria 2808
174 Ga0207702_10104624 3300026078 Unclassified 2505
175 Ga0207674_10014572 3300026116 Bacteria 8677
176 Ga0207674_10089522 3300026116 Bacteria 3070
177 Ga0207675_100049866 3300026118 Bacteria 3906
178 Ga0207675_100088193 3300026118 Bacteria 2914
179 Ga0207683_10000142 3300026121 Bacteria 59460
180 Ga0207683_10004299 3300026121 Bacteria 12302
181 Ga0207683_10065461 3300026121 Bacteria 3205
182 Ga0207683_10100915 3300026121 Bacteria 2577
183 Ga0207428_10022418 3300027907 Bacteria 5330
184 Ga0207428_10111405 3300027907 Bacteria 2106
185 Ga0268265_10006487 3300028380 Bacteria 7930
186 Ga0268264_10009563 3300028381 Bacteria 8027
187 Ga0268264_10145251 3300028381 Bacteria 2120
188 Ga0316182_1255140 3300030745 Bacteria 3070
189 Ga0307407_10020275 3300031903 Bacteria 3403
190 Ga0307409_100010441 3300031995 Bacteria 5777
191 Ga0307409_100128428 3300031995 Bacteria 2161
192 Ga0395899_0002221 3300037312 Bacteria 15917
193 Ga0395899_0006022 3300037312 Bacteria 9415
194 Ga0395900_0013463 3300037418 Bacteria 8357
195 Ga0395900_0015766 3300037418 Bacteria 7704
196 Ga0395900_0016554 3300037418 Bacteria 7522
197 Ga0395900_0027886 3300037418 Bacteria 5784
198 Ga0395900_0029588 3300037418 Bacteria 5619
199 Ga0395900_0031016 3300037418 Bacteria 5491
200 Ga0395900_0043754 3300037418 Bacteria 4615
201 Ga0395898_0015257 3300037466 Bacteria 7884
202 Ga0395898_0016207 3300037466 Bacteria 7632
203 Ga0395898_0020842 3300037466 Bacteria 6654
204 Ga0395898_0043956 3300037466 Bacteria 4400
205 Ga0395898_0049210 3300037466 Bacteria 4130
206 Ga0395898_0055057 3300037466 Bacteria 3880
207 Ga0395898_0067363 3300037466 Bacteria 3466
208 Ga0395898_0084947 3300037466 Bacteria 3051
209 Ga0395905_0012505 3300037471 Bacteria 8170
210 Ga0395905_0034627 3300037471 Bacteria 4743
211 Ga0395905_0036136 3300037471 Bacteria 4639
212 Ga0395905_0037440 3300037471 Bacteria 4554
213 Ga0395905_0050207 3300037471 Bacteria 3909
214 Ga0395905_0066397 3300037471 Bacteria 3379
215 Ga0395905_0097170 3300037471 Bacteria 2765
216 Ga0395905_0191498 3300037471 Bacteria 1918
217 Ga0395901_0034848 3300038443 Bacteria 5199
218 Ga0395901_0042294 3300038443 Bacteria 4723
219 Ga0395901_0058405 3300038443 Bacteria 4012
220 Ga0395901_0074643 3300038443 Bacteria 3537
221 Ga0395901_0092460 3300038443 Bacteria 3167
222 Ga0395901_0202504 3300038443 Unclassified 2080
223 Ga0451853_0379822 3300041512 Bacteria 4618
224 Ga0451853_0765816 3300041512 Bacteria 3391
225 Ga0450920_006316 3300042122 Bacteria 2130
226 Ga0439464_0016189 3300042439 Bacteria 2015
227 Ga0495592_0078749 3300046454 Bacteria 2387
228 Ga0495603_0076818 3300046455 Bacteria 1960
229 Ga0495629_0106936 3300046459 Bacteria 1952
230 Ga0495629_0132863 3300046459 Bacteria 1734
231 Ga0495641_0022568 3300046461 Bacteria 3145
232 Ga0495630_0035460 3300046517 Bacteria 3728
233 Ga0495640_0071180 3300046533 Bacteria 2334
234 Ga0495656_0035067 3300046615 Bacteria 2059
235 Ga0495634_0030626 3300046642 Bacteria 3715
236 Ga0495658_0045576 3300046683 Bacteria 2461
237 Ga0495600_0063839 3300046809 Bacteria 2407
238 Ga0495674_0031558 3300047319 Bacteria 4813
239 Ga0495674_0057159 3300047319 Bacteria 3415
240 Ga0495680_0007921 3300047322 Bacteria 9690
241 Ga0495680_0131187 3300047322 Bacteria 1841
242 Ga0495684_0069965 3300047471 Bacteria 2668
243 Ga0496100_0032920 3300048903 Bacteria 3238
244 Ga0496100_0034349 3300048903 Bacteria 3181
245 Ga0496101_0000543 3300048904 Bacteria 23139
246 Ga0496101_0005919 3300048904 Bacteria 7832
247 Ga0496101_0048086 3300048904 Bacteria 3064
248 Ga0496102_0001980 3300048905 Bacteria 17696
249 Ga0496102_0016132 3300048905 Bacteria 6524
250 Ga0496102_0102424 3300048905 Bacteria 2661
251 Ga0496102_0117208 3300048905 Bacteria 2485
252 Ga0496103_0009850 3300048906 Bacteria 5658
253 Ga0496103_0079394 3300048906 Bacteria 2062
254 Ga0496104_0001097 3300048907 Bacteria 23145
255 Ga0496104_0001813 3300048907 Bacteria 18528
256 Ga0496104_0004152 3300048907 Bacteria 12575
257 Ga0496105_0001360 3300048908 Bacteria 17182
258 Ga0496105_0016806 3300048908 Bacteria 5850
259 Ga0496105_0017790 3300048908 Bacteria 5701
260 Ga0496105_0085356 3300048908 Bacteria 2608
261 Ga0496105_0117539 3300048908 Bacteria 2193
262 Ga0496106_0018812 3300048909 Bacteria 5117
263 Ga0496106_0076573 3300048909 Bacteria 2564
264 Ga0496107_0004076 3300048910 Bacteria 9839
265 Ga0496107_0025509 3300048910 Bacteria 4185
266 Ga0496107_0035423 3300048910 Bacteria 3578
267 Ga0496107_0058412 3300048910 Bacteria 2789
268 Ga0496107_0082462 3300048910 Unclassified 2345
269 Ga0496107_0085508 3300048910 Bacteria 2301
270 Ga0496108_0003834 3300048911 Bacteria 12057
271 Ga0496108_0006639 3300048911 Bacteria 9376
272 Ga0496109_0001660 3300048912 Bacteria 18557
273 Ga0496109_0009699 3300048912 Bacteria 8218
274 Ga0496109_0010543 3300048912 Bacteria 7901
275 Ga0496109_0013291 3300048912 Bacteria 7132
276 Ga0496109_0022955 3300048912 Bacteria 5531
277 Ga0496109_0072458 3300048912 Bacteria 3165
278 Ga0496109_0092185 3300048912 Bacteria 2802
279 Ga0496109_0104488 3300048912 Bacteria 2630
280 Ga0496109_0243337 3300048912 Bacteria 1693
281 Ga0496110_0000147 3300048913 Bacteria 41765
282 Ga0496110_0019649 3300048913 Bacteria 5690
283 Ga0496110_0024580 3300048913 Bacteria 5136
284 Ga0496110_0048735 3300048913 Bacteria 3714
285 Ga0496110_0061859 3300048913 Bacteria 3305
286 Ga0496110_0064139 3300048913 Bacteria 3246
287 Ga0496110_0124627 3300048913 Bacteria 2324
288 Ga0496111_0000221 3300048914 Bacteria 27214
289 Ga0496111_0031082 3300048914 Bacteria 3801
290 Ga0496111_0049512 3300048914 Bacteria 3030
291 Ga0496111_0057649 3300048914 Bacteria 2812
292 Ga0496113_0003582 3300048916 Bacteria 9322
293 Ga0496113_0009864 3300048916 Bacteria 6289
294 Ga0496113_0021616 3300048916 Bacteria 4541
295 Ga0496113_0092171 3300048916 Bacteria 2337
296 Ga0496114_0000834 3300048917 Bacteria 23084
297 Ga0496114_0001655 3300048917 Bacteria 16906
298 Ga0496114_0001826 3300048917 Bacteria 16140
299 Ga0496114_0017300 3300048917 Bacteria 5817
300 Ga0496115_0001370 3300048918 Bacteria 17409
301 Ga0496115_0015383 3300048918 Bacteria 5803
302 Ga0501031_0012137 3300049568 Bacteria 5617
303 Ga0501031_0015562 3300049568 Bacteria 4938
304 Ga0501031_0086727 3300049568 Bacteria 2041
305 Ga0501032_0031022 3300049569 Bacteria 3666
306 Ga0501033_0013352 3300049570 Bacteria 6259
307 Ga0501034_0030929 3300049571 Bacteria 5441
308 Ga0501034_0196894 3300049571 Bacteria 1974
309 Ga0501036_0009988 3300049572 Bacteria 7818
310 Ga0501036_0010078 3300049572 Bacteria 7787
311 Ga0501036_0020701 3300049572 Bacteria 5526
312 Ga0501038_0022466 3300049574 Bacteria 5652
313 Ga0501038_0095395 3300049574 Bacteria 2485
314 Ga0501039_0007901 3300049575 Bacteria 8106
315 Ga0501039_0008447 3300049575 Bacteria 7848
316 Ga0501039_0041438 3300049575 Bacteria 3557
317 Ga0501039_0052144 3300049575 Bacteria 3165
318 Ga0501039_0061557 3300049575 Bacteria 2907
319 Ga0501040_0001329 3300049576 Bacteria 15629
320 Ga0501040_0002104 3300049576 Bacteria 12819
321 Ga0501040_0065640 3300049576 Bacteria 2500
322 Ga0501041_0004693 3300049577 Bacteria 7932
323 Ga0501041_0014066 3300049577 Bacteria 4748
324 Ga0501041_0023887 3300049577 Bacteria 3667
325 Ga0501041_0026406 3300049577 Bacteria 3494
326 Ga0501041_0083878 3300049577 Bacteria 1964
327 Ga0501042_0005728 3300049578 Bacteria 8024
328 Ga0501042_0014801 3300049578 Bacteria 5327
329 Ga0501042_0052799 3300049578 Bacteria 2900
330 Ga0501042_0143867 3300049578 Bacteria 1719
331 Ga0501046_0000989 3300049580 Bacteria 27797
332 Ga0501046_0094405 3300049580 Bacteria 2299
333 Ga0501048_0000199 3300049582 Bacteria 39152
334 Ga0501048_0029753 3300049582 Bacteria 3957
335 Ga0501048_0041208 3300049582 Bacteria 3308
336 Ga0501048_0049090 3300049582 Bacteria 3009
337 Ga0501048_0058547 3300049582 Bacteria 2731
338 Ga0501068_0075232 3300049584 Bacteria 2066
339 Ga0501069_0090590 3300049585 Bacteria 1729
340 Ga0501070_0019414 3300049586 Bacteria 5699
341 Ga0501071_0010608 3300049587 Bacteria 6179
342 Ga0501071_0035636 3300049587 Bacteria 3545
343 Ga0501071_0041663 3300049587 Bacteria 3288
344 Ga0501071_0114334 3300049587 Bacteria 1996
345 Ga0501072_0004400 3300049588 Bacteria 10696
346 Ga0501072_0005293 3300049588 Bacteria 9825
347 Ga0501072_0007934 3300049588 Bacteria 8060
348 Ga0501072_0018084 3300049588 Bacteria 5421
349 Ga0501072_0023920 3300049588 Bacteria 4748
350 Ga0501072_0059285 3300049588 Bacteria 3018
351 Ga0501072_0066163 3300049588 Bacteria 2851
352 Ga0501072_0084919 3300049588 Bacteria 2510
353 Ga0501072_0090920 3300049588 Bacteria 2423
354 Ga0501074_0016225 3300049590 Bacteria 5410
355 Ga0501074_0023837 3300049590 Bacteria 4449
356 Ga0501074_0141491 3300049590 Bacteria 1721
357 Ga0501075_0003349 3300049591 Bacteria 10708
358 Ga0501075_0007370 3300049591 Bacteria 7632
359 Ga0501075_0007466 3300049591 Bacteria 7582
360 Ga0501076_0003621 3300049592 Bacteria 10848
361 Ga0501076_0005817 3300049592 Bacteria 8894
362 Ga0501076_0010473 3300049592 Bacteria 6882
363 Ga0501076_0012495 3300049592 Bacteria 6350
364 Ga0501076_0016292 3300049592 Bacteria 5634
365 Ga0501076_0023105 3300049592 Bacteria 4788
366 Ga0501076_0024350 3300049592 Bacteria 4678
367 Ga0501076_0073542 3300049592 Bacteria 2737
368 Ga0501077_0001746 3300049593 Bacteria 13096
369 Ga0501077_0110273 3300049593 Bacteria 1743
370 Ga0501079_0000553 3300049741 Bacteria 24477
371 Ga0501079_0001321 3300049741 Bacteria 17431
372 Ga0501079_0026600 3300049741 Bacteria 4435
373 Ga0501079_0038456 3300049741 Bacteria 3690
374 Ga0501079_0061882 3300049741 Bacteria 2887
375 Ga0501080_0008789 3300049742 Bacteria 9179
376 Ga0501080_0039785 3300049742 Bacteria 4387
377 Ga0501080_0100408 3300049742 Bacteria 2685
378 Ga0501081_0009075 3300049743 Bacteria 6468
379 Ga0501081_0011953 3300049743 Bacteria 5688
380 Ga0501081_0023965 3300049743 Bacteria 4094
381 Ga0501081_0059049 3300049743 Bacteria 2655
382 Ga0501083_0081049 3300049744 Bacteria 2152
383 Ga0501035_0014865 3300049822 Bacteria 7185
384 Ga0501045_0008303 3300049824 Bacteria 7230
385 Ga0501045_0010757 3300049824 Bacteria 6413
386 Ga0501045_0017445 3300049824 Bacteria 5097
387 nmdc:mga0yw44_19917_c1 3300050492 Bacteria 3711
388 nmdc:mga06z11_68774_c1 3300050494 Bacteria 1867
389 nmdc:mga05p37_27528_c1 3300050507 Bacteria 6921
390 nmdc:mga05p37_27833_c1 3300050507 Bacteria 6885
391 nmdc:mga05p37_288084_c1 3300050507 Bacteria 1955
392 nmdc:mga05p37_86387_c1 3300050507 Bacteria 3866
393 nmdc:mga05p37_939_c1 3300050507 Bacteria 32816
394 nmdc:mga05p37_94833_c1 3300050507 Bacteria 3676
395 nmdc:mga09592_124124_c1 3300050508 Bacteria 2219
396 nmdc:mga0qj67_28378_c1 3300050509 Bacteria 4344
397 nmdc:mga0qj67_62033_c1 3300050509 Bacteria 2970
398 nmdc:mga08y16_41761_c1 3300050511 Bacteria 4804
399 nmdc:mga08y16_43339_c1 3300050511 Bacteria 4716
400 nmdc:mga08y16_44518_c1 3300050511 Bacteria 4650
401 nmdc:mga0n895_13682_c1 3300050512 Bacteria 7336
402 nmdc:mga0n895_26202_c1 3300050512 Bacteria 5517
403 nmdc:mga0n895_7263_c1 3300050512 Bacteria 9490
404 nmdc:mga0n895_919_c1 3300050512 Bacteria 21216
405 nmdc:mga0rr50_111124_c1 3300050513 Bacteria 2169
406 nmdc:mga0rr50_13517_c1 3300050513 Bacteria 5318
407 nmdc:mga0rr50_4094_c1 3300050513 Bacteria 8514
408 nmdc:mga0a205_16489_c1 3300050515 Bacteria 6918
409 nmdc:mga0a205_1706_c1 3300050515 Bacteria 18964
410 nmdc:mga0a205_55723_c1 3300050515 Bacteria 3818
411 nmdc:mga0a205_9221_c1 3300050515 Bacteria 9009
412 nmdc:mga0a205_955_c1 3300050515 Bacteria 17193
413 Ga0495601_0058969 3300053077 Bacteria 2433
414 Ga0500593_000604 3300053117 Bacteria 13821
415 Ga0501084_0013473 3300054114 Bacteria 6767
416 Ga0501084_0014139 3300054114 Bacteria 6609
417 Ga0501084_0041321 3300054114 Bacteria 3858
418 Ga0501084_0144844 3300054114 Bacteria 2001
419 Ga0501084_0148752 3300054114 Bacteria 1973
420 Ga0501082_0002980 3300060353 Bacteria 14791
421 Ga0501082_0016014 3300060353 Bacteria 6450
422 Ga0501082_0025062 3300060353 Bacteria 5139
423 Ga0501082_0032797 3300060353 Bacteria 4480
424 Ga0530510_0000620 3300061734 Bacteria 22868
425 Ga0530510_0000747 3300061734 Bacteria 21084
426 Ga0496114_0133360
427 Ga0058859_10028464
428 Ga0070658_10158514
429 Ga0070683_100027878
430 Ga0070690_100005045
431 Ga0070670_100027803
432 Ga0068869_100004531
433 Ga0068869_100025717
434 Ga0070680_100008816
435 Ga0070682_100015963
436 Ga0068868_100030444
437 Ga0070660_100052345
438 Ga0070689_100005548
439 Ga0070668_100038427
440 Ga0070669_100004470
441 Ga0070675_100002887
442 Ga0070675_100007055
443 Ga0070674_100009211
444 Ga0070673_100011963
445 Ga0070688_100003576
446 Ga0070659_100004713
447 Ga0070711_100054435
448 Ga0070700_100030587
449 Ga0070708_100066410
450 Ga0070663_100047854
451 Ga0070678_100004673
452 Ga0070678_100008519
453 Ga0070662_100005240
454 Ga0070662_100061207
455 Ga0070662_100075746
456 Ga0070681_10001982
457 Ga0068867_100038598
458 Ga0070685_10018533
459 Ga0070706_100019341
460 Ga0070707_100031969
461 Ga0070698_100143083
462 Ga0070679_100014285
463 Ga0070672_100007168
464 Ga0070693_100014647
465 Ga0070693_100033773
466 Ga0068857_100102047
467 Ga0068856_100002508
468 Ga0070702_100034568
469 Ga0070702_100038086
470 Ga0068859_100006774
471 Ga0068864_100012424
472 Ga0068861_100018346
473 Ga0068870_10003161
474 Ga0068870_10026157
475 Ga0068858_100036941
476 Ga0068858_100236397
477 Ga0068860_100015505
478 Ga0068860_100078229
479 Ga0068862_100014517
480 Ga0068862_100091495
481 Ga0081455_10013652
482 Ga0081455_10014969
483 Ga0081455_10054323
484 Ga0081455_10079425
485 Ga0075365_10005473
486 Ga0070712_100020713
487 Ga0075367_10023145
488 Ga0075428_100009716
489 Ga0075428_100025958
490 Ga0075428_100067525
491 Ga0075430_100004739
492 Ga0075430_100037296
493 Ga0075431_100002207
494 Ga0075431_100013244
495 Ga0075433_10000145
496 Ga0075433_10013612
497 Ga0075433_10051202
498 Ga0075433_10264497
499 Ga0075434_100000512
500 Ga0075434_100031552
501 Ga0075434_100111752
502 Ga0075434_100214154
503 Ga0075429_100000455
504 Ga0075429_100021122
505 Ga0075429_100028883
506 Ga0097620_100006775
507 Ga0075435_100010124
508 Ga0075435_100011615
509 Ga0075435_100116286
510 Ga0111539_10019165
511 Ga0111539_10057498
512 Ga0111539_10095480
513 Ga0105245_10008851
514 Ga0105245_10010711
515 Ga0105245_10020308
516 Ga0105245_10076369
517 Ga0105245_10164794
518 Ga0114129_10007959
519 Ga0114129_10010571
520 Ga0114129_10018534
521 Ga0114129_10026099
522 Ga0114129_10083283
523 Ga0114129_10093121
524 Ga0114129_10112452
525 Ga0114129_10163018
526 Ga0105243_10014582
527 Ga0105243_10097913
528 Ga0105241_10198938
529 Ga0105242_10060348
530 Ga0105242_10085462
531 Ga0105248_10043731
532 Ga0105248_10094528
533 Ga0105238_10257416
534 Ga0105249_10005918
535 Ga0105249_10025303
536 Ga0157378_10040305
537 Ga0157378_10094568
538 Ga0157378_10171466
539 Ga0163162_10245175
540 Ga0157375_10009347
541 Ga0157375_10054486
542 Ga0157375_10056079
543 Ga0157375_10190226
544 Ga0157380_10005766
545 Ga0157380_10016505
546 Ga0157380_10060024
547 Ga0157377_10001597
548 Ga0157379_10110319
549 Ga0157376_10079355
550 Ga0163161_10041043
551 Ga0163161_10041492
552 Ga0207697_10003360
553 Ga0207682_10002946
554 Ga0207688_10007115
555 Ga0207688_10025259
556 Ga0207645_10016598
557 Ga0207643_10000821
558 Ga0207643_10028645
559 Ga0207705_10116996
560 Ga0207684_10016802
561 Ga0207684_10141159
562 Ga0207707_10006727
563 Ga0207693_10060514
564 Ga0207663_10049810
565 Ga0207660_10015843
566 Ga0207662_10060206
567 Ga0207657_10149519
568 Ga0207652_10002985
569 Ga0207646_10057194
570 Ga0207681_10004255
571 Ga0207694_10178585
572 Ga0207650_10045496
573 Ga0207659_10004202
574 Ga0207687_10007466
575 Ga0207687_10013450
576 Ga0207687_10023600
577 Ga0207706_10015538
578 Ga0207706_10017173
579 Ga0207706_10024715
580 Ga0207686_10045781
581 Ga0207669_10001293
582 Ga0207669_10004123
583 Ga0207704_10055894
584 Ga0207691_10011440
585 Ga0207691_10042689
586 Ga0207691_10059221
587 Ga0207689_10008934
588 Ga0207689_10061720
589 Ga0207661_10000856
590 Ga0207679_10031975
591 Ga0207651_10004656
592 Ga0207712_10004101
593 Ga0207668_10143092
594 Ga0207677_10062495
595 Ga0207703_10018372
596 Ga0207708_10029905
597 Ga0207708_10034780
598 Ga0207702_10081611
599 Ga0207702_10104624
600 Ga0207674_10014572
601 Ga0207674_10089522
602 Ga0207675_100049866
603 Ga0207675_100088193
604 Ga0207683_10000142
605 Ga0207683_10004299
606 Ga0207683_10065461
607 Ga0207683_10100915
608 Ga0207428_10022418
609 Ga0207428_10111405
610 Ga0268265_10006487
611 Ga0268264_10009563
612 Ga0268264_10145251
613 Ga0316182_1255140
614 Ga0307407_10020275
615 Ga0307409_100010441
616 Ga0307409_100128428
617 Ga0395899_0002221
618 Ga0395899_0006022
619 Ga0395900_0013463
620 Ga0395900_0015766
621 Ga0395900_0016554
622 Ga0395900_0027886
623 Ga0395900_0029588
624 Ga0395900_0031016
625 Ga0395900_0043754
626 Ga0395898_0015257
627 Ga0395898_0016207
628 Ga0395898_0020842
629 Ga0395898_0043956
630 Ga0395898_0049210
631 Ga0395898_0055057
632 Ga0395898_0067363
633 Ga0395898_0084947
634 Ga0395905_0012505
635 Ga0395905_0034627
636 Ga0395905_0036136
637 Ga0395905_0037440
638 Ga0395905_0050207
639 Ga0395905_0066397
640 Ga0395905_0097170
641 Ga0395905_0191498
642 Ga0395901_0034848
643 Ga0395901_0042294
644 Ga0395901_0058405
645 Ga0395901_0074643
646 Ga0395901_0092460
647 Ga0395901_0202504
648 Ga0451853_0379822
649 Ga0451853_0765816
650 Ga0450920_006316
651 Ga0439464_0016189
652 Ga0495592_0078749
653 Ga0495603_0076818
654 Ga0495629_0106936
655 Ga0495629_0132863
656 Ga0495641_0022568
657 Ga0495630_0035460
658 Ga0495640_0071180
659 Ga0495656_0035067
660 Ga0495634_0030626
661 Ga0495658_0045576
662 Ga0495600_0063839
663 Ga0495674_0031558
664 Ga0495674_0057159
665 Ga0495680_0007921
666 Ga0495680_0131187
667 Ga0495684_0069965
668 Ga0496100_0032920
669 Ga0496100_0034349
670 Ga0496101_0000543
671 Ga0496101_0005919
672 Ga0496101_0048086
673 Ga0496102_0001980
674 Ga0496102_0016132
675 Ga0496102_0102424
676 Ga0496102_0117208
677 Ga0496103_0009850
678 Ga0496103_0079394
679 Ga0496104_0001097
680 Ga0496104_0001813
681 Ga0496104_0004152
682 Ga0496105_0001360
683 Ga0496105_0016806
684 Ga0496105_0017790
685 Ga0496105_0085356
686 Ga0496105_0117539
687 Ga0496106_0018812
688 Ga0496106_0076573
689 Ga0496107_0004076
690 Ga0496107_0025509
691 Ga0496107_0035423
692 Ga0496107_0058412
693 Ga0496107_0082462
694 Ga0496107_0085508
695 Ga0496108_0003834
696 Ga0496108_0006639
697 Ga0496109_0001660
698 Ga0496109_0009699
699 Ga0496109_0010543
700 Ga0496109_0013291
701 Ga0496109_0022955
702 Ga0496109_0072458
703 Ga0496109_0092185
704 Ga0496109_0104488
705 Ga0496109_0243337
706 Ga0496110_0000147
707 Ga0496110_0019649
708 Ga0496110_0024580
709 Ga0496110_0048735
710 Ga0496110_0061859
711 Ga0496110_0064139
712 Ga0496110_0124627
713 Ga0496111_0000221
714 Ga0496111_0031082
715 Ga0496111_0049512
716 Ga0496111_0057649
717 Ga0496113_0003582
718 Ga0496113_0009864
719 Ga0496113_0021616
720 Ga0496113_0092171
721 Ga0496114_0000834
722 Ga0496114_0001655
723 Ga0496114_0001826
724 Ga0496114_0017300
725 Ga0496115_0001370
726 Ga0496115_0015383
727 Ga0501031_0012137
728 Ga0501031_0015562
729 Ga0501031_0086727
730 Ga0501032_0031022
731 Ga0501033_0013352
732 Ga0501034_0030929
733 Ga0501034_0196894
734 Ga0501036_0009988
735 Ga0501036_0010078
736 Ga0501036_0020701
737 Ga0501038_0022466
738 Ga0501038_0095395
739 Ga0501039_0007901
740 Ga0501039_0008447
741 Ga0501039_0041438
742 Ga0501039_0052144
743 Ga0501039_0061557
744 Ga0501040_0001329
745 Ga0501040_0002104
746 Ga0501040_0065640
747 Ga0501041_0004693
748 Ga0501041_0014066
749 Ga0501041_0023887
750 Ga0501041_0026406
751 Ga0501041_0083878
752 Ga0501042_0005728
753 Ga0501042_0014801
754 Ga0501042_0052799
755 Ga0501042_0143867
756 Ga0501046_0000989
757 Ga0501046_0094405
758 Ga0501048_0000199
759 Ga0501048_0029753
760 Ga0501048_0041208
761 Ga0501048_0049090
762 Ga0501048_0058547
763 Ga0501068_0075232
764 Ga0501069_0090590
765 Ga0501070_0019414
766 Ga0501071_0010608
767 Ga0501071_0035636
768 Ga0501071_0041663
769 Ga0501071_0114334
770 Ga0501072_0004400
771 Ga0501072_0005293
772 Ga0501072_0007934
773 Ga0501072_0018084
774 Ga0501072_0023920
775 Ga0501072_0059285
776 Ga0501072_0066163
777 Ga0501072_0084919
778 Ga0501072_0090920
779 Ga0501074_0016225
780 Ga0501074_0023837
781 Ga0501074_0141491
782 Ga0501075_0003349
783 Ga0501075_0007370
784 Ga0501075_0007466
785 Ga0501076_0003621
786 Ga0501076_0005817
787 Ga0501076_0010473
788 Ga0501076_0012495
789 Ga0501076_0016292
790 Ga0501076_0023105
791 Ga0501076_0024350
792 Ga0501076_0073542
793 Ga0501077_0001746
794 Ga0501077_0110273
795 Ga0501079_0000553
796 Ga0501079_0001321
797 Ga0501079_0026600
798 Ga0501079_0038456
799 Ga0501079_0061882
800 Ga0501080_0008789
801 Ga0501080_0039785
802 Ga0501080_0100408
803 Ga0501081_0009075
804 Ga0501081_0011953
805 Ga0501081_0023965
806 Ga0501081_0059049
807 Ga0501083_0081049
808 Ga0501035_0014865
809 Ga0501045_0008303
810 Ga0501045_0010757
811 Ga0501045_0017445
812 nmdc:mga0yw44_19917_c1
813 nmdc:mga06z11_68774_c1
814 nmdc:mga05p37_27528_c1
815 nmdc:mga05p37_27833_c1
816 nmdc:mga05p37_288084_c1
817 nmdc:mga05p37_86387_c1
818 nmdc:mga05p37_939_c1
819 nmdc:mga05p37_94833_c1
820 nmdc:mga09592_124124_c1
821 nmdc:mga0qj67_28378_c1
822 nmdc:mga0qj67_62033_c1
823 nmdc:mga08y16_41761_c1
824 nmdc:mga08y16_43339_c1
825 nmdc:mga08y16_44518_c1
826 nmdc:mga0n895_13682_c1
827 nmdc:mga0n895_26202_c1
828 nmdc:mga0n895_7263_c1
829 nmdc:mga0n895_919_c1
830 nmdc:mga0rr50_111124_c1
831 nmdc:mga0rr50_13517_c1
832 nmdc:mga0rr50_4094_c1
833 nmdc:mga0a205_16489_c1
834 nmdc:mga0a205_1706_c1
835 nmdc:mga0a205_55723_c1
836 nmdc:mga0a205_9221_c1
837 nmdc:mga0a205_955_c1
838 Ga0495601_0058969
839 Ga0500593_000604
840 Ga0501084_0013473
841 Ga0501084_0014139
842 Ga0501084_0041321
843 Ga0501084_0144844
844 Ga0501084_0148752
845 Ga0501082_0002980
846 Ga0501082_0016014
847 Ga0501082_0025062
848 Ga0501082_0032797
849 Ga0530510_0000620
850 Ga0530510_0000747

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03606

DcuC

C4-dicarboxylate anaerobic carrier

77

536

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wu1-assembly1.cif.gz_A structure of apo laindy 0.5921 11 486
6wu1-assembly1.cif.gz_A structure of apo laindy 0.575 11 486
4r0c-assembly1.cif.gz_B crystal structure of the alcanivorax borkumensis ydah transporter reveals an unusual topology 0.5681 16 495
4r0c-assembly1.cif.gz_B crystal structure of the alcanivorax borkumensis ydah transporter reveals an unusual topology 0.5634 16 495
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.5416 100 489
ID Description Score Start End Superfamily
af_Q57727_14_160_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.3682 154 243 1.10.357.140
af_A0A0P0YBY4_33_209_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3432 97 244 1.20.1250.20
af_A0A0P0YBY4_33_209_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2967 97 244 1.20.1250.20
af_Q5AAP8_56_244_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2761 96 247 1.20.1250.20
af_O05301_232_420_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2733 354 491 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2H9T5L3-F1-model_v4 Arginine/ornithine antiporter ArcD 0.9507 15 491 GO:0005886
AF-A0A2H9T5L3-F1-model_v4 Arginine/ornithine antiporter ArcD 0.942 15 491 GO:0005886
AF-A0A3M1X751-F1-model_v4 YfcC family protein 0.9291 96 493 GO:0005886
AF-A0A1Y4C4B1-F1-model_v4 YfcC family protein 0.9239 6 494 GO:0005886
AF-A0A0B8QDD6-F1-model_v4 Arginine/ornithine antiporter arcD 0.9231 154 419 GO:0005886

Map