F440905

General Info

Members Datasets Scaffolds Average Seq Length
425 179 850 315

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100042768|Ga0070683_1000427684
Length 332
Sequence LSAADFSTDVSAAPLGGRRIRLGDLLLQLVAGLAALASVVLVGLIVWKVIAGAWPSIDTFGLSFVWHIAWNPVLGHELYGAGSFLFGTAITSLLALALAAPLAIGIALYLTELSPRFLRGPVTALVETLAAIPSVVMGLWGILVLGPLLHDHVEPALHSALGFIPLFGEPSPSGSSIFTAVIVLAIMILPIVASITRELFLGVPRELREGALAMGTTRWEMIQGVVFPYARGGIAAALILGLGRAIGEAIAVTQVIGGGVFIHWSLFSTGDTLASKIAASYQGATTKIQVASLIYLGLILLVFSLLMNVAAQWIVRRVARRQGVGTNRGGLG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
76 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.35
Rhizosphere 89.41
Stem 0
Stem Tuber 0
Unclassified 3.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100042768 3300005329 Bacteria 4173
2 rootH2_10171436 3300003320 Bacteria 2376
3 Ga0070658_10036992 3300005327 Bacteria 3933
4 Ga0070658_10055488 3300005327 Bacteria 3219
5 Ga0070658_10140618 3300005327 Bacteria 2016
6 Ga0070680_100022428 3300005336 Bacteria 5029
7 Ga0070680_100045638 3300005336 Bacteria 3563
8 Ga0070682_100033555 3300005337 Bacteria 3120
9 Ga0070682_100151679 3300005337 Bacteria 1591
10 Ga0070682_100266655 3300005337 Bacteria 1242
11 Ga0070660_100014624 3300005339 Bacteria 5661
12 Ga0070660_100015413 3300005339 Bacteria 5519
13 Ga0070660_100016446 3300005339 Bacteria 5369
14 Ga0070660_100023225 3300005339 Bacteria 4594
15 Ga0070660_100190806 3300005339 Bacteria 1660
16 Ga0070660_100311968 3300005339 Bacteria 1291
17 Ga0070661_100002256 3300005344 Bacteria 13217
18 Ga0070661_100252501 3300005344 Bacteria 1361
19 Ga0070671_100316629 3300005355 Bacteria 1329
20 Ga0070659_100095611 3300005366 Bacteria 2386
21 Ga0070709_10016593 3300005434 Bacteria 4207
22 Ga0070709_10097829 3300005434 Bacteria 1949
23 Ga0070709_10103465 3300005434 Unclassified 1901
24 Ga0070714_100013500 3300005435 Bacteria 6548
25 Ga0070714_100033583 3300005435 Bacteria 4290
26 Ga0070714_100051319 3300005435 Bacteria 3515
27 Ga0070714_100069729 3300005435 Bacteria 3037
28 Ga0070714_100093595 3300005435 Bacteria 2636
29 Ga0070714_100183153 3300005435 Bacteria 1907
30 Ga0070714_100272468 3300005435 Unclassified 1570
31 Ga0070713_100012896 3300005436 Bacteria 6150
32 Ga0070713_100033219 3300005436 Bacteria 4130
33 Ga0070713_100062388 3300005436 Bacteria 3122
34 Ga0070713_100100388 3300005436 Bacteria 2505
35 Ga0070710_10054881 3300005437 Unclassified 2249
36 Ga0070711_100026451 3300005439 Bacteria 3803
37 Ga0070711_100027840 3300005439 Bacteria 3714
38 Ga0070711_100141264 3300005439 Bacteria 1806
39 Ga0070681_10015981 3300005458 Bacteria 7484
40 Ga0070681_10035382 3300005458 Bacteria 5017
41 Ga0070681_10042138 3300005458 Bacteria 4576
42 Ga0070681_10063530 3300005458 Bacteria 3664
43 Ga0070681_10082837 3300005458 Bacteria 3162
44 Ga0070681_10236312 3300005458 Bacteria 1741
45 Ga0070706_100152931 3300005467 Bacteria 2154
46 Ga0070707_100003577 3300005468 Bacteria 14661
47 Ga0070698_100036439 3300005471 Bacteria 5081
48 Ga0070698_100170870 3300005471 Bacteria 2115
49 Ga0070698_100176547 3300005471 Bacteria 2075
50 Ga0070698_100295554 3300005471 Bacteria 1551
51 Ga0070679_100033052 3300005530 Bacteria 5120
52 Ga0070679_100108155 3300005530 Bacteria 2766
53 Ga0070684_100009303 3300005535 Bacteria 7735
54 Ga0070684_100009575 3300005535 Bacteria 7634
55 Ga0070684_100087540 3300005535 Bacteria 2766
56 Ga0070684_100140026 3300005535 Bacteria 2187
57 Ga0070684_100155398 3300005535 Bacteria 2074
58 Ga0070695_100000670 3300005545 Bacteria 18279
59 Ga0070693_100081909 3300005547 Bacteria 1926
60 Ga0068855_100049669 3300005563 Bacteria 4946
61 Ga0068855_100112447 3300005563 Bacteria 3125
62 Ga0068855_100396251 3300005563 Bacteria 1514
63 Ga0070664_100217698 3300005564 Bacteria 1708
64 Ga0068856_100186943 3300005614 Bacteria 2085
65 Ga0081455_10004511 3300005937 Bacteria 15565
66 Ga0081455_10005352 3300005937 Bacteria 14094
67 Ga0081455_10018827 3300005937 Bacteria 6550
68 Ga0081539_10002541 3300005985 Bacteria 25355
69 Ga0070717_10018633 3300006028 Bacteria 5427
70 Ga0070717_10018777 3300006028 Bacteria 5407
71 Ga0070717_10031485 3300006028 Bacteria 4268
72 Ga0070717_10032568 3300006028 Bacteria 4201
73 Ga0075432_10003526 3300006058 Bacteria 5305
74 Ga0070715_10084501 3300006163 Bacteria 1448
75 Ga0070716_100183928 3300006173 Bacteria 1375
76 Ga0070716_100225087 3300006173 Bacteria 1263
77 Ga0070712_100021245 3300006175 Bacteria 4260
78 Ga0070712_100027155 3300006175 Bacteria 3820
79 Ga0075428_100042491 3300006844 Bacteria 4998
80 Ga0075431_100070432 3300006847 Bacteria 3608
81 Ga0075434_100133527 3300006871 Bacteria 2501
82 Ga0075434_100212931 3300006871 Unclassified 1952
83 Ga0075429_100146201 3300006880 Bacteria 2069
84 Ga0075436_100141320 3300006914 Bacteria 1692
85 Ga0075435_100130302 3300007076 Unclassified 2104
86 Ga0105240_10085718 3300009093 Bacteria 3859
87 Ga0105240_10096690 3300009093 Bacteria 3599
88 Ga0105240_10172747 3300009093 Bacteria 2558
89 Ga0105240_10212322 3300009093 Bacteria 2260
90 Ga0105240_10785854 3300009093 Bacteria 1032
91 Ga0111539_10036627 3300009094 Bacteria 5929
92 Ga0111539_10168331 3300009094 Bacteria 2561
93 Ga0105245_10034848 3300009098 Bacteria 4465
94 Ga0114129_10067221 3300009147 Bacteria 4999
95 Ga0105237_10020096 3300009545 Bacteria 6894
96 Ga0105238_10047235 3300009551 Bacteria 4343
97 Ga0105238_10096783 3300009551 Bacteria 2937
98 Ga0157371_10244667 3300013102 Bacteria 1291
99 Ga0157370_10012865 3300013104 Bacteria 8651
100 Ga0157370_10021515 3300013104 Bacteria 6427
101 Ga0157370_10075634 3300013104 Bacteria 3174
102 Ga0157369_10008041 3300013105 Bacteria 12095
103 Ga0157369_10018488 3300013105 Bacteria 7813
104 Ga0157369_10036209 3300013105 Bacteria 5408
105 Ga0157369_10175745 3300013105 Bacteria 2255
106 Ga0157372_10097837 3300013307 Bacteria 3347
107 Ga0157372_10267185 3300013307 Bacteria 1987
108 Ga0157372_10481565 3300013307 Bacteria 1447
109 Ga0182008_10040008 3300014497 Bacteria 2342
110 Ga0182008_10040120 3300014497 Bacteria 2338
111 Ga0206356_10266076 3300020070 Bacteria 2237
112 Ga0206356_11907936 3300020070 Bacteria 2548
113 Ga0207692_10035270 3300025898 Bacteria 2429
114 Ga0207692_10065811 3300025898 Bacteria 1892
115 Ga0207699_10078093 3300025906 Bacteria 2044
116 Ga0207699_10091766 3300025906 Bacteria 1908
117 Ga0207699_10181774 3300025906 Bacteria 1414
118 Ga0207699_10193886 3300025906 Bacteria 1372
119 Ga0207705_10026659 3300025909 Bacteria 4119
120 Ga0207707_10017295 3300025912 Bacteria 6285
121 Ga0207707_10031160 3300025912 Bacteria 4666
122 Ga0207707_10037056 3300025912 Bacteria 4261
123 Ga0207707_10204614 3300025912 Bacteria 1720
124 Ga0207707_10414824 3300025912 Unclassified 1155
125 Ga0207695_10015652 3300025913 Bacteria 8921
126 Ga0207695_10089272 3300025913 Bacteria 3100
127 Ga0207695_10121922 3300025913 Bacteria 2574
128 Ga0207671_10018650 3300025914 Bacteria 5317
129 Ga0207693_10031085 3300025915 Bacteria 4218
130 Ga0207693_10044381 3300025915 Bacteria 3494
131 Ga0207663_10059814 3300025916 Bacteria 2412
132 Ga0207663_10071202 3300025916 Unclassified 2243
133 Ga0207663_10104702 3300025916 Bacteria 1908
134 Ga0207660_10058148 3300025917 Bacteria 2771
135 Ga0207660_10072550 3300025917 Bacteria 2507
136 Ga0207657_10002003 3300025919 Bacteria 22017
137 Ga0207657_10009290 3300025919 Bacteria 9904
138 Ga0207657_10018203 3300025919 Bacteria 6720
139 Ga0207657_10026670 3300025919 Bacteria 5304
140 Ga0207649_10062381 3300025920 Bacteria 2350
141 Ga0207649_10212639 3300025920 Bacteria 1373
142 Ga0207652_10019733 3300025921 Bacteria 5546
143 Ga0207652_10074924 3300025921 Bacteria 2948
144 Ga0207646_10000785 3300025922 Bacteria 41163
145 Ga0207646_10278189 3300025922 Bacteria 1512
146 Ga0207694_10104540 3300025924 Bacteria 2247
147 Ga0207687_10059711 3300025927 Bacteria 2687
148 Ga0207700_10000012 3300025928 Bacteria 231712
149 Ga0207700_10002676 3300025928 Bacteria 10263
150 Ga0207700_10011526 3300025928 Bacteria 5643
151 Ga0207700_10089261 3300025928 Bacteria 2429
152 Ga0207700_10110637 3300025928 Bacteria 2210
153 Ga0207664_10003292 3300025929 Bacteria 10740
154 Ga0207664_10008805 3300025929 Bacteria 7059
155 Ga0207664_10028107 3300025929 Bacteria 4271
156 Ga0207664_10079986 3300025929 Bacteria 2655
157 Ga0207664_10093247 3300025929 Bacteria 2473
158 Ga0207664_10173507 3300025929 Bacteria 1847
159 Ga0207644_10357499 3300025931 Bacteria 1187
160 Ga0207665_10001126 3300025939 Bacteria 17976
161 Ga0207661_10031054 3300025944 Bacteria 4122
162 Ga0207667_10085766 3300025949 Bacteria 3259
163 Ga0207667_10414309 3300025949 Bacteria 1371
164 Ga0207702_10201583 3300026078 Bacteria 1845
165 Ga0207428_10002858 3300027907 Bacteria 17124
166 Ga0207428_10096612 3300027907 Bacteria 2287
167 Ga0265319_1000985 3300028563 Bacteria 17873
168 Ga0265319_1004406 3300028563 Bacteria 6980
169 Ga0265319_1009282 3300028563 Bacteria 4209
170 Ga0265319_1032005 3300028563 Bacteria 1827
171 Ga0265318_10000633 3300028577 Bacteria 24181
172 Ga0265336_10010681 3300028666 Bacteria 3141
173 Ga0265338_10000811 3300028800 Bacteria 52712
174 Ga0265338_10011482 3300028800 Bacteria 10226
175 Ga0265338_10013126 3300028800 Bacteria 9386
176 Ga0265338_10017139 3300028800 Bacteria 7828
177 Ga0265338_10042877 3300028800 Bacteria 4206
178 Ga0265338_10093357 3300028800 Bacteria 2480
179 Ga0265324_10039587 3300029957 Bacteria 1634
180 Ga0265330_10002570 3300031235 Bacteria 9854
181 Ga0265330_10020045 3300031235 Bacteria 3057
182 Ga0265332_10014143 3300031238 Bacteria 3531
183 Ga0265332_10080095 3300031238 Bacteria 1386
184 Ga0265320_10028528 3300031240 Bacteria 2897
185 Ga0265320_10055106 3300031240 Bacteria 1915
186 Ga0265320_10100341 3300031240 Bacteria 1333
187 Ga0265325_10006204 3300031241 Bacteria 7288
188 Ga0265329_10005681 3300031242 Bacteria 5013
189 Ga0265329_10005871 3300031242 Bacteria 4922
190 Ga0265340_10011167 3300031247 Bacteria 4783
191 Ga0265339_10025872 3300031249 Bacteria 3363
192 Ga0265339_10040100 3300031249 Bacteria 2603
193 Ga0265331_10008506 3300031250 Bacteria 5834
194 Ga0265331_10029032 3300031250 Bacteria 2763
195 Ga0265327_10019635 3300031251 Bacteria 4146
196 Ga0265327_10067337 3300031251 Bacteria 1804
197 Ga0265316_10025029 3300031344 Bacteria 4986
198 Ga0265314_10017605 3300031711 Bacteria 5602
199 Ga0265314_10027444 3300031711 Bacteria 4262
200 Ga0265342_10057476 3300031712 Bacteria 2302
201 Ga0265342_10069591 3300031712 Bacteria 2054
202 Ga0265342_10111160 3300031712 Bacteria 1551
203 Ga0307407_10228331 3300031903 Bacteria 1263
204 Ga0307412_10069233 3300031911 Bacteria 2402
205 Ga0307416_100195587 3300032002 Bacteria 1912
206 Ga0373945_0037284 3300035116 Bacteria 1744
207 Ga0373931_0046147 3300035691 Bacteria 2303
208 Ga0373937_0005253 3300036401 Bacteria 11057
209 Ga0373937_0418546 3300036401 Bacteria 1272
210 Ga0395899_0001854 3300037312 Bacteria 17497
211 Ga0395899_0002544 3300037312 Bacteria 14764
212 Ga0395899_0044284 3300037312 Bacteria 3317
213 Ga0395899_0144263 3300037312 Bacteria 1692
214 Ga0395900_0021338 3300037418 Bacteria 6620
215 Ga0395900_0070456 3300037418 Bacteria 3594
216 Ga0395900_0158501 3300037418 Bacteria 2310
217 Ga0395900_0211837 3300037418 Bacteria 1956
218 Ga0395898_0007821 3300037466 Bacteria 11348
219 Ga0395898_0009506 3300037466 Bacteria 10206
220 Ga0395898_0021914 3300037466 Bacteria 6472
221 Ga0395898_0024742 3300037466 Bacteria 6053
222 Ga0395898_0055720 3300037466 Bacteria 3856
223 Ga0395898_0096918 3300037466 Bacteria 2833
224 Ga0395898_0201837 3300037466 Bacteria 1898
225 Ga0395905_0004454 3300037471 Bacteria 14561
226 Ga0395905_0009190 3300037471 Bacteria 9677
227 Ga0395905_0028379 3300037471 Bacteria 5276
228 Ga0395905_0062693 3300037471 Bacteria 3477
229 Ga0395905_0182561 3300037471 Bacteria 1970
230 Ga0395905_0200083 3300037471 Bacteria 1873
231 Ga0395901_0007904 3300038443 Bacteria 10729
232 Ga0395901_0017795 3300038443 Bacteria 7252
233 Ga0395901_0029458 3300038443 Bacteria 5653
234 Ga0395901_0041902 3300038443 Bacteria 4746
235 Ga0395901_0101175 3300038443 Bacteria 3024
236 Ga0395901_0104067 3300038443 Bacteria 2979
237 Ga0395901_0134016 3300038443 Bacteria 2603
238 Ga0395901_0135415 3300038443 Bacteria 2589
239 Ga0439440_0013260 3300042993 Bacteria 1764
240 Ga0466969_0012931 3300044656 Bacteria 4396
241 Ga0466972_0043100 3300044658 Bacteria 2192
242 Ga0466965_0059647 3300044683 Bacteria 1905
243 Ga0466966_0063021 3300044684 Bacteria 2337
244 Ga0466966_0087249 3300044684 Bacteria 1939
245 Ga0466961_0005404 3300044693 Bacteria 8047
246 Ga0466961_0019140 3300044693 Bacteria 4405
247 Ga0466961_0050659 3300044693 Bacteria 2652
248 Ga0466963_0000046 3300044694 Bacteria 40452
249 Ga0466963_0000702 3300044694 Bacteria 16334
250 Ga0466963_0001313 3300044694 Bacteria 13223
251 Ga0466963_0003151 3300044694 Bacteria 9360
252 Ga0466963_0003364 3300044694 Bacteria 9131
253 Ga0466963_0004199 3300044694 Bacteria 8348
254 Ga0466963_0004506 3300044694 Bacteria 8106
255 Ga0466963_0009456 3300044694 Bacteria 5870
256 Ga0466963_0013036 3300044694 Bacteria 5096
257 Ga0466963_0013911 3300044694 Bacteria 4954
258 Ga0466963_0020921 3300044694 Bacteria 4121
259 Ga0466963_0035584 3300044694 Bacteria 3245
260 Ga0466963_0045715 3300044694 Bacteria 2884
261 Ga0466963_0051059 3300044694 Bacteria 2740
262 Ga0466963_0061550 3300044694 Bacteria 2509
263 Ga0466963_0083332 3300044694 Bacteria 2169
264 Ga0466963_0132439 3300044694 Bacteria 1723
265 Ga0466963_0156086 3300044694 Bacteria 1586
266 Ga0466964_0012167 3300044706 Bacteria 3254
267 Ga0466971_0001381 3300044719 Bacteria 10181
268 Ga0466971_0009338 3300044719 Bacteria 4286
269 Ga0466971_0100778 3300044719 Bacteria 1327
270 Ga0466971_0139147 3300044719 Unclassified 1130
271 Ga0466968_0001927 3300044735 Bacteria 7511
272 Ga0466968_0011953 3300044735 Bacteria 3390
273 Ga0466968_0012071 3300044735 Bacteria 3374
274 Ga0466968_0012352 3300044735 Bacteria 3342
275 Ga0466968_0022946 3300044735 Bacteria 2539
276 Ga0466970_0003050 3300044765 Bacteria 8127
277 Ga0466970_0027869 3300044765 Bacteria 2966
278 Ga0466957_0001599 3300044842 Bacteria 11892
279 Ga0466957_0004817 3300044842 Bacteria 7554
280 Ga0466957_0008551 3300044842 Bacteria 5825
281 Ga0466957_0008559 3300044842 Bacteria 5823
282 Ga0466957_0057730 3300044842 Bacteria 2376
283 Ga0466960_0015096 3300044901 Bacteria 3325
284 Ga0466960_0029540 3300044901 Bacteria 2516
285 Ga0466959_0001570 3300045049 Bacteria 14073
286 Ga0466959_0002913 3300045049 Bacteria 11034
287 Ga0466959_0004480 3300045049 Bacteria 9358
288 Ga0466959_0157495 3300045049 Bacteria 1598
289 Ga0466959_0302540 3300045049 Bacteria 1095
290 Ga0466958_0001038 3300045836 Bacteria 12693
291 Ga0466958_0011825 3300045836 Bacteria 4927
292 Ga0466958_0012875 3300045836 Bacteria 4748
293 Ga0466958_0022432 3300045836 Bacteria 3698
294 Ga0466958_0032562 3300045836 Bacteria 3102
295 Ga0466967_0000043 3300045976 Bacteria 45343
296 Ga0466967_0000681 3300045976 Bacteria 17225
297 Ga0466967_0001292 3300045976 Bacteria 14262
298 Ga0466967_0004206 3300045976 Bacteria 9648
299 Ga0466967_0006328 3300045976 Bacteria 8360
300 Ga0466967_0011594 3300045976 Bacteria 6690
301 Ga0466967_0019074 3300045976 Bacteria 5505
302 Ga0466967_0020340 3300045976 Bacteria 5362
303 Ga0466967_0020551 3300045976 Bacteria 5341
304 Ga0466967_0027496 3300045976 Bacteria 4733
305 Ga0466967_0029869 3300045976 Bacteria 4567
306 Ga0466967_0038232 3300045976 Bacteria 4114
307 Ga0466967_0084961 3300045976 Bacteria 2864
308 Ga0466967_0093248 3300045976 Bacteria 2739
309 Ga0466967_0159728 3300045976 Bacteria 2114
310 Ga0466967_0177033 3300045976 Bacteria 2009
311 Ga0466967_0304273 3300045976 Bacteria 1534
312 Ga0466967_0335408 3300045976 Bacteria 1461
313 Ga0466967_0392812 3300045976 Unclassified 1348
314 Ga0495592_0001903 3300046454 Bacteria 14720
315 Ga0495592_0130851 3300046454 Bacteria 1755
316 Ga0495629_0005257 3300046459 Bacteria 9680
317 Ga0495651_0081508 3300046462 Bacteria 2442
318 Ga0495651_0104091 3300046462 Bacteria 2108
319 Ga0495653_0008519 3300046463 Bacteria 8410
320 Ga0495653_0020365 3300046463 Bacteria 5379
321 Ga0495582_0054653 3300046473 Bacteria 2201
322 Ga0495664_0006093 3300046477 Bacteria 6656
323 Ga0495664_0070113 3300046477 Bacteria 2093
324 Ga0495608_0022398 3300046511 Bacteria 4331
325 Ga0495628_0005188 3300046516 Bacteria 11441
326 Ga0495652_0145218 3300046529 Bacteria 1861
327 Ga0495640_0084525 3300046533 Bacteria 2105
328 Ga0495587_0012716 3300046536 Bacteria 5294
329 Ga0495645_0053524 3300046543 Bacteria 2933
330 Ga0495645_0071379 3300046543 Bacteria 2504
331 Ga0495667_0004579 3300046559 Bacteria 9345
332 Ga0495667_0098316 3300046559 Bacteria 1895
333 Ga0495634_0011958 3300046642 Bacteria 6297
334 Ga0495599_0015732 3300046678 Bacteria 4695
335 Ga0495599_0141165 3300046678 Bacteria 1494
336 Ga0495623_0024181 3300046679 Bacteria 3918
337 Ga0495646_0038383 3300046680 Bacteria 2958
338 Ga0495647_0012495 3300046681 Bacteria 2926
339 Ga0495613_0014833 3300046689 Bacteria 5783
340 Ga0495613_0163591 3300046689 Bacteria 1582
341 Ga0495613_0259488 3300046689 Bacteria 1211
342 Ga0495624_0015748 3300046690 Bacteria 5098
343 Ga0495600_0017792 3300046809 Bacteria 4524
344 Ga0495600_0022606 3300046809 Bacteria 4039
345 Ga0495600_0214412 3300046809 Unclassified 1233
346 Ga0495604_0089308 3300047317 Bacteria 2291
347 Ga0495604_0173160 3300047317 Bacteria 1516
348 Ga0495680_0007127 3300047322 Bacteria 10296
349 Ga0495680_0052210 3300047322 Bacteria 3188
350 Ga0495684_0057705 3300047471 Bacteria 2958
351 Ga0495684_0158164 3300047471 Bacteria 1692
352 Ga0495684_0343348 3300047471 Bacteria 1062
353 Ga0495602_0025708 3300048088 Bacteria 5692
354 Ga0495602_0132898 3300048088 Bacteria 1982
355 Ga0496100_0025929 3300048903 Bacteria 3588
356 Ga0496100_0136522 3300048903 Unclassified 1733
357 Ga0496101_0035190 3300048904 Bacteria 3541
358 Ga0496101_0089416 3300048904 Bacteria 2289
359 Ga0496101_0455581 3300048904 Bacteria 1009
360 Ga0496102_0035974 3300048905 Bacteria 4459
361 Ga0496102_0099502 3300048905 Bacteria 2699
362 Ga0496103_0023527 3300048906 Bacteria 3716
363 Ga0496103_0056812 3300048906 Bacteria 2430
364 Ga0496103_0076119 3300048906 Bacteria 2105
365 Ga0496104_0029794 3300048907 Bacteria 5065
366 Ga0496104_0037737 3300048907 Bacteria 4517
367 Ga0496104_0101348 3300048907 Bacteria 2757
368 Ga0496104_0378958 3300048907 Bacteria 1327
369 Ga0496105_0052549 3300048908 Bacteria 3365
370 Ga0496105_0070601 3300048908 Bacteria 2887
371 Ga0496105_0152259 3300048908 Bacteria 1900
372 Ga0496106_0009131 3300048909 Bacteria 7327
373 Ga0496106_0011764 3300048909 Bacteria 6459
374 Ga0496107_0003956 3300048910 Bacteria 9970
375 Ga0496107_0028668 3300048910 Bacteria 3957
376 Ga0496107_0201078 3300048910 Unclassified 1481
377 Ga0496108_0016309 3300048911 Bacteria 6059
378 Ga0496108_0025391 3300048911 Bacteria 4882
379 Ga0496109_0017919 3300048912 Bacteria 6216
380 Ga0496109_0038166 3300048912 Bacteria 4341
381 Ga0496109_0079151 3300048912 Bacteria 3027
382 Ga0496109_0187972 3300048912 Bacteria 1940
383 Ga0496110_0186283 3300048913 Bacteria 1885
384 Ga0496111_0076244 3300048914 Bacteria 2444
385 Ga0496111_0204741 3300048914 Bacteria 1466
386 Ga0496112_0011560 3300048915 Bacteria 8066
387 Ga0496112_0024061 3300048915 Bacteria 5828
388 Ga0496112_0028782 3300048915 Bacteria 5366
389 Ga0496112_0039595 3300048915 Bacteria 4607
390 Ga0496112_0161642 3300048915 Bacteria 2206
391 Ga0496112_0440229 3300048915 Unclassified 1241
392 Ga0496113_0017625 3300048916 Bacteria 4962
393 Ga0496113_0038752 3300048916 Bacteria 3505
394 Ga0496113_0051170 3300048916 Bacteria 3082
395 Ga0496113_0094915 3300048916 Bacteria 2305
396 Ga0496114_0142977 3300048917 Bacteria 2073
397 Ga0496114_0189874 3300048917 Bacteria 1797
398 Ga0496115_0032127 3300048918 Bacteria 4140
399 Ga0501034_0009663 3300049571 Bacteria 10088
400 Ga0501047_0190459 3300049581 Bacteria 1915
401 Ga0501069_0025791 3300049585 Bacteria 3214
402 Ga0501069_0087921 3300049585 Bacteria 1756
403 Ga0501070_0012113 3300049586 Bacteria 7279
404 Ga0501072_0005382 3300049588 Bacteria 9743
405 Ga0501073_0064760 3300049589 Bacteria 2549
406 Ga0501074_0005034 3300049590 Bacteria 9482
407 Ga0501079_0006203 3300049741 Bacteria 8970
408 Ga0501080_0034208 3300049742 Bacteria 4742
409 Ga0501083_0009873 3300049744 Bacteria 6740
410 nmdc:mga05p37_73830_c1 3300050507 Bacteria 4198
411 nmdc:mga09592_108657_c1 3300050508 Bacteria 2379
412 nmdc:mga06r32_327979_c1 3300050510 Bacteria 1516
413 nmdc:mga08y16_160498_c1 3300050511 Bacteria 2336
414 nmdc:mga08y16_61893_c1 3300050511 Bacteria 3909
415 nmdc:mga0n895_58298_c1 3300050512 Bacteria 3807
416 nmdc:mga08x19_282168_c1 3300050514 Bacteria 1151
417 Ga0495601_0033655 3300053077 Bacteria 3193
418 Ga0495612_0018405 3300053078 Bacteria 2798
419 Ga0495595_0008566 3300053084 Bacteria 4204
420 Ga0495595_0068729 3300053084 Bacteria 1671
421 Ga0495619_0022331 3300053085 Bacteria 4048
422 Ga0495619_0129968 3300053085 Bacteria 1730
423 Ga0466962_0001894 3300061719 Bacteria 9847
424 Ga0466962_0005848 3300061719 Bacteria 5910
425 Ga0466962_0097010 3300061719 Bacteria 1414
426 Ga0070683_100042768
427 rootH2_10171436
428 Ga0070658_10036992
429 Ga0070658_10055488
430 Ga0070658_10140618
431 Ga0070680_100022428
432 Ga0070680_100045638
433 Ga0070682_100033555
434 Ga0070682_100151679
435 Ga0070682_100266655
436 Ga0070660_100014624
437 Ga0070660_100015413
438 Ga0070660_100016446
439 Ga0070660_100023225
440 Ga0070660_100190806
441 Ga0070660_100311968
442 Ga0070661_100002256
443 Ga0070661_100252501
444 Ga0070671_100316629
445 Ga0070659_100095611
446 Ga0070709_10016593
447 Ga0070709_10097829
448 Ga0070709_10103465
449 Ga0070714_100013500
450 Ga0070714_100033583
451 Ga0070714_100051319
452 Ga0070714_100069729
453 Ga0070714_100093595
454 Ga0070714_100183153
455 Ga0070714_100272468
456 Ga0070713_100012896
457 Ga0070713_100033219
458 Ga0070713_100062388
459 Ga0070713_100100388
460 Ga0070710_10054881
461 Ga0070711_100026451
462 Ga0070711_100027840
463 Ga0070711_100141264
464 Ga0070681_10015981
465 Ga0070681_10035382
466 Ga0070681_10042138
467 Ga0070681_10063530
468 Ga0070681_10082837
469 Ga0070681_10236312
470 Ga0070706_100152931
471 Ga0070707_100003577
472 Ga0070698_100036439
473 Ga0070698_100170870
474 Ga0070698_100176547
475 Ga0070698_100295554
476 Ga0070679_100033052
477 Ga0070679_100108155
478 Ga0070684_100009303
479 Ga0070684_100009575
480 Ga0070684_100087540
481 Ga0070684_100140026
482 Ga0070684_100155398
483 Ga0070695_100000670
484 Ga0070693_100081909
485 Ga0068855_100049669
486 Ga0068855_100112447
487 Ga0068855_100396251
488 Ga0070664_100217698
489 Ga0068856_100186943
490 Ga0081455_10004511
491 Ga0081455_10005352
492 Ga0081455_10018827
493 Ga0081539_10002541
494 Ga0070717_10018633
495 Ga0070717_10018777
496 Ga0070717_10031485
497 Ga0070717_10032568
498 Ga0075432_10003526
499 Ga0070715_10084501
500 Ga0070716_100183928
501 Ga0070716_100225087
502 Ga0070712_100021245
503 Ga0070712_100027155
504 Ga0075428_100042491
505 Ga0075431_100070432
506 Ga0075434_100133527
507 Ga0075434_100212931
508 Ga0075429_100146201
509 Ga0075436_100141320
510 Ga0075435_100130302
511 Ga0105240_10085718
512 Ga0105240_10096690
513 Ga0105240_10172747
514 Ga0105240_10212322
515 Ga0105240_10785854
516 Ga0111539_10036627
517 Ga0111539_10168331
518 Ga0105245_10034848
519 Ga0114129_10067221
520 Ga0105237_10020096
521 Ga0105238_10047235
522 Ga0105238_10096783
523 Ga0157371_10244667
524 Ga0157370_10012865
525 Ga0157370_10021515
526 Ga0157370_10075634
527 Ga0157369_10008041
528 Ga0157369_10018488
529 Ga0157369_10036209
530 Ga0157369_10175745
531 Ga0157372_10097837
532 Ga0157372_10267185
533 Ga0157372_10481565
534 Ga0182008_10040008
535 Ga0182008_10040120
536 Ga0206356_10266076
537 Ga0206356_11907936
538 Ga0207692_10035270
539 Ga0207692_10065811
540 Ga0207699_10078093
541 Ga0207699_10091766
542 Ga0207699_10181774
543 Ga0207699_10193886
544 Ga0207705_10026659
545 Ga0207707_10017295
546 Ga0207707_10031160
547 Ga0207707_10037056
548 Ga0207707_10204614
549 Ga0207707_10414824
550 Ga0207695_10015652
551 Ga0207695_10089272
552 Ga0207695_10121922
553 Ga0207671_10018650
554 Ga0207693_10031085
555 Ga0207693_10044381
556 Ga0207663_10059814
557 Ga0207663_10071202
558 Ga0207663_10104702
559 Ga0207660_10058148
560 Ga0207660_10072550
561 Ga0207657_10002003
562 Ga0207657_10009290
563 Ga0207657_10018203
564 Ga0207657_10026670
565 Ga0207649_10062381
566 Ga0207649_10212639
567 Ga0207652_10019733
568 Ga0207652_10074924
569 Ga0207646_10000785
570 Ga0207646_10278189
571 Ga0207694_10104540
572 Ga0207687_10059711
573 Ga0207700_10000012
574 Ga0207700_10002676
575 Ga0207700_10011526
576 Ga0207700_10089261
577 Ga0207700_10110637
578 Ga0207664_10003292
579 Ga0207664_10008805
580 Ga0207664_10028107
581 Ga0207664_10079986
582 Ga0207664_10093247
583 Ga0207664_10173507
584 Ga0207644_10357499
585 Ga0207665_10001126
586 Ga0207661_10031054
587 Ga0207667_10085766
588 Ga0207667_10414309
589 Ga0207702_10201583
590 Ga0207428_10002858
591 Ga0207428_10096612
592 Ga0265319_1000985
593 Ga0265319_1004406
594 Ga0265319_1009282
595 Ga0265319_1032005
596 Ga0265318_10000633
597 Ga0265336_10010681
598 Ga0265338_10000811
599 Ga0265338_10011482
600 Ga0265338_10013126
601 Ga0265338_10017139
602 Ga0265338_10042877
603 Ga0265338_10093357
604 Ga0265324_10039587
605 Ga0265330_10002570
606 Ga0265330_10020045
607 Ga0265332_10014143
608 Ga0265332_10080095
609 Ga0265320_10028528
610 Ga0265320_10055106
611 Ga0265320_10100341
612 Ga0265325_10006204
613 Ga0265329_10005681
614 Ga0265329_10005871
615 Ga0265340_10011167
616 Ga0265339_10025872
617 Ga0265339_10040100
618 Ga0265331_10008506
619 Ga0265331_10029032
620 Ga0265327_10019635
621 Ga0265327_10067337
622 Ga0265316_10025029
623 Ga0265314_10017605
624 Ga0265314_10027444
625 Ga0265342_10057476
626 Ga0265342_10069591
627 Ga0265342_10111160
628 Ga0307407_10228331
629 Ga0307412_10069233
630 Ga0307416_100195587
631 Ga0373945_0037284
632 Ga0373931_0046147
633 Ga0373937_0005253
634 Ga0373937_0418546
635 Ga0395899_0001854
636 Ga0395899_0002544
637 Ga0395899_0044284
638 Ga0395899_0144263
639 Ga0395900_0021338
640 Ga0395900_0070456
641 Ga0395900_0158501
642 Ga0395900_0211837
643 Ga0395898_0007821
644 Ga0395898_0009506
645 Ga0395898_0021914
646 Ga0395898_0024742
647 Ga0395898_0055720
648 Ga0395898_0096918
649 Ga0395898_0201837
650 Ga0395905_0004454
651 Ga0395905_0009190
652 Ga0395905_0028379
653 Ga0395905_0062693
654 Ga0395905_0182561
655 Ga0395905_0200083
656 Ga0395901_0007904
657 Ga0395901_0017795
658 Ga0395901_0029458
659 Ga0395901_0041902
660 Ga0395901_0101175
661 Ga0395901_0104067
662 Ga0395901_0134016
663 Ga0395901_0135415
664 Ga0439440_0013260
665 Ga0466969_0012931
666 Ga0466972_0043100
667 Ga0466965_0059647
668 Ga0466966_0063021
669 Ga0466966_0087249
670 Ga0466961_0005404
671 Ga0466961_0019140
672 Ga0466961_0050659
673 Ga0466963_0000046
674 Ga0466963_0000702
675 Ga0466963_0001313
676 Ga0466963_0003151
677 Ga0466963_0003364
678 Ga0466963_0004199
679 Ga0466963_0004506
680 Ga0466963_0009456
681 Ga0466963_0013036
682 Ga0466963_0013911
683 Ga0466963_0020921
684 Ga0466963_0035584
685 Ga0466963_0045715
686 Ga0466963_0051059
687 Ga0466963_0061550
688 Ga0466963_0083332
689 Ga0466963_0132439
690 Ga0466963_0156086
691 Ga0466964_0012167
692 Ga0466971_0001381
693 Ga0466971_0009338
694 Ga0466971_0100778
695 Ga0466971_0139147
696 Ga0466968_0001927
697 Ga0466968_0011953
698 Ga0466968_0012071
699 Ga0466968_0012352
700 Ga0466968_0022946
701 Ga0466970_0003050
702 Ga0466970_0027869
703 Ga0466957_0001599
704 Ga0466957_0004817
705 Ga0466957_0008551
706 Ga0466957_0008559
707 Ga0466957_0057730
708 Ga0466960_0015096
709 Ga0466960_0029540
710 Ga0466959_0001570
711 Ga0466959_0002913
712 Ga0466959_0004480
713 Ga0466959_0157495
714 Ga0466959_0302540
715 Ga0466958_0001038
716 Ga0466958_0011825
717 Ga0466958_0012875
718 Ga0466958_0022432
719 Ga0466958_0032562
720 Ga0466967_0000043
721 Ga0466967_0000681
722 Ga0466967_0001292
723 Ga0466967_0004206
724 Ga0466967_0006328
725 Ga0466967_0011594
726 Ga0466967_0019074
727 Ga0466967_0020340
728 Ga0466967_0020551
729 Ga0466967_0027496
730 Ga0466967_0029869
731 Ga0466967_0038232
732 Ga0466967_0084961
733 Ga0466967_0093248
734 Ga0466967_0159728
735 Ga0466967_0177033
736 Ga0466967_0304273
737 Ga0466967_0335408
738 Ga0466967_0392812
739 Ga0495592_0001903
740 Ga0495592_0130851
741 Ga0495629_0005257
742 Ga0495651_0081508
743 Ga0495651_0104091
744 Ga0495653_0008519
745 Ga0495653_0020365
746 Ga0495582_0054653
747 Ga0495664_0006093
748 Ga0495664_0070113
749 Ga0495608_0022398
750 Ga0495628_0005188
751 Ga0495652_0145218
752 Ga0495640_0084525
753 Ga0495587_0012716
754 Ga0495645_0053524
755 Ga0495645_0071379
756 Ga0495667_0004579
757 Ga0495667_0098316
758 Ga0495634_0011958
759 Ga0495599_0015732
760 Ga0495599_0141165
761 Ga0495623_0024181
762 Ga0495646_0038383
763 Ga0495647_0012495
764 Ga0495613_0014833
765 Ga0495613_0163591
766 Ga0495613_0259488
767 Ga0495624_0015748
768 Ga0495600_0017792
769 Ga0495600_0022606
770 Ga0495600_0214412
771 Ga0495604_0089308
772 Ga0495604_0173160
773 Ga0495680_0007127
774 Ga0495680_0052210
775 Ga0495684_0057705
776 Ga0495684_0158164
777 Ga0495684_0343348
778 Ga0495602_0025708
779 Ga0495602_0132898
780 Ga0496100_0025929
781 Ga0496100_0136522
782 Ga0496101_0035190
783 Ga0496101_0089416
784 Ga0496101_0455581
785 Ga0496102_0035974
786 Ga0496102_0099502
787 Ga0496103_0023527
788 Ga0496103_0056812
789 Ga0496103_0076119
790 Ga0496104_0029794
791 Ga0496104_0037737
792 Ga0496104_0101348
793 Ga0496104_0378958
794 Ga0496105_0052549
795 Ga0496105_0070601
796 Ga0496105_0152259
797 Ga0496106_0009131
798 Ga0496106_0011764
799 Ga0496107_0003956
800 Ga0496107_0028668
801 Ga0496107_0201078
802 Ga0496108_0016309
803 Ga0496108_0025391
804 Ga0496109_0017919
805 Ga0496109_0038166
806 Ga0496109_0079151
807 Ga0496109_0187972
808 Ga0496110_0186283
809 Ga0496111_0076244
810 Ga0496111_0204741
811 Ga0496112_0011560
812 Ga0496112_0024061
813 Ga0496112_0028782
814 Ga0496112_0039595
815 Ga0496112_0161642
816 Ga0496112_0440229
817 Ga0496113_0017625
818 Ga0496113_0038752
819 Ga0496113_0051170
820 Ga0496113_0094915
821 Ga0496114_0142977
822 Ga0496114_0189874
823 Ga0496115_0032127
824 Ga0501034_0009663
825 Ga0501047_0190459
826 Ga0501069_0025791
827 Ga0501069_0087921
828 Ga0501070_0012113
829 Ga0501072_0005382
830 Ga0501073_0064760
831 Ga0501074_0005034
832 Ga0501079_0006203
833 Ga0501080_0034208
834 Ga0501083_0009873
835 nmdc:mga05p37_73830_c1
836 nmdc:mga09592_108657_c1
837 nmdc:mga06r32_327979_c1
838 nmdc:mga08y16_160498_c1
839 nmdc:mga08y16_61893_c1
840 nmdc:mga0n895_58298_c1
841 nmdc:mga08x19_282168_c1
842 Ga0495601_0033655
843 Ga0495612_0018405
844 Ga0495595_0008566
845 Ga0495595_0068729
846 Ga0495619_0022331
847 Ga0495619_0129968
848 Ga0466962_0001894
849 Ga0466962_0005848
850 Ga0466962_0097010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

99

320

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.7836 83 301
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7816 82 301
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7728 85 301
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.7448 84 301
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.7271 27 300
ID Description Score Start End Superfamily
af_P0AGH8_17_311_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.962 26 301 1.10.3720.10
af_Q58420_16_310_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9459 28 301 1.10.3720.10
af_P9WG07_21_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9268 34 301 1.10.3720.10
af_P0AGH8_17_311_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8987 26 301 1.10.3720.10
af_P9WG05_32_321_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8883 34 301 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7V3W915-F1-model_v4 Phosphate transport system permease protein 0.9684 21 301 GO:0005315
GO:0005886
GO:0006817
AF-A0A162UGF4-F1-model_v4 Phosphate transport system permease protein 0.9671 21 301 GO:0005315
GO:0005886
GO:0006817
AF-A0A101XSD8-F1-model_v4 Phosphate transport system permease protein 0.9661 21 301 GO:0005315
GO:0005886
GO:0006817
AF-A0A2V9ZE21-F1-model_v4 Phosphate transport system permease protein 0.9633 70 301 GO:0005315
GO:0005886
GO:0006817
AF-A0A2J6XUE2-F1-model_v4 Phosphate transport system permease protein 0.9626 22 301 GO:0005315
GO:0005886
GO:0006817

Map