F440908

General Info

Members Datasets Scaffolds Average Seq Length
425 239 848 77

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100670494|Ga0070683_1006704941
Length 87
Sequence MAIKLNLDRVMLERRISLTDLAEKVGITLANLSILKTNKARAIRFTTLDALCRELQCQPGELLEFVAQDAREEVQAEQVSSAPEGRS

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
176 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
179 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
182 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
183 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
184 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
185 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
186 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
187 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
188 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
189 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
190 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 0.94
Rhizosphere 98.35
Stem 0
Stem Tuber 0
Unclassified 9.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100670494 3300005329 Bacteria 993
2 Ga0065715_10805110 3300005293 Bacteria 608
3 Ga0065707_10442474 3300005295 Bacteria 806
4 Ga0065707_10869266 3300005295 Bacteria 576
5 Ga0070658_10114041 3300005327 Bacteria 2241
6 Ga0070676_10023538 3300005328 Bacteria 3462
7 Ga0070676_11521100 3300005328 Unclassified 516
8 Ga0070680_100875598 3300005336 Bacteria 774
9 Ga0070680_100912955 3300005336 Bacteria 758
10 Ga0068868_100904554 3300005338 Unclassified 802
11 Ga0070660_100187617 3300005339 Unclassified 1674
12 Ga0070660_100204534 3300005339 Bacteria 1602
13 Ga0070691_10001156 3300005341 Bacteria 10999
14 Ga0070691_10157918 3300005341 Bacteria 1167
15 Ga0070668_100029505 3300005347 Bacteria 4167
16 Ga0070668_102250125 3300005347 Bacteria 504
17 Ga0070669_100176552 3300005353 Bacteria 1669
18 Ga0070669_100176736 3300005353 Bacteria 1668
19 Ga0070669_100565273 3300005353 Bacteria 950
20 Ga0070675_100067423 3300005354 Bacteria 2961
21 Ga0070674_100069755 3300005356 Bacteria 2480
22 Ga0070673_102040370 3300005364 Bacteria 544
23 Ga0070688_100873118 3300005365 Bacteria 708
24 Ga0070659_100100362 3300005366 Bacteria 2329
25 Ga0070709_10000184 3300005434 Bacteria 39762
26 Ga0070709_10073149 3300005434 Bacteria 2218
27 Ga0070714_100020356 3300005435 Bacteria 5417
28 Ga0070713_100000001 3300005436 Bacteria 257984
29 Ga0070713_100077226 3300005436 Bacteria 2831
30 Ga0070701_10591134 3300005438 Bacteria 734
31 Ga0070700_100347186 3300005441 Unclassified 1099
32 Ga0070694_100381687 3300005444 Bacteria 1099
33 Ga0070708_100617234 3300005445 Bacteria 1022
34 Ga0070678_100551693 3300005456 Bacteria 1023
35 Ga0070681_10018800 3300005458 Bacteria 6915
36 Ga0070681_10042791 3300005458 Bacteria 4538
37 Ga0070681_10419399 3300005458 Bacteria 1250
38 Ga0068867_100062517 3300005459 Bacteria 2766
39 Ga0068867_102252934 3300005459 Bacteria 517
40 Ga0070706_100993442 3300005467 Bacteria 774
41 Ga0070679_100032184 3300005530 Bacteria 5185
42 Ga0070679_100047438 3300005530 Bacteria 4282
43 Ga0070679_101237510 3300005530 Unclassified 692
44 Ga0070684_101188730 3300005535 Bacteria 717
45 Ga0070684_101315333 3300005535 Bacteria 680
46 Ga0068853_100022645 3300005539 Bacteria 5250
47 Ga0070672_100234078 3300005543 Bacteria 1544
48 Ga0070672_100555593 3300005543 Bacteria 997
49 Ga0070695_100006278 3300005545 Bacteria 7020
50 Ga0070696_101029055 3300005546 Bacteria 689
51 Ga0070696_101332276 3300005546 Bacteria 610
52 Ga0070693_100039396 3300005547 Bacteria 2647
53 Ga0070665_101706336 3300005548 Unclassified 637
54 Ga0070704_100681394 3300005549 Bacteria 910
55 Ga0070704_101406328 3300005549 Bacteria 640
56 Ga0068855_100014497 3300005563 Bacteria 9493
57 Ga0068855_100030199 3300005563 Bacteria 6483
58 Ga0068855_100531413 3300005563 Unclassified 1275
59 Ga0068855_102273942 3300005563 Bacteria 543
60 Ga0070664_100193204 3300005564 Bacteria 1814
61 Ga0070664_100396302 3300005564 Bacteria 1262
62 Ga0068857_100000821 3300005577 Bacteria 23249
63 Ga0068857_101439659 3300005577 Bacteria 671
64 Ga0068854_100029197 3300005578 Bacteria 3816
65 Ga0068856_100000182 3300005614 Bacteria 65421
66 Ga0068856_100003034 3300005614 Bacteria 17203
67 Ga0068852_100000764 3300005616 Bacteria 21174
68 Ga0068864_100436621 3300005618 Bacteria 1250
69 Ga0068864_102664886 3300005618 Bacteria 506
70 Ga0068861_100763014 3300005719 Bacteria 904
71 Ga0068870_11444876 3300005840 Bacteria 505
72 Ga0068863_100385075 3300005841 Bacteria 1370
73 Ga0068863_102355949 3300005841 Bacteria 542
74 Ga0068858_101545252 3300005842 Unclassified 655
75 Ga0068860_100236038 3300005843 Bacteria 1778
76 Ga0068860_100845392 3300005843 Bacteria 930
77 Ga0068862_100113306 3300005844 Bacteria 2382
78 Ga0081538_10011477 3300005981 Bacteria 7173
79 Ga0081539_10000164 3300005985 Bacteria 154639
80 Ga0081539_10020919 3300005985 Bacteria 4395
81 Ga0081539_10038911 3300005985 Bacteria 2812
82 Ga0070716_100378666 3300006173 Bacteria 1011
83 Ga0070712_100000026 3300006175 Bacteria 77190
84 Ga0097621_100357152 3300006237 Bacteria 1301
85 Ga0097621_102208325 3300006237 Unclassified 526
86 Ga0068871_100759497 3300006358 Bacteria 892
87 Ga0068871_101239213 3300006358 Bacteria 700
88 Ga0068871_101300274 3300006358 Bacteria 684
89 Ga0075428_100000003 3300006844 Bacteria 365483
90 Ga0075428_100028540 3300006844 Bacteria 6173
91 Ga0075428_100067914 3300006844 Bacteria 3901
92 Ga0075428_100068227 3300006844 Bacteria 3890
93 Ga0075428_100790923 3300006844 Bacteria 1008
94 Ga0075430_100037157 3300006846 Bacteria 4129
95 Ga0075430_100043221 3300006846 Bacteria 3809
96 Ga0075430_100470103 3300006846 Bacteria 1038
97 Ga0075430_101084522 3300006846 Bacteria 660
98 Ga0075430_101445236 3300006846 Bacteria 565
99 Ga0075431_100025474 3300006847 Bacteria 6063
100 Ga0075431_100134557 3300006847 Unclassified 2548
101 Ga0075431_100504234 3300006847 Bacteria 1201
102 Ga0075431_100966697 3300006847 Bacteria 819
103 Ga0075431_100991690 3300006847 Unclassified 807
104 Ga0075433_10008427 3300006852 Bacteria 8224
105 Ga0075434_100012298 3300006871 Bacteria 8108
106 Ga0075434_100565724 3300006871 Unclassified 1156
107 Ga0075434_100618685 3300006871 Bacteria 1102
108 Ga0075434_100813896 3300006871 Bacteria 950
109 Ga0075429_100048500 3300006880 Bacteria 3693
110 Ga0075429_100434661 3300006880 Bacteria 1150
111 Ga0075429_101490162 3300006880 Bacteria 589
112 Ga0075429_101555391 3300006880 Unclassified 575
113 Ga0068865_100887235 3300006881 Bacteria 775
114 Ga0068865_101045759 3300006881 Bacteria 717
115 Ga0075436_100000553 3300006914 Bacteria 24405
116 Ga0075436_101259552 3300006914 Bacteria 559
117 Ga0075435_100223388 3300007076 Bacteria 1599
118 Ga0105240_10008019 3300009093 Bacteria 15203
119 Ga0105240_10387068 3300009093 Bacteria 1578
120 Ga0111539_10000001 3300009094 Bacteria 1035431
121 Ga0111539_10829262 3300009094 Bacteria 1076
122 Ga0111539_12028521 3300009094 Bacteria 667
123 Ga0105245_10502602 3300009098 Bacteria 1229
124 Ga0105247_10068312 3300009101 Bacteria 2216
125 Ga0114129_10121171 3300009147 Bacteria 3600
126 Ga0114129_10441182 3300009147 Bacteria 1709
127 Ga0114129_10687039 3300009147 Bacteria 1317
128 Ga0114129_11504145 3300009147 Bacteria 827
129 Ga0105243_10977894 3300009148 Bacteria 847
130 Ga0105243_11223012 3300009148 Bacteria 765
131 Ga0105243_12898384 3300009148 Bacteria 520
132 Ga0105241_10006960 3300009174 Bacteria 8318
133 Ga0105241_10389705 3300009174 Bacteria 1219
134 Ga0105241_11722933 3300009174 Bacteria 609
135 Ga0105248_10779024 3300009177 Bacteria 1079
136 Ga0105248_11076539 3300009177 Bacteria 908
137 Ga0105237_10002519 3300009545 Bacteria 22690
138 Ga0105237_10370727 3300009545 Unclassified 1436
139 Ga0105238_10001440 3300009551 Bacteria 23914
140 Ga0105238_10805606 3300009551 Unclassified 955
141 Ga0105249_10279354 3300009553 Bacteria 1667
142 Ga0105249_10397630 3300009553 Bacteria 1407
143 Ga0105249_10933337 3300009553 Bacteria 935
144 Ga0105239_10010542 3300010375 Bacteria 10333
145 Ga0157373_10000547 3300013100 Bacteria 29443
146 Ga0157373_10566395 3300013100 Bacteria 825
147 Ga0157373_11522231 3300013100 Bacteria 511
148 Ga0157370_10078146 3300013104 Bacteria 3116
149 Ga0157369_10003538 3300013105 Bacteria 18565
150 Ga0157369_10263507 3300013105 Bacteria 1797
151 Ga0157378_10203117 3300013297 Bacteria 1875
152 Ga0163162_10023584 3300013306 Bacteria 6075
153 Ga0157372_10009996 3300013307 Bacteria 10091
154 Ga0157372_10688310 3300013307 Unclassified 1190
155 Ga0157372_10706126 3300013307 Bacteria 1173
156 Ga0157372_11253868 3300013307 Bacteria 856
157 Ga0157375_11439599 3300013308 Bacteria 812
158 Ga0157375_11843479 3300013308 Bacteria 717
159 Ga0163163_12712657 3300014325 Bacteria 552
160 Ga0157380_10010503 3300014326 Bacteria 6662
161 Ga0157380_10202970 3300014326 Bacteria 1760
162 Ga0157380_10371194 3300014326 Bacteria 1347
163 Ga0157380_10751674 3300014326 Bacteria 986
164 Ga0157377_11531792 3300014745 Bacteria 531
165 Ga0157379_10006014 3300014968 Bacteria 10463
166 Ga0157379_10006473 3300014968 Bacteria 10095
167 Ga0157379_10050566 3300014968 Bacteria 3711
168 Ga0157379_10493590 3300014968 Bacteria 1134
169 Ga0207682_10183387 3300025893 Bacteria 957
170 Ga0207682_10239944 3300025893 Bacteria 842
171 Ga0207710_10099184 3300025900 Bacteria 1372
172 Ga0207699_10000462 3300025906 Bacteria 20729
173 Ga0207699_10122796 3300025906 Bacteria 1682
174 Ga0207645_10030432 3300025907 Bacteria 3478
175 Ga0207645_10546636 3300025907 Bacteria 785
176 Ga0207705_10059843 3300025909 Bacteria 2750
177 Ga0207654_10033210 3300025911 Bacteria 2859
178 Ga0207707_10019799 3300025912 Bacteria 5875
179 Ga0207707_10024755 3300025912 Bacteria 5251
180 Ga0207707_10379490 3300025912 Bacteria 1215
181 Ga0207695_10006695 3300025913 Bacteria 14864
182 Ga0207671_10236644 3300025914 Bacteria 1434
183 Ga0207693_10000099 3300025915 Bacteria 77197
184 Ga0207663_10840690 3300025916 Bacteria 732
185 Ga0207660_10559556 3300025917 Bacteria 930
186 Ga0207660_10587046 3300025917 Bacteria 907
187 Ga0207657_10184782 3300025919 Unclassified 1684
188 Ga0207657_10195728 3300025919 Unclassified 1628
189 Ga0207649_11459339 3300025920 Unclassified 541
190 Ga0207652_10006632 3300025921 Bacteria 9325
191 Ga0207652_10017888 3300025921 Bacteria 5808
192 Ga0207652_11099218 3300025921 Unclassified 695
193 Ga0207646_11546758 3300025922 Bacteria 573
194 Ga0207681_10206441 3300025923 Bacteria 1511
195 Ga0207650_10828422 3300025925 Bacteria 785
196 Ga0207687_10102392 3300025927 Bacteria 2109
197 Ga0207700_10000015 3300025928 Bacteria 224772
198 Ga0207700_10060694 3300025928 Bacteria 2865
199 Ga0207664_10106961 3300025929 Bacteria 2320
200 Ga0207690_10171902 3300025932 Unclassified 1624
201 Ga0207706_10396576 3300025933 Bacteria 1197
202 Ga0207709_11348351 3300025935 Bacteria 590
203 Ga0207669_10046302 3300025937 Bacteria 2569
204 Ga0207669_11364870 3300025937 Bacteria 603
205 Ga0207704_10305410 3300025938 Bacteria 1221
206 Ga0207691_10039668 3300025940 Bacteria 4356
207 Ga0207667_10004523 3300025949 Bacteria 17035
208 Ga0207667_10021413 3300025949 Bacteria 7165
209 Ga0207667_11299460 3300025949 Bacteria 704
210 Ga0207668_10187930 3300025972 Bacteria 1635
211 Ga0207668_11346626 3300025972 Archaea 643
212 Ga0207640_10016906 3300025981 Bacteria 4255
213 Ga0207640_11151870 3300025981 Unclassified 688
214 Ga0207703_10098814 3300026035 Bacteria 2469
215 Ga0207703_12293159 3300026035 Bacteria 516
216 Ga0207639_10146793 3300026041 Bacteria 1971
217 Ga0207708_10024673 3300026075 Bacteria 4547
218 Ga0207708_10242706 3300026075 Bacteria 1449
219 Ga0207708_10876657 3300026075 Unclassified 776
220 Ga0207702_10000011 3300026078 Bacteria 284514
221 Ga0207702_10005646 3300026078 Bacteria 10911
222 Ga0207641_10430700 3300026088 Bacteria 1272
223 Ga0207641_10492730 3300026088 Bacteria 1189
224 Ga0207641_11217015 3300026088 Bacteria 753
225 Ga0207648_10908553 3300026089 Bacteria 823
226 Ga0207648_11142519 3300026089 Bacteria 731
227 Ga0207648_11598817 3300026089 Bacteria 613
228 Ga0207676_10489521 3300026095 Bacteria 1166
229 Ga0207674_10000004 3300026116 Bacteria 241430
230 Ga0207674_11931898 3300026116 Bacteria 556
231 Ga0207675_100731148 3300026118 Bacteria 1000
232 Ga0207675_101324947 3300026118 Bacteria 740
233 Ga0207698_10040316 3300026142 Bacteria 3468
234 Ga0209996_1075452 3300027395 Bacteria 526
235 Ga0209984_1027348 3300027424 Bacteria 799
236 Ga0209982_1006085 3300027552 Bacteria 1751
237 Ga0209970_1018564 3300027614 Bacteria 1168
238 Ga0210002_1004083 3300027617 Bacteria 2166
239 Ga0209983_1003533 3300027665 Bacteria 3327
240 Ga0209971_1111527 3300027682 Bacteria 671
241 Ga0209998_10030516 3300027717 Bacteria 1191
242 Ga0209998_10032852 3300027717 Bacteria 1155
243 Ga0209998_10054911 3300027717 Bacteria 929
244 Ga0209974_10001297 3300027876 Bacteria 8992
245 Ga0209974_10051491 3300027876 Bacteria 1385
246 Ga0207428_10000002 3300027907 Bacteria 854851
247 Ga0207428_10055520 3300027907 Bacteria 3149
248 Ga0268265_10200199 3300028380 Bacteria 1732
249 Ga0268265_10292042 3300028380 Bacteria 1464
250 Ga0268265_12284280 3300028380 Bacteria 548
251 Ga0268264_10198820 3300028381 Bacteria 1832
252 Ga0268264_11201891 3300028381 Bacteria 767
253 Ga0265319_1054272 3300028563 Bacteria 1314
254 Ga0265318_10237731 3300028577 Bacteria 665
255 Ga0265338_10159785 3300028800 Bacteria 1742
256 Ga0265338_10163209 3300028800 Bacteria 1718
257 Ga0265338_10526383 3300028800 Unclassified 830
258 Ga0265338_10953284 3300028800 Bacteria 582
259 Ga0265338_11150511 3300028800 Bacteria 521
260 Ga0265330_10095914 3300031235 Bacteria 1271
261 Ga0265330_10110169 3300031235 Bacteria 1176
262 Ga0265332_10132154 3300031238 Bacteria 1047
263 Ga0265332_10154098 3300031238 Bacteria 961
264 Ga0265332_10236675 3300031238 Bacteria 756
265 Ga0265320_10055270 3300031240 Bacteria 1911
266 Ga0265325_10000083 3300031241 Bacteria 66086
267 Ga0265325_10054651 3300031241 Bacteria 2043
268 Ga0265325_10383087 3300031241 Bacteria 618
269 Ga0265340_10000158 3300031247 Bacteria 34190
270 Ga0265340_10021953 3300031247 Bacteria 3268
271 Ga0265340_10033408 3300031247 Bacteria 2561
272 Ga0265340_10060528 3300031247 Bacteria 1813
273 Ga0265340_10355915 3300031247 Bacteria 647
274 Ga0265339_10001775 3300031249 Bacteria 15873
275 Ga0265339_10053047 3300031249 Bacteria 2206
276 Ga0265339_10334264 3300031249 Bacteria 716
277 Ga0265331_10046989 3300031250 Bacteria 2079
278 Ga0265331_10058374 3300031250 Bacteria 1827
279 Ga0265331_10512776 3300031250 Bacteria 540
280 Ga0265316_10005895 3300031344 Bacteria 11811
281 Ga0265316_10028451 3300031344 Bacteria 4611
282 Ga0265316_10042682 3300031344 Bacteria 3622
283 Ga0265316_10128116 3300031344 Bacteria 1913
284 Ga0265316_10254098 3300031344 Bacteria 1290
285 Ga0307408_100049458 3300031548 Bacteria 3020
286 Ga0265313_10000161 3300031595 Bacteria 70093
287 Ga0265313_10007112 3300031595 Bacteria 7716
288 Ga0265313_10018001 3300031595 Bacteria 3985
289 Ga0265313_10334295 3300031595 Bacteria 603
290 Ga0265314_10069582 3300031711 Bacteria 2361
291 Ga0265314_10169484 3300031711 Bacteria 1319
292 Ga0265314_10251918 3300031711 Unclassified 1013
293 Ga0265314_10321690 3300031711 Bacteria 860
294 Ga0265314_10371571 3300031711 Bacteria 781
295 Ga0265342_10053444 3300031712 Bacteria 2404
296 Ga0265342_10126988 3300031712 Bacteria 1431
297 Ga0265342_10213472 3300031712 Bacteria 1042
298 Ga0265342_10289924 3300031712 Bacteria 864
299 Ga0265342_10408904 3300031712 Bacteria 700
300 Ga0316576_10560627 3300031727 Bacteria 836
301 Ga0307516_10996305 3300031730 Unclassified 510
302 Ga0307405_10343100 3300031731 Bacteria 1149
303 Ga0307405_10971216 3300031731 Bacteria 723
304 Ga0307406_10570848 3300031901 Bacteria 928
305 Ga0307407_11150482 3300031903 Bacteria 605
306 Ga0307412_10669780 3300031911 Bacteria 887
307 Ga0307409_100041362 3300031995 Bacteria 3441
308 Ga0307409_100664821 3300031995 Bacteria 1037
309 Ga0307409_102624212 3300031995 Bacteria 532
310 Ga0307416_100058160 3300032002 Bacteria 3132
311 Ga0307416_100707472 3300032002 Bacteria 1097
312 Ga0307414_10479142 3300032004 Bacteria 1097
313 Ga0307414_11871633 3300032004 Bacteria 560
314 Ga0373928_0274246 3300035084 Bacteria 509
315 Ga0373932_0081011 3300035112 Bacteria 1025
316 Ga0373954_0201990 3300035118 Unclassified 977
317 Ga0373956_0478404 3300035119 Unclassified 594
318 Ga0373957_0099194 3300035120 Bacteria 1165
319 Ga0373957_0478186 3300035120 Unclassified 541
320 Ga0373955_0107049 3300035172 Unclassified 1613
321 Ga0316574_0973745 3300035398 Bacteria 511
322 Ga0373931_0340343 3300035691 Bacteria 936
323 Ga0373931_0724272 3300035691 Bacteria 658
324 Ga0373935_0381297 3300035692 Unclassified 1010
325 Ga0373933_0025692 3300035724 Bacteria 3379
326 Ga0373937_0023854 3300036401 Bacteria 5516
327 Ga0373937_0216076 3300036401 Bacteria 1804
328 Ga0373937_0576926 3300036401 Bacteria 1068
329 Ga0316582_0347647 3300036647 Bacteria 1020
330 Ga0316584_0062383 3300036712 Unclassified 2792
331 Ga0316584_0457646 3300036712 Bacteria 902
332 Ga0316584_1136565 3300036712 Unclassified 517
333 Ga0373925_0394337 3300037068 Unclassified 1128
334 Ga0373925_0812005 3300037068 Bacteria 771
335 Ga0400489_69221 3300039093 Bacteria 2104
336 Ga0436360_0217978 3300039438 Bacteria 2047
337 Ga0436362_0679709 3300039453 Bacteria 809
338 Ga0439439_0006247 3300041406 Bacteria 2752
339 Ga0439443_081046 3300042003 Bacteria 603
340 Ga0439445_0121157 3300042004 Bacteria 751
341 Ga0450913_007740 3300042117 Bacteria 814
342 Ga0450921_019736 3300042123 Bacteria 634
343 Ga0450890_048268 3300042127 Bacteria 644
344 Ga0450896_046234 3300042133 Bacteria 686
345 Ga0439446_0002984 3300042156 Bacteria 4141
346 Ga0439458_0046175 3300042157 Bacteria 1066
347 Ga0439434_0044116 3300042435 Bacteria 1373
348 Ga0439435_0046498 3300042436 Bacteria 1230
349 Ga0439444_0190912 3300042437 Bacteria 513
350 Ga0451577_0119458 3300042876 Bacteria 2361
351 Ga0466961_0797863 3300044693 Bacteria 564
352 Ga0466963_0203040 3300044694 Unclassified 1387
353 Ga0453684_0000101 3300044712 Bacteria 368298
354 Ga0453684_0015534 3300044712 Bacteria 12028
355 Ga0451576_1155149 3300045051 Bacteria 809
356 Ga0495651_0382884 3300046462 Bacteria 922
357 Ga0495608_0333892 3300046511 Bacteria 935
358 Ga0495630_0497422 3300046517 Bacteria 935
359 Ga0495630_1461159 3300046517 Bacteria 513
360 Ga0495586_0833249 3300046535 Bacteria 532
361 Ga0495657_0788865 3300046675 Bacteria 543
362 Ga0495623_0292446 3300046679 Bacteria 903
363 Ga0495647_0066430 3300046681 Bacteria 1435
364 Ga0495658_0946666 3300046683 Bacteria 550
365 Ga0495669_0001531 3300046684 Bacteria 9513
366 Ga0495636_0209885 3300047318 Unclassified 891
367 Ga0495675_0416720 3300047444 Bacteria 781
368 Ga0495602_0384148 3300048088 Bacteria 1005
369 Ga0496102_0888250 3300048905 Bacteria 813
370 Ga0496107_0430109 3300048910 Bacteria 981
371 Ga0496112_0380164 3300048915 Viruses 1353
372 Ga0496112_0931980 3300048915 Bacteria 790
373 Ga0501032_0008580 3300049569 Bacteria 7450
374 Ga0501036_0295710 3300049572 Bacteria 1354
375 Ga0501036_0493410 3300049572 Unclassified 1019
376 Ga0501038_0474386 3300049574 Bacteria 959
377 Ga0501039_0361479 3300049575 Bacteria 1140
378 Ga0501043_1302619 3300049579 Bacteria 507
379 Ga0501046_0270569 3300049580 Bacteria 1246
380 Ga0501047_0096336 3300049581 Bacteria 2837
381 Ga0501067_0058848 3300049583 Bacteria 2127
382 Ga0501068_0002967 3300049584 Bacteria 9041
383 Ga0501068_0433940 3300049584 Bacteria 849
384 Ga0501070_0814904 3300049586 Bacteria 732
385 Ga0501073_0059191 3300049589 Bacteria 2676
386 Ga0501073_0645076 3300049589 Bacteria 731
387 Ga0501073_0850565 3300049589 Bacteria 628
388 Ga0501076_1357717 3300049592 Bacteria 584
389 Ga0501077_0815264 3300049593 Bacteria 600
390 Ga0501077_0849098 3300049593 Bacteria 587
391 Ga0501083_0022338 3300049744 Bacteria 4391
392 Ga0501044_0302750 3300049823 Bacteria 1527
393 nmdc:mga00v17_675617_c1 3300050491 Bacteria 663
394 nmdc:mga05p37_1529914_c1 3300050507 Bacteria 662
395 nmdc:mga05p37_441330_c1 3300050507 Bacteria 1509
396 nmdc:mga09592_422098_c1 3300050508 Bacteria 1152
397 nmdc:mga09592_701022_c1 3300050508 Bacteria 862
398 nmdc:mga09592_788843_c1 3300050508 Unclassified 804
399 nmdc:mga0qj67_1008826_c1 3300050509 Bacteria 653
400 nmdc:mga0qj67_206446_c1 3300050509 Bacteria 1596
401 nmdc:mga0qj67_45700_c2 3300050509 Bacteria 2182
402 nmdc:mga0qj67_513599_c1 3300050509 Bacteria 963
403 nmdc:mga0qj67_828668_c1 3300050509 Bacteria 731
404 nmdc:mga06r32_116835_c1 3300050510 Unclassified 2629
405 nmdc:mga06r32_1551360_c1 3300050510 Bacteria 602
406 nmdc:mga06r32_160832_c1 3300050510 Unclassified 806
407 nmdc:mga06r32_165713_c1 3300050510 Bacteria 2193
408 nmdc:mga06r32_277314_c1 3300050510 Bacteria 1664
409 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
410 nmdc:mga08y16_736926_c1 3300050511 Bacteria 982
411 nmdc:mga0n895_15710_c1 3300050512 Bacteria 6918
412 nmdc:mga0n895_1690706_c1 3300050512 Bacteria 596
413 nmdc:mga0n895_20846_c1 3300050512 Bacteria 6122
414 nmdc:mga0n895_249489_c1 3300050512 Bacteria 1801
415 nmdc:mga0rr50_1132813_c1 3300050513 Bacteria 665
416 nmdc:mga0rr50_301924_c1 3300050513 Bacteria 1339
417 nmdc:mga0rr50_42538_c1 3300050513 Bacteria 3318
418 nmdc:mga0rr50_45079_c1 3300050513 Bacteria 3238
419 nmdc:mga08x19_250309_c1 3300050514 Bacteria 1223
420 nmdc:mga08x19_381_c1 3300050514 Bacteria 31108
421 nmdc:mga08x19_7934_c1 3300050514 Bacteria 6309
422 nmdc:mga0a205_1281397_c1 3300050515 Bacteria 581
423 Ga0495619_0067848 3300053085 Bacteria 2382
424 Ga0501082_0180560 3300060353 Bacteria 1836
425 Ga0070683_100670494
426 Ga0065715_10805110
427 Ga0065707_10442474
428 Ga0065707_10869266
429 Ga0070658_10114041
430 Ga0070676_10023538
431 Ga0070676_11521100
432 Ga0070680_100875598
433 Ga0070680_100912955
434 Ga0068868_100904554
435 Ga0070660_100187617
436 Ga0070660_100204534
437 Ga0070691_10001156
438 Ga0070691_10157918
439 Ga0070668_100029505
440 Ga0070668_102250125
441 Ga0070669_100176552
442 Ga0070669_100176736
443 Ga0070669_100565273
444 Ga0070675_100067423
445 Ga0070674_100069755
446 Ga0070673_102040370
447 Ga0070688_100873118
448 Ga0070659_100100362
449 Ga0070709_10000184
450 Ga0070709_10073149
451 Ga0070714_100020356
452 Ga0070713_100000001
453 Ga0070713_100077226
454 Ga0070701_10591134
455 Ga0070700_100347186
456 Ga0070694_100381687
457 Ga0070708_100617234
458 Ga0070678_100551693
459 Ga0070681_10018800
460 Ga0070681_10042791
461 Ga0070681_10419399
462 Ga0068867_100062517
463 Ga0068867_102252934
464 Ga0070706_100993442
465 Ga0070679_100032184
466 Ga0070679_100047438
467 Ga0070679_101237510
468 Ga0070684_101188730
469 Ga0070684_101315333
470 Ga0068853_100022645
471 Ga0070672_100234078
472 Ga0070672_100555593
473 Ga0070695_100006278
474 Ga0070696_101029055
475 Ga0070696_101332276
476 Ga0070693_100039396
477 Ga0070665_101706336
478 Ga0070704_100681394
479 Ga0070704_101406328
480 Ga0068855_100014497
481 Ga0068855_100030199
482 Ga0068855_100531413
483 Ga0068855_102273942
484 Ga0070664_100193204
485 Ga0070664_100396302
486 Ga0068857_100000821
487 Ga0068857_101439659
488 Ga0068854_100029197
489 Ga0068856_100000182
490 Ga0068856_100003034
491 Ga0068852_100000764
492 Ga0068864_100436621
493 Ga0068864_102664886
494 Ga0068861_100763014
495 Ga0068870_11444876
496 Ga0068863_100385075
497 Ga0068863_102355949
498 Ga0068858_101545252
499 Ga0068860_100236038
500 Ga0068860_100845392
501 Ga0068862_100113306
502 Ga0081538_10011477
503 Ga0081539_10000164
504 Ga0081539_10020919
505 Ga0081539_10038911
506 Ga0070716_100378666
507 Ga0070712_100000026
508 Ga0097621_100357152
509 Ga0097621_102208325
510 Ga0068871_100759497
511 Ga0068871_101239213
512 Ga0068871_101300274
513 Ga0075428_100000003
514 Ga0075428_100028540
515 Ga0075428_100067914
516 Ga0075428_100068227
517 Ga0075428_100790923
518 Ga0075430_100037157
519 Ga0075430_100043221
520 Ga0075430_100470103
521 Ga0075430_101084522
522 Ga0075430_101445236
523 Ga0075431_100025474
524 Ga0075431_100134557
525 Ga0075431_100504234
526 Ga0075431_100966697
527 Ga0075431_100991690
528 Ga0075433_10008427
529 Ga0075434_100012298
530 Ga0075434_100565724
531 Ga0075434_100618685
532 Ga0075434_100813896
533 Ga0075429_100048500
534 Ga0075429_100434661
535 Ga0075429_101490162
536 Ga0075429_101555391
537 Ga0068865_100887235
538 Ga0068865_101045759
539 Ga0075436_100000553
540 Ga0075436_101259552
541 Ga0075435_100223388
542 Ga0105240_10008019
543 Ga0105240_10387068
544 Ga0111539_10000001
545 Ga0111539_10829262
546 Ga0111539_12028521
547 Ga0105245_10502602
548 Ga0105247_10068312
549 Ga0114129_10121171
550 Ga0114129_10441182
551 Ga0114129_10687039
552 Ga0114129_11504145
553 Ga0105243_10977894
554 Ga0105243_11223012
555 Ga0105243_12898384
556 Ga0105241_10006960
557 Ga0105241_10389705
558 Ga0105241_11722933
559 Ga0105248_10779024
560 Ga0105248_11076539
561 Ga0105237_10002519
562 Ga0105237_10370727
563 Ga0105238_10001440
564 Ga0105238_10805606
565 Ga0105249_10279354
566 Ga0105249_10397630
567 Ga0105249_10933337
568 Ga0105239_10010542
569 Ga0157373_10000547
570 Ga0157373_10566395
571 Ga0157373_11522231
572 Ga0157370_10078146
573 Ga0157369_10003538
574 Ga0157369_10263507
575 Ga0157378_10203117
576 Ga0163162_10023584
577 Ga0157372_10009996
578 Ga0157372_10688310
579 Ga0157372_10706126
580 Ga0157372_11253868
581 Ga0157375_11439599
582 Ga0157375_11843479
583 Ga0163163_12712657
584 Ga0157380_10010503
585 Ga0157380_10202970
586 Ga0157380_10371194
587 Ga0157380_10751674
588 Ga0157377_11531792
589 Ga0157379_10006014
590 Ga0157379_10006473
591 Ga0157379_10050566
592 Ga0157379_10493590
593 Ga0207682_10183387
594 Ga0207682_10239944
595 Ga0207710_10099184
596 Ga0207699_10000462
597 Ga0207699_10122796
598 Ga0207645_10030432
599 Ga0207645_10546636
600 Ga0207705_10059843
601 Ga0207654_10033210
602 Ga0207707_10019799
603 Ga0207707_10024755
604 Ga0207707_10379490
605 Ga0207695_10006695
606 Ga0207671_10236644
607 Ga0207693_10000099
608 Ga0207663_10840690
609 Ga0207660_10559556
610 Ga0207660_10587046
611 Ga0207657_10184782
612 Ga0207657_10195728
613 Ga0207649_11459339
614 Ga0207652_10006632
615 Ga0207652_10017888
616 Ga0207652_11099218
617 Ga0207646_11546758
618 Ga0207681_10206441
619 Ga0207650_10828422
620 Ga0207687_10102392
621 Ga0207700_10000015
622 Ga0207700_10060694
623 Ga0207664_10106961
624 Ga0207690_10171902
625 Ga0207706_10396576
626 Ga0207709_11348351
627 Ga0207669_10046302
628 Ga0207669_11364870
629 Ga0207704_10305410
630 Ga0207691_10039668
631 Ga0207667_10004523
632 Ga0207667_10021413
633 Ga0207667_11299460
634 Ga0207668_10187930
635 Ga0207668_11346626
636 Ga0207640_10016906
637 Ga0207640_11151870
638 Ga0207703_10098814
639 Ga0207703_12293159
640 Ga0207639_10146793
641 Ga0207708_10024673
642 Ga0207708_10242706
643 Ga0207708_10876657
644 Ga0207702_10000011
645 Ga0207702_10005646
646 Ga0207641_10430700
647 Ga0207641_10492730
648 Ga0207641_11217015
649 Ga0207648_10908553
650 Ga0207648_11142519
651 Ga0207648_11598817
652 Ga0207676_10489521
653 Ga0207674_10000004
654 Ga0207674_11931898
655 Ga0207675_100731148
656 Ga0207675_101324947
657 Ga0207698_10040316
658 Ga0209996_1075452
659 Ga0209984_1027348
660 Ga0209982_1006085
661 Ga0209970_1018564
662 Ga0210002_1004083
663 Ga0209983_1003533
664 Ga0209971_1111527
665 Ga0209998_10030516
666 Ga0209998_10032852
667 Ga0209998_10054911
668 Ga0209974_10001297
669 Ga0209974_10051491
670 Ga0207428_10000002
671 Ga0207428_10055520
672 Ga0268265_10200199
673 Ga0268265_10292042
674 Ga0268265_12284280
675 Ga0268264_10198820
676 Ga0268264_11201891
677 Ga0265319_1054272
678 Ga0265318_10237731
679 Ga0265338_10159785
680 Ga0265338_10163209
681 Ga0265338_10526383
682 Ga0265338_10953284
683 Ga0265338_11150511
684 Ga0265330_10095914
685 Ga0265330_10110169
686 Ga0265332_10132154
687 Ga0265332_10154098
688 Ga0265332_10236675
689 Ga0265320_10055270
690 Ga0265325_10000083
691 Ga0265325_10054651
692 Ga0265325_10383087
693 Ga0265340_10000158
694 Ga0265340_10021953
695 Ga0265340_10033408
696 Ga0265340_10060528
697 Ga0265340_10355915
698 Ga0265339_10001775
699 Ga0265339_10053047
700 Ga0265339_10334264
701 Ga0265331_10046989
702 Ga0265331_10058374
703 Ga0265331_10512776
704 Ga0265316_10005895
705 Ga0265316_10028451
706 Ga0265316_10042682
707 Ga0265316_10128116
708 Ga0265316_10254098
709 Ga0307408_100049458
710 Ga0265313_10000161
711 Ga0265313_10007112
712 Ga0265313_10018001
713 Ga0265313_10334295
714 Ga0265314_10069582
715 Ga0265314_10169484
716 Ga0265314_10251918
717 Ga0265314_10321690
718 Ga0265314_10371571
719 Ga0265342_10053444
720 Ga0265342_10126988
721 Ga0265342_10213472
722 Ga0265342_10289924
723 Ga0265342_10408904
724 Ga0316576_10560627
725 Ga0307516_10996305
726 Ga0307405_10343100
727 Ga0307405_10971216
728 Ga0307406_10570848
729 Ga0307407_11150482
730 Ga0307412_10669780
731 Ga0307409_100041362
732 Ga0307409_100664821
733 Ga0307409_102624212
734 Ga0307416_100058160
735 Ga0307416_100707472
736 Ga0307414_10479142
737 Ga0307414_11871633
738 Ga0373928_0274246
739 Ga0373932_0081011
740 Ga0373954_0201990
741 Ga0373956_0478404
742 Ga0373957_0099194
743 Ga0373957_0478186
744 Ga0373955_0107049
745 Ga0316574_0973745
746 Ga0373931_0340343
747 Ga0373931_0724272
748 Ga0373935_0381297
749 Ga0373933_0025692
750 Ga0373937_0023854
751 Ga0373937_0216076
752 Ga0373937_0576926
753 Ga0316582_0347647
754 Ga0316584_0062383
755 Ga0316584_0457646
756 Ga0316584_1136565
757 Ga0373925_0394337
758 Ga0373925_0812005
759 Ga0400489_69221
760 Ga0436360_0217978
761 Ga0436362_0679709
762 Ga0439439_0006247
763 Ga0439443_081046
764 Ga0439445_0121157
765 Ga0450913_007740
766 Ga0450921_019736
767 Ga0450890_048268
768 Ga0450896_046234
769 Ga0439446_0002984
770 Ga0439458_0046175
771 Ga0439434_0044116
772 Ga0439435_0046498
773 Ga0439444_0190912
774 Ga0451577_0119458
775 Ga0466961_0797863
776 Ga0466963_0203040
777 Ga0453684_0000101
778 Ga0453684_0015534
779 Ga0451576_1155149
780 Ga0495651_0382884
781 Ga0495608_0333892
782 Ga0495630_0497422
783 Ga0495630_1461159
784 Ga0495586_0833249
785 Ga0495657_0788865
786 Ga0495623_0292446
787 Ga0495647_0066430
788 Ga0495658_0946666
789 Ga0495669_0001531
790 Ga0495636_0209885
791 Ga0495675_0416720
792 Ga0495602_0384148
793 Ga0496102_0888250
794 Ga0496107_0430109
795 Ga0496112_0380164
796 Ga0496112_0931980
797 Ga0501032_0008580
798 Ga0501036_0295710
799 Ga0501036_0493410
800 Ga0501038_0474386
801 Ga0501039_0361479
802 Ga0501043_1302619
803 Ga0501046_0270569
804 Ga0501047_0096336
805 Ga0501067_0058848
806 Ga0501068_0002967
807 Ga0501068_0433940
808 Ga0501070_0814904
809 Ga0501073_0059191
810 Ga0501073_0645076
811 Ga0501073_0850565
812 Ga0501076_1357717
813 Ga0501077_0815264
814 Ga0501077_0849098
815 Ga0501083_0022338
816 Ga0501044_0302750
817 nmdc:mga00v17_675617_c1
818 nmdc:mga05p37_1529914_c1
819 nmdc:mga05p37_441330_c1
820 nmdc:mga09592_422098_c1
821 nmdc:mga09592_701022_c1
822 nmdc:mga09592_788843_c1
823 nmdc:mga0qj67_1008826_c1
824 nmdc:mga0qj67_206446_c1
825 nmdc:mga0qj67_45700_c2
826 nmdc:mga0qj67_513599_c1
827 nmdc:mga0qj67_828668_c1
828 nmdc:mga06r32_116835_c1
829 nmdc:mga06r32_1551360_c1
830 nmdc:mga06r32_160832_c1
831 nmdc:mga06r32_165713_c1
832 nmdc:mga06r32_277314_c1
833 nmdc:mga08y16_3_c1
834 nmdc:mga08y16_736926_c1
835 nmdc:mga0n895_15710_c1
836 nmdc:mga0n895_1690706_c1
837 nmdc:mga0n895_20846_c1
838 nmdc:mga0n895_249489_c1
839 nmdc:mga0rr50_1132813_c1
840 nmdc:mga0rr50_301924_c1
841 nmdc:mga0rr50_42538_c1
842 nmdc:mga0rr50_45079_c1
843 nmdc:mga08x19_250309_c1
844 nmdc:mga08x19_381_c1
845 nmdc:mga08x19_7934_c1
846 nmdc:mga0a205_1281397_c1
847 Ga0495619_0067848
848 Ga0501082_0180560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

6

68

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f51-assembly1.cif.gz_A crystal structure of the clp gene regulator clgr from corynebacterium glutamicum 0.9465 7 61
2xj3-assembly1.cif.gz_B high resolution structure of the t55c mutant of cylr2. 0.9456 5 66
3bs3-assembly1.cif.gz_A-2 crystal structure of a putative dna-binding protein from bacteroides fragilis 0.9372 3 64
3f52-assembly1.cif.gz_E crystal structure of the clp gene regulator clgr from c. glutamicum 0.9346 7 57
1utx-assembly1.cif.gz_B regulation of cytolysin expression by enterococcus faecalis: role of cylr2 0.9273 3 68
ID Description Score Start End Superfamily
3f51A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9465 7 61 1.10.260.40
3f51C00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9373 7 61 1.10.260.40
3f52E00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9346 7 57 1.10.260.40
3qq6B00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9257 8 59 1.10.260.40
3omtB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9205 7 65 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A2M8WQ62-F1-model_v4 Xre family transcriptional regulator 0.9924 3 64 GO:0003677
AF-A0A7X6U6X3-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9896 2 64 GO:0003677
AF-A0A412LL25-F1-model_v4 Transcriptional regulator 0.9892 3 66 GO:0003677
AF-A0A328UAV5-F1-model_v4 Transcriptional regulator 0.9858 3 66 GO:0003677
AF-A0A1H9FDC5-F1-model_v4 Putative transcriptional regulator 0.9849 2 64 GO:0003677

Map