F440856

General Info

Members Datasets Scaffolds Average Seq Length
424 231 848 76

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0341192|Ga0501040_0341192_549_818
Length 89
Sequence MEESPVRSIVSVLMEVKIGVVHTPKELTLDVEGTPDEVSAAVDQALANDDAVLWLTDSKGRRIGVPSERLAYVEIETDHGAKRVGFGPG

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
128 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
129 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
130 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
131 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
132 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
133 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
134 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
135 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
136 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
137 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
138 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
139 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
140 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
141 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
142 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
143 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
154 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
155 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.12
Nodule 0
Rhizoplane 7.55
Rhizosphere 88.68
Stem 0
Stem Tuber 0
Unclassified 16.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0341192 3300049576 Bacteria 1073
2 JGI25407J50210_10070867 3300003373 Bacteria 870
3 JGI25407J50210_10158356 3300003373 Bacteria 557
4 Ga0068869_100203205 3300005334 Unclassified 1563
5 Ga0070666_10546929 3300005335 Bacteria 842
6 Ga0068868_101876476 3300005338 Bacteria 567
7 Ga0070687_100440479 3300005343 Unclassified 864
8 Ga0070668_100167546 3300005347 Bacteria 1786
9 Ga0070674_100693701 3300005356 Bacteria 870
10 Ga0070703_10018255 3300005406 Bacteria 2026
11 Ga0070709_11078554 3300005434 Bacteria 642
12 Ga0070714_102237347 3300005435 Unclassified 532
13 Ga0070713_100627841 3300005436 Unclassified 1022
14 Ga0070711_101380964 3300005439 Bacteria 613
15 Ga0070705_101436037 3300005440 Unclassified 576
16 Ga0070700_100927742 3300005441 Unclassified 711
17 Ga0070694_100660876 3300005444 Unclassified 847
18 Ga0070708_102244125 3300005445 Unclassified 504
19 Ga0070663_101726152 3300005455 Unclassified 560
20 Ga0068867_100197958 3300005459 Bacteria 1607
21 Ga0068867_101105010 3300005459 Unclassified 724
22 Ga0070707_102302523 3300005468 Bacteria 506
23 Ga0070679_101045967 3300005530 Bacteria 761
24 Ga0068853_101617551 3300005539 Bacteria 628
25 Ga0070686_100513454 3300005544 Bacteria 932
26 Ga0070686_101260683 3300005544 Unclassified 616
27 Ga0070695_101316449 3300005545 Bacteria 597
28 Ga0070696_100458593 3300005546 Unclassified 1007
29 Ga0070696_100963377 3300005546 Bacteria 711
30 Ga0070665_100628625 3300005548 Bacteria 1087
31 Ga0068855_100257465 3300005563 Bacteria 1945
32 Ga0068854_101940344 3300005578 Unclassified 542
33 Ga0068856_102023536 3300005614 Bacteria 586
34 Ga0070702_101895742 3300005615 Unclassified 500
35 Ga0068852_101481415 3300005616 Bacteria 701
36 Ga0068859_100964012 3300005617 Bacteria 936
37 Ga0068861_100019353 3300005719 Bacteria 4863
38 Ga0068870_10167954 3300005840 Bacteria 1307
39 Ga0068863_102723985 3300005841 Bacteria 503
40 Ga0068858_101320699 3300005842 Bacteria 710
41 Ga0068860_100646718 3300005843 Bacteria 1065
42 Ga0068860_100932771 3300005843 Bacteria 885
43 Ga0068860_102813386 3300005843 Bacteria 504
44 Ga0068862_101194254 3300005844 Unclassified 759
45 Ga0081455_10018909 3300005937 Bacteria 6537
46 Ga0081455_10059823 3300005937 Bacteria 3215
47 Ga0081538_10004200 3300005981 Bacteria 13360
48 Ga0081538_10004226 3300005981 Bacteria 13320
49 Ga0081538_10007135 3300005981 Bacteria 9704
50 Ga0081538_10008358 3300005981 Bacteria 8807
51 Ga0081538_10016199 3300005981 Bacteria 5729
52 Ga0081538_10033156 3300005981 Bacteria 3444
53 Ga0081538_10065718 3300005981 Bacteria 2040
54 Ga0081538_10066048 3300005981 Bacteria 2032
55 Ga0081539_10008062 3300005985 Bacteria 9327
56 Ga0081539_10036182 3300005985 Bacteria 2958
57 Ga0081539_10102165 3300005985 Bacteria 1459
58 Ga0075363_100007432 3300006048 Bacteria 5036
59 Ga0075362_10155218 3300006177 Bacteria 1100
60 Ga0075367_10489603 3300006178 Unclassified 780
61 Ga0075370_10277915 3300006353 Bacteria 995
62 Ga0075370_10281044 3300006353 Bacteria 989
63 Ga0075428_100081139 3300006844 Bacteria 3540
64 Ga0075428_100650951 3300006844 Bacteria 1124
65 Ga0075430_100007122 3300006846 Bacteria 9432
66 Ga0075430_100401240 3300006846 Bacteria 1132
67 Ga0075430_100456688 3300006846 Bacteria 1054
68 Ga0075431_100044110 3300006847 Bacteria 4599
69 Ga0075431_100469772 3300006847 Bacteria 1252
70 Ga0075431_100571338 3300006847 Bacteria 1117
71 Ga0075433_10060371 3300006852 Bacteria 3319
72 Ga0075433_10109623 3300006852 Bacteria 2449
73 Ga0075434_100070336 3300006871 Bacteria 3490
74 Ga0075434_100185215 3300006871 Bacteria 2102
75 Ga0075429_100006360 3300006880 Bacteria 10219
76 Ga0075429_100276380 3300006880 Bacteria 1471
77 Ga0097620_100964099 3300006931 Bacteria 936
78 Ga0075435_100175662 3300007076 Unclassified 1809
79 Ga0075435_100627782 3300007076 Bacteria 932
80 Ga0075435_101751384 3300007076 Bacteria 545
81 Ga0105240_11306595 3300009093 Unclassified 765
82 Ga0105240_12254572 3300009093 Unclassified 564
83 Ga0111539_10028896 3300009094 Bacteria 6760
84 Ga0111539_10845188 3300009094 Bacteria 1065
85 Ga0111539_11245705 3300009094 Bacteria 864
86 Ga0105245_10050394 3300009098 Bacteria 3731
87 Ga0105245_11434541 3300009098 Bacteria 741
88 Ga0105245_12057672 3300009098 Unclassified 624
89 Ga0114129_10046447 3300009147 Bacteria 6103
90 Ga0114129_10177699 3300009147 Bacteria 2898
91 Ga0114129_10334358 3300009147 Bacteria 2010
92 Ga0114129_10432734 3300009147 Bacteria 1728
93 Ga0114129_10484229 3300009147 Bacteria 1618
94 Ga0114129_11003753 3300009147 Bacteria 1051
95 Ga0114129_11594130 3300009147 Bacteria 799
96 Ga0114129_13396529 3300009147 Bacteria 512
97 Ga0105243_11906527 3300009148 Bacteria 627
98 Ga0105241_12229120 3300009174 Bacteria 544
99 Ga0105241_12608024 3300009174 Bacteria 508
100 Ga0105242_10147884 3300009176 Bacteria 2045
101 Ga0105242_10411207 3300009176 Bacteria 1265
102 Ga0105248_11874001 3300009177 Unclassified 680
103 Ga0105249_10027368 3300009553 Bacteria 5143
104 Ga0105249_10662317 3300009553 Bacteria 1102
105 Ga0105239_10379689 3300010375 Bacteria 1597
106 Ga0105239_12547900 3300010375 Bacteria 596
107 Ga0105246_11013441 3300011119 Bacteria 752
108 Ga0105246_11237846 3300011119 Unclassified 689
109 Ga0157378_10542516 3300013297 Unclassified 1167
110 Ga0163162_10019724 3300013306 Bacteria 6620
111 Ga0163162_12693232 3300013306 Bacteria 572
112 Ga0157372_10637490 3300013307 Bacteria 1241
113 Ga0157375_12622438 3300013308 Bacteria 602
114 Ga0163163_12181793 3300014325 Viruses 613
115 Ga0157380_11191619 3300014326 Unclassified 805
116 Ga0182008_10321257 3300014497 Bacteria 815
117 Ga0157379_10244852 3300014968 Bacteria 1627
118 Ga0157379_10922605 3300014968 Bacteria 829
119 Ga0213876_10341093 3300021384 Bacteria 797
120 Ga0213876_10419023 3300021384 Bacteria 712
121 Ga0207643_10916961 3300025908 Bacteria 568
122 Ga0207707_10205479 3300025912 Unclassified 1717
123 Ga0207663_10398697 3300025916 Bacteria 1052
124 Ga0207662_10250591 3300025918 Bacteria 1162
125 Ga0207652_11000868 3300025921 Bacteria 735
126 Ga0207646_11739535 3300025922 Bacteria 535
127 Ga0207650_10459534 3300025925 Bacteria 1060
128 Ga0207650_10971912 3300025925 Unclassified 722
129 Ga0207687_10091313 3300025927 Bacteria 2221
130 Ga0207687_11455519 3300025927 Bacteria 589
131 Ga0207687_11550348 3300025927 Bacteria 569
132 Ga0207700_10377104 3300025928 Bacteria 1240
133 Ga0207664_11443602 3300025929 Unclassified 609
134 Ga0207690_11625615 3300025932 Bacteria 540
135 Ga0207706_10005442 3300025933 Bacteria 11862
136 Ga0207686_10056211 3300025934 Bacteria 2473
137 Ga0207691_11638475 3300025940 Bacteria 522
138 Ga0207661_10634391 3300025944 Bacteria 982
139 Ga0207712_10259882 3300025961 Bacteria 1408
140 Ga0207712_11239561 3300025961 Bacteria 666
141 Ga0207703_12084300 3300026035 Unclassified 543
142 Ga0207639_10686966 3300026041 Unclassified 949
143 Ga0207708_10205114 3300026075 Unclassified 1574
144 Ga0207702_12185057 3300026078 Bacteria 542
145 Ga0207648_10207315 3300026089 Bacteria 1739
146 Ga0207648_10211778 3300026089 Bacteria 1721
147 Ga0207648_11236870 3300026089 Unclassified 701
148 Ga0207676_11252267 3300026095 Bacteria 736
149 Ga0207675_100002608 3300026118 Bacteria 17843
150 Ga0207675_102133423 3300026118 Unclassified 576
151 Ga0207683_10407725 3300026121 Bacteria 1251
152 Ga0207428_10005998 3300027907 Bacteria 11252
153 Ga0207428_10310321 3300027907 Unclassified 1166
154 Ga0268266_10384823 3300028379 Bacteria 1324
155 Ga0268265_10112287 3300028380 Bacteria 2228
156 Ga0268265_11818676 3300028380 Unclassified 616
157 Ga0268264_11189895 3300028381 Bacteria 771
158 Ga0268264_11311265 3300028381 Bacteria 734
159 Ga0265318_10067191 3300028577 Bacteria 1331
160 Ga0265318_10167576 3300028577 Bacteria 805
161 Ga0265338_10352192 3300028800 Bacteria 1058
162 Ga0265330_10460616 3300031235 Bacteria 540
163 Ga0307408_100067105 3300031548 Bacteria 2637
164 Ga0307408_100179291 3300031548 Bacteria 1698
165 Ga0307408_100621633 3300031548 Unclassified 962
166 Ga0307408_100715321 3300031548 Bacteria 901
167 Ga0307405_10017136 3300031731 Bacteria 3968
168 Ga0307405_10158904 3300031731 Bacteria 1598
169 Ga0307405_10557369 3300031731 Unclassified 928
170 Ga0307405_10640369 3300031731 Archaea 873
171 Ga0307405_11189468 3300031731 Bacteria 659
172 Ga0307413_10175186 3300031824 Bacteria 1523
173 Ga0307413_10773476 3300031824 Bacteria 804
174 Ga0307413_10995784 3300031824 Unclassified 718
175 Ga0307413_12151547 3300031824 Bacteria 505
176 Ga0307410_10012482 3300031852 Bacteria 4917
177 Ga0307410_10047157 3300031852 Bacteria 2878
178 Ga0307410_10194787 3300031852 Bacteria 1543
179 Ga0307410_10479089 3300031852 Bacteria 1020
180 Ga0307406_10032374 3300031901 Bacteria 3191
181 Ga0307406_10166614 3300031901 Bacteria 1590
182 Ga0307406_10180565 3300031901 Unclassified 1536
183 Ga0307406_10213102 3300031901 Bacteria 1430
184 Ga0307406_11283811 3300031901 Bacteria 638
185 Ga0307407_10015908 3300031903 Bacteria 3732
186 Ga0307407_10021865 3300031903 Bacteria 3307
187 Ga0307407_10222017 3300031903 Bacteria 1278
188 Ga0307407_10828823 3300031903 Bacteria 705
189 Ga0307412_10026220 3300031911 Bacteria 3620
190 Ga0307412_10540887 3300031911 Bacteria 977
191 Ga0307412_11764797 3300031911 Bacteria 568
192 Ga0307409_100003997 3300031995 Bacteria 8178
193 Ga0307409_100008453 3300031995 Bacteria 6250
194 Ga0307409_100037034 3300031995 Bacteria 3592
195 Ga0307409_100461244 3300031995 Bacteria 1228
196 Ga0307409_100596005 3300031995 Bacteria 1091
197 Ga0307409_100812715 3300031995 Bacteria 943
198 Ga0307409_101034769 3300031995 Bacteria 840
199 Ga0307409_101562988 3300031995 Bacteria 687
200 Ga0307416_100005376 3300032002 Bacteria 7862
201 Ga0307416_100006777 3300032002 Bacteria 7203
202 Ga0307416_100027054 3300032002 Bacteria 4239
203 Ga0307416_100138563 3300032002 Bacteria 2206
204 Ga0307416_101091498 3300032002 Bacteria 902
205 Ga0307416_102124607 3300032002 Bacteria 663
206 Ga0307414_10018858 3300032004 Bacteria 4261
207 Ga0307414_11579221 3300032004 Bacteria 611
208 Ga0307411_10090750 3300032005 Bacteria 2132
209 Ga0307411_10202944 3300032005 Bacteria 1524
210 Ga0307415_100002318 3300032126 Bacteria 9454
211 Ga0307415_100047981 3300032126 Bacteria 2878
212 Ga0307415_100130479 3300032126 Bacteria 1901
213 Ga0307415_100537004 3300032126 Bacteria 1029
214 Ga0307415_101154891 3300032126 Bacteria 727
215 Ga0307415_101307595 3300032126 Unclassified 687
216 Ga0307415_101413494 3300032126 Bacteria 663
217 Ga0373923_0675888 3300035111 Bacteria 512
218 Ga0373936_0437646 3300035113 Bacteria 603
219 Ga0373931_1006048 3300035691 Archaea 564
220 Ga0373947_0347540 3300035725 Unclassified 995
221 Ga0395899_0484332 3300037312 Unclassified 805
222 Ga0395900_0093068 3300037418 Bacteria 3097
223 Ga0395900_0838530 3300037418 Unclassified 845
224 Ga0395900_1448953 3300037418 Viruses 599
225 Ga0395900_1460233 3300037418 Bacteria 596
226 Ga0395905_0219108 3300037471 Bacteria 1781
227 Ga0395905_1069478 3300037471 Viruses 710
228 Ga0395905_1078388 3300037471 Bacteria 706
229 Ga0395901_0098980 3300038443 Bacteria 3057
230 Ga0395901_0101114 3300038443 Bacteria 3025
231 Ga0395901_0325421 3300038443 Bacteria 1590
232 Ga0395901_0650385 3300038443 Bacteria 1057
233 Ga0395901_0676437 3300038443 Bacteria 1032
234 Ga0395901_1250686 3300038443 Viruses 706
235 Ga0436365_0780018 3300039437 Bacteria 2079
236 Ga0436365_0908806 3300039437 Bacteria 1651
237 Ga0436365_0959802 3300039437 Bacteria 4899
238 Ga0436363_1082935 3300039450 Unclassified 931
239 Ga0451797_0307944 3300041453 Bacteria 523
240 Ga0451841_1034010 3300041498 Unclassified 1146
241 Ga0439448_0030554 3300042005 Bacteria 1709
242 Ga0439448_0212363 3300042005 Bacteria 679
243 Ga0439451_032149 3300042009 Bacteria 1055
244 Ga0439454_006731 3300042011 Unclassified 1423
245 Ga0439454_085155 3300042011 Bacteria 578
246 Ga0439456_003928 3300042013 Bacteria 3020
247 Ga0439463_002259 3300042016 Bacteria 4936
248 Ga0439463_008291 3300042016 Bacteria 2561
249 Ga0450914_008465 3300042118 Bacteria 953
250 Ga0450915_014226 3300042119 Unclassified 590
251 Ga0450888_014761 3300042126 Bacteria 948
252 Ga0439444_0072375 3300042437 Unclassified 740
253 Ga0439464_0001560 3300042439 Bacteria 5435
254 Ga0439460_0016599 3300042461 Bacteria 1963
255 Ga0439460_0055284 3300042461 Bacteria 1199
256 Ga0439460_0100643 3300042461 Bacteria 928
257 Ga0439460_0132780 3300042461 Bacteria 822
258 Ga0450916_073824 3300042530 Unclassified 573
259 Ga0450918_131106 3300042531 Bacteria 507
260 Ga0450893_0066814 3300042532 Bacteria 694
261 Ga0439440_0017964 3300042993 Bacteria 1562
262 Ga0439440_0062333 3300042993 Bacteria 954
263 Ga0466967_0575599 3300045976 Bacteria 1110
264 Ga0466967_1097099 3300045976 Bacteria 793
265 Ga0495590_0238313 3300046457 Bacteria 675
266 Ga0495629_0282630 3300046459 Unclassified 1138
267 Ga0495582_0070089 3300046473 Bacteria 1939
268 Ga0495605_0110497 3300046474 Bacteria 1255
269 Ga0495607_0171816 3300046501 Bacteria 1094
270 Ga0495608_0477421 3300046511 Bacteria 757
271 Ga0495616_0109604 3300046513 Bacteria 1284
272 Ga0495618_0197509 3300046514 Bacteria 1274
273 Ga0495631_0076378 3300046518 Bacteria 1446
274 Ga0495631_0255888 3300046518 Bacteria 746
275 Ga0495644_0181880 3300046523 Bacteria 808
276 Ga0495663_0062874 3300046525 Bacteria 1170
277 Ga0495642_0138469 3300046528 Bacteria 1050
278 Ga0495652_1074003 3300046529 Bacteria 524
279 Ga0495621_0537249 3300046539 Unclassified 507
280 Ga0495633_0233137 3300046558 Bacteria 841
281 Ga0495656_0136148 3300046615 Bacteria 1173
282 Ga0495634_0273731 3300046642 Bacteria 1027
283 Ga0495634_0632096 3300046642 Unclassified 619
284 Ga0495659_0124755 3300046664 Bacteria 1017
285 Ga0495647_0605414 3300046681 Unclassified 514
286 Ga0495671_0148287 3300046692 Bacteria 1142
287 Ga0495589_0140079 3300046794 Bacteria 1159
288 Ga0495636_0115912 3300047318 Bacteria 1182
289 Ga0495674_1127696 3300047319 Unclassified 596
290 Ga0495674_1357937 3300047319 Bacteria 531
291 Ga0495676_0049871 3300047321 Bacteria 3362
292 Ga0495615_0255031 3300048090 Unclassified 557
293 Ga0496100_0266912 3300048903 Bacteria 1271
294 Ga0496100_1550376 3300048903 Unclassified 523
295 Ga0496101_0216564 3300048904 Bacteria 1485
296 Ga0496102_0385518 3300048905 Unclassified 1319
297 Ga0496102_0842680 3300048905 Bacteria 839
298 Ga0496102_0871880 3300048905 Bacteria 822
299 Ga0496104_0053508 3300048907 Bacteria 3814
300 Ga0496104_0210205 3300048907 Bacteria 1857
301 Ga0496104_0834597 3300048907 Unclassified 827
302 Ga0496105_0052706 3300048908 Bacteria 3360
303 Ga0496105_0157489 3300048908 Bacteria 1865
304 Ga0496105_0234596 3300048908 Unclassified 1490
305 Ga0496108_0089149 3300048911 Bacteria 2621
306 Ga0496108_0170158 3300048911 Bacteria 1885
307 Ga0496108_1019070 3300048911 Bacteria 706
308 Ga0496108_1083122 3300048911 Unclassified 682
309 Ga0496108_1476966 3300048911 Bacteria 566
310 Ga0496109_0001028 3300048912 Bacteria 23077
311 Ga0496109_0310853 3300048912 Unclassified 1487
312 Ga0496109_0809724 3300048912 Bacteria 875
313 Ga0496110_0261119 3300048913 Unclassified 1576
314 Ga0496110_0627278 3300048913 Bacteria 974
315 Ga0496111_0065765 3300048914 Bacteria 2632
316 Ga0496111_0412773 3300048914 Bacteria 997
317 Ga0496112_0000277 3300048915 Bacteria 33274
318 Ga0496112_0015811 3300048915 Bacteria 7051
319 Ga0496112_1036942 3300048915 Bacteria 739
320 Ga0496113_0369644 3300048916 Bacteria 1151
321 Ga0496113_0574645 3300048916 Unclassified 903
322 Ga0496114_0427443 3300048917 Bacteria 1173
323 Ga0496115_0149508 3300048918 Unclassified 1928
324 Ga0501031_0003128 3300049568 Bacteria 10610
325 Ga0501031_0119914 3300049568 Bacteria 1718
326 Ga0501031_0985169 3300049568 Bacteria 539
327 Ga0501032_0102611 3300049569 Bacteria 1895
328 Ga0501032_0159459 3300049569 Bacteria 1481
329 Ga0501033_0010445 3300049570 Bacteria 7121
330 Ga0501033_0095471 3300049570 Bacteria 2173
331 Ga0501034_0240687 3300049571 Bacteria 1756
332 Ga0501036_1370963 3300049572 Bacteria 574
333 Ga0501037_0006888 3300049573 Bacteria 8302
334 Ga0501037_0466853 3300049573 Bacteria 859
335 Ga0501038_0046220 3300049574 Bacteria 3775
336 Ga0501038_0237122 3300049574 Bacteria 1449
337 Ga0501039_0004821 3300049575 Bacteria 10213
338 Ga0501039_0031161 3300049575 Bacteria 4110
339 Ga0501040_0000871 3300049576 Bacteria 18928
340 Ga0501040_0006713 3300049576 Bacteria 7465
341 Ga0501041_0000592 3300049577 Bacteria 18965
342 Ga0501041_0001910 3300049577 Bacteria 11675
343 Ga0501042_0002085 3300049578 Bacteria 12137
344 Ga0501042_0003606 3300049578 Bacteria 9765
345 Ga0501043_0009494 3300049579 Bacteria 7629
346 Ga0501046_0001466 3300049580 Bacteria 22637
347 Ga0501046_0009557 3300049580 Bacteria 8367
348 Ga0501047_0072391 3300049581 Bacteria 3318
349 Ga0501048_0001076 3300049582 Bacteria 20458
350 Ga0501048_0005206 3300049582 Bacteria 9910
351 Ga0501068_0013947 3300049584 Bacteria 4584
352 Ga0501068_0029986 3300049584 Bacteria 3224
353 Ga0501069_0085293 3300049585 Bacteria 1782
354 Ga0501069_0264584 3300049585 Bacteria 1004
355 Ga0501070_0252697 3300049586 Bacteria 1442
356 Ga0501070_0352770 3300049586 Bacteria 1194
357 Ga0501071_0002949 3300049587 Bacteria 10512
358 Ga0501071_0011791 3300049587 Bacteria 5898
359 Ga0501072_0001745 3300049588 Bacteria 16159
360 Ga0501072_0084812 3300049588 Bacteria 2512
361 Ga0501073_0255738 3300049589 Bacteria 1209
362 Ga0501074_0001212 3300049590 Bacteria 16976
363 Ga0501074_0024964 3300049590 Bacteria 4342
364 Ga0501074_0775589 3300049590 Bacteria 676
365 Ga0501075_0002323 3300049591 Bacteria 12623
366 Ga0501075_0010362 3300049591 Bacteria 6549
367 Ga0501075_1102287 3300049591 Bacteria 603
368 Ga0501076_0002510 3300049592 Bacteria 12632
369 Ga0501076_0004900 3300049592 Bacteria 9576
370 Ga0501076_1069315 3300049592 Unclassified 664
371 Ga0501077_0000462 3300049593 Bacteria 24692
372 Ga0501077_0055834 3300049593 Bacteria 2507
373 Ga0501079_0002263 3300049741 Bacteria 13894
374 Ga0501079_0002910 3300049741 Bacteria 12509
375 Ga0501080_0048992 3300049742 Bacteria 3932
376 Ga0501080_0137188 3300049742 Bacteria 2263
377 Ga0501080_1066147 3300049742 Bacteria 699
378 Ga0501081_0002060 3300049743 Bacteria 12542
379 Ga0501081_0139077 3300049743 Bacteria 1739
380 Ga0501083_0084316 3300049744 Bacteria 2104
381 Ga0501035_0008143 3300049822 Bacteria 9770
382 Ga0501035_0171864 3300049822 Bacteria 1872
383 Ga0501044_0128739 3300049823 Bacteria 2527
384 Ga0501045_0000551 3300049824 Bacteria 23481
385 Ga0501045_0001308 3300049824 Bacteria 16534
386 nmdc:mga03n38_12402_c1 3300050490 Bacteria 3206
387 nmdc:mga0yw44_1206997_c1 3300050492 Bacteria 510
388 nmdc:mga06z11_448468_c1 3300050494 Unclassified 779
389 nmdc:mga05p37_1289296_c1 3300050507 Bacteria 746
390 nmdc:mga05p37_35837_c1 3300050507 Bacteria 6086
391 nmdc:mga05p37_394146_c1 3300050507 Bacteria 1618
392 nmdc:mga05p37_506670_c1 3300050507 Bacteria 1384
393 nmdc:mga05p37_954934_c2 3300050507 Bacteria 600
394 nmdc:mga05p37_98428_c1 3300050507 Bacteria 3603
395 nmdc:mga09592_1067455_c1 3300050508 Unclassified 673
396 nmdc:mga09592_548023_c1 3300050508 Bacteria 993
397 nmdc:mga0qj67_3393_c1 3300050509 Bacteria 11490
398 nmdc:mga0qj67_53678_c1 3300050509 Bacteria 3190
399 nmdc:mga06r32_295057_c1 3300050510 Bacteria 1607
400 nmdc:mga06r32_400599_c1 3300050510 Bacteria 1354
401 nmdc:mga06r32_667687_c1 3300050510 Unclassified 1007
402 nmdc:mga08y16_314736_c1 3300050511 Bacteria 1612
403 nmdc:mga08y16_43444_c1 3300050511 Bacteria 4710
404 nmdc:mga08y16_930560_c1 3300050511 Bacteria 853
405 nmdc:mga0n895_106048_c1 3300050512 Bacteria 2823
406 nmdc:mga0n895_213517_c1 3300050512 Unclassified 1959
407 nmdc:mga0n895_23038_c1 3300050512 Bacteria 5848
408 nmdc:mga0rr50_1213363_c1 3300050513 Unclassified 641
409 nmdc:mga0a205_1048360_c1 3300050515 Unclassified 662
410 nmdc:mga0a205_32257_c1 3300050515 Bacteria 5023
411 nmdc:mga0a205_93747_c1 3300050515 Bacteria 2901
412 Ga0500559_0426634 3300053136 Archaea 615
413 Ga0501084_0015505 3300054114 Bacteria 6320
414 Ga0501084_0019408 3300054114 Bacteria 5663
415 Ga0501084_1216368 3300054114 Unclassified 632
416 Ga0590071_103641 3300059421 Bacteria 718
417 Ga0590074_002125 3300059423 Bacteria 3244
418 Ga0590075_046610 3300059424 Bacteria 1111
419 Ga0501082_0008235 3300060353 Bacteria 8990
420 Ga0501082_0095638 3300060353 Bacteria 2567
421 Ga0501082_0155042 3300060353 Bacteria 1990
422 Ga0501082_1609087 3300060353 Unclassified 567
423 Ga0530510_0000652 3300061734 Bacteria 22396
424 Ga0530510_0063901 3300061734 Bacteria 2666
425 Ga0501040_0341192
426 JGI25407J50210_10070867
427 JGI25407J50210_10158356
428 Ga0068869_100203205
429 Ga0070666_10546929
430 Ga0068868_101876476
431 Ga0070687_100440479
432 Ga0070668_100167546
433 Ga0070674_100693701
434 Ga0070703_10018255
435 Ga0070709_11078554
436 Ga0070714_102237347
437 Ga0070713_100627841
438 Ga0070711_101380964
439 Ga0070705_101436037
440 Ga0070700_100927742
441 Ga0070694_100660876
442 Ga0070708_102244125
443 Ga0070663_101726152
444 Ga0068867_100197958
445 Ga0068867_101105010
446 Ga0070707_102302523
447 Ga0070679_101045967
448 Ga0068853_101617551
449 Ga0070686_100513454
450 Ga0070686_101260683
451 Ga0070695_101316449
452 Ga0070696_100458593
453 Ga0070696_100963377
454 Ga0070665_100628625
455 Ga0068855_100257465
456 Ga0068854_101940344
457 Ga0068856_102023536
458 Ga0070702_101895742
459 Ga0068852_101481415
460 Ga0068859_100964012
461 Ga0068861_100019353
462 Ga0068870_10167954
463 Ga0068863_102723985
464 Ga0068858_101320699
465 Ga0068860_100646718
466 Ga0068860_100932771
467 Ga0068860_102813386
468 Ga0068862_101194254
469 Ga0081455_10018909
470 Ga0081455_10059823
471 Ga0081538_10004200
472 Ga0081538_10004226
473 Ga0081538_10007135
474 Ga0081538_10008358
475 Ga0081538_10016199
476 Ga0081538_10033156
477 Ga0081538_10065718
478 Ga0081538_10066048
479 Ga0081539_10008062
480 Ga0081539_10036182
481 Ga0081539_10102165
482 Ga0075363_100007432
483 Ga0075362_10155218
484 Ga0075367_10489603
485 Ga0075370_10277915
486 Ga0075370_10281044
487 Ga0075428_100081139
488 Ga0075428_100650951
489 Ga0075430_100007122
490 Ga0075430_100401240
491 Ga0075430_100456688
492 Ga0075431_100044110
493 Ga0075431_100469772
494 Ga0075431_100571338
495 Ga0075433_10060371
496 Ga0075433_10109623
497 Ga0075434_100070336
498 Ga0075434_100185215
499 Ga0075429_100006360
500 Ga0075429_100276380
501 Ga0097620_100964099
502 Ga0075435_100175662
503 Ga0075435_100627782
504 Ga0075435_101751384
505 Ga0105240_11306595
506 Ga0105240_12254572
507 Ga0111539_10028896
508 Ga0111539_10845188
509 Ga0111539_11245705
510 Ga0105245_10050394
511 Ga0105245_11434541
512 Ga0105245_12057672
513 Ga0114129_10046447
514 Ga0114129_10177699
515 Ga0114129_10334358
516 Ga0114129_10432734
517 Ga0114129_10484229
518 Ga0114129_11003753
519 Ga0114129_11594130
520 Ga0114129_13396529
521 Ga0105243_11906527
522 Ga0105241_12229120
523 Ga0105241_12608024
524 Ga0105242_10147884
525 Ga0105242_10411207
526 Ga0105248_11874001
527 Ga0105249_10027368
528 Ga0105249_10662317
529 Ga0105239_10379689
530 Ga0105239_12547900
531 Ga0105246_11013441
532 Ga0105246_11237846
533 Ga0157378_10542516
534 Ga0163162_10019724
535 Ga0163162_12693232
536 Ga0157372_10637490
537 Ga0157375_12622438
538 Ga0163163_12181793
539 Ga0157380_11191619
540 Ga0182008_10321257
541 Ga0157379_10244852
542 Ga0157379_10922605
543 Ga0213876_10341093
544 Ga0213876_10419023
545 Ga0207643_10916961
546 Ga0207707_10205479
547 Ga0207663_10398697
548 Ga0207662_10250591
549 Ga0207652_11000868
550 Ga0207646_11739535
551 Ga0207650_10459534
552 Ga0207650_10971912
553 Ga0207687_10091313
554 Ga0207687_11455519
555 Ga0207687_11550348
556 Ga0207700_10377104
557 Ga0207664_11443602
558 Ga0207690_11625615
559 Ga0207706_10005442
560 Ga0207686_10056211
561 Ga0207691_11638475
562 Ga0207661_10634391
563 Ga0207712_10259882
564 Ga0207712_11239561
565 Ga0207703_12084300
566 Ga0207639_10686966
567 Ga0207708_10205114
568 Ga0207702_12185057
569 Ga0207648_10207315
570 Ga0207648_10211778
571 Ga0207648_11236870
572 Ga0207676_11252267
573 Ga0207675_100002608
574 Ga0207675_102133423
575 Ga0207683_10407725
576 Ga0207428_10005998
577 Ga0207428_10310321
578 Ga0268266_10384823
579 Ga0268265_10112287
580 Ga0268265_11818676
581 Ga0268264_11189895
582 Ga0268264_11311265
583 Ga0265318_10067191
584 Ga0265318_10167576
585 Ga0265338_10352192
586 Ga0265330_10460616
587 Ga0307408_100067105
588 Ga0307408_100179291
589 Ga0307408_100621633
590 Ga0307408_100715321
591 Ga0307405_10017136
592 Ga0307405_10158904
593 Ga0307405_10557369
594 Ga0307405_10640369
595 Ga0307405_11189468
596 Ga0307413_10175186
597 Ga0307413_10773476
598 Ga0307413_10995784
599 Ga0307413_12151547
600 Ga0307410_10012482
601 Ga0307410_10047157
602 Ga0307410_10194787
603 Ga0307410_10479089
604 Ga0307406_10032374
605 Ga0307406_10166614
606 Ga0307406_10180565
607 Ga0307406_10213102
608 Ga0307406_11283811
609 Ga0307407_10015908
610 Ga0307407_10021865
611 Ga0307407_10222017
612 Ga0307407_10828823
613 Ga0307412_10026220
614 Ga0307412_10540887
615 Ga0307412_11764797
616 Ga0307409_100003997
617 Ga0307409_100008453
618 Ga0307409_100037034
619 Ga0307409_100461244
620 Ga0307409_100596005
621 Ga0307409_100812715
622 Ga0307409_101034769
623 Ga0307409_101562988
624 Ga0307416_100005376
625 Ga0307416_100006777
626 Ga0307416_100027054
627 Ga0307416_100138563
628 Ga0307416_101091498
629 Ga0307416_102124607
630 Ga0307414_10018858
631 Ga0307414_11579221
632 Ga0307411_10090750
633 Ga0307411_10202944
634 Ga0307415_100002318
635 Ga0307415_100047981
636 Ga0307415_100130479
637 Ga0307415_100537004
638 Ga0307415_101154891
639 Ga0307415_101307595
640 Ga0307415_101413494
641 Ga0373923_0675888
642 Ga0373936_0437646
643 Ga0373931_1006048
644 Ga0373947_0347540
645 Ga0395899_0484332
646 Ga0395900_0093068
647 Ga0395900_0838530
648 Ga0395900_1448953
649 Ga0395900_1460233
650 Ga0395905_0219108
651 Ga0395905_1069478
652 Ga0395905_1078388
653 Ga0395901_0098980
654 Ga0395901_0101114
655 Ga0395901_0325421
656 Ga0395901_0650385
657 Ga0395901_0676437
658 Ga0395901_1250686
659 Ga0436365_0780018
660 Ga0436365_0908806
661 Ga0436365_0959802
662 Ga0436363_1082935
663 Ga0451797_0307944
664 Ga0451841_1034010
665 Ga0439448_0030554
666 Ga0439448_0212363
667 Ga0439451_032149
668 Ga0439454_006731
669 Ga0439454_085155
670 Ga0439456_003928
671 Ga0439463_002259
672 Ga0439463_008291
673 Ga0450914_008465
674 Ga0450915_014226
675 Ga0450888_014761
676 Ga0439444_0072375
677 Ga0439464_0001560
678 Ga0439460_0016599
679 Ga0439460_0055284
680 Ga0439460_0100643
681 Ga0439460_0132780
682 Ga0450916_073824
683 Ga0450918_131106
684 Ga0450893_0066814
685 Ga0439440_0017964
686 Ga0439440_0062333
687 Ga0466967_0575599
688 Ga0466967_1097099
689 Ga0495590_0238313
690 Ga0495629_0282630
691 Ga0495582_0070089
692 Ga0495605_0110497
693 Ga0495607_0171816
694 Ga0495608_0477421
695 Ga0495616_0109604
696 Ga0495618_0197509
697 Ga0495631_0076378
698 Ga0495631_0255888
699 Ga0495644_0181880
700 Ga0495663_0062874
701 Ga0495642_0138469
702 Ga0495652_1074003
703 Ga0495621_0537249
704 Ga0495633_0233137
705 Ga0495656_0136148
706 Ga0495634_0273731
707 Ga0495634_0632096
708 Ga0495659_0124755
709 Ga0495647_0605414
710 Ga0495671_0148287
711 Ga0495589_0140079
712 Ga0495636_0115912
713 Ga0495674_1127696
714 Ga0495674_1357937
715 Ga0495676_0049871
716 Ga0495615_0255031
717 Ga0496100_0266912
718 Ga0496100_1550376
719 Ga0496101_0216564
720 Ga0496102_0385518
721 Ga0496102_0842680
722 Ga0496102_0871880
723 Ga0496104_0053508
724 Ga0496104_0210205
725 Ga0496104_0834597
726 Ga0496105_0052706
727 Ga0496105_0157489
728 Ga0496105_0234596
729 Ga0496108_0089149
730 Ga0496108_0170158
731 Ga0496108_1019070
732 Ga0496108_1083122
733 Ga0496108_1476966
734 Ga0496109_0001028
735 Ga0496109_0310853
736 Ga0496109_0809724
737 Ga0496110_0261119
738 Ga0496110_0627278
739 Ga0496111_0065765
740 Ga0496111_0412773
741 Ga0496112_0000277
742 Ga0496112_0015811
743 Ga0496112_1036942
744 Ga0496113_0369644
745 Ga0496113_0574645
746 Ga0496114_0427443
747 Ga0496115_0149508
748 Ga0501031_0003128
749 Ga0501031_0119914
750 Ga0501031_0985169
751 Ga0501032_0102611
752 Ga0501032_0159459
753 Ga0501033_0010445
754 Ga0501033_0095471
755 Ga0501034_0240687
756 Ga0501036_1370963
757 Ga0501037_0006888
758 Ga0501037_0466853
759 Ga0501038_0046220
760 Ga0501038_0237122
761 Ga0501039_0004821
762 Ga0501039_0031161
763 Ga0501040_0000871
764 Ga0501040_0006713
765 Ga0501041_0000592
766 Ga0501041_0001910
767 Ga0501042_0002085
768 Ga0501042_0003606
769 Ga0501043_0009494
770 Ga0501046_0001466
771 Ga0501046_0009557
772 Ga0501047_0072391
773 Ga0501048_0001076
774 Ga0501048_0005206
775 Ga0501068_0013947
776 Ga0501068_0029986
777 Ga0501069_0085293
778 Ga0501069_0264584
779 Ga0501070_0252697
780 Ga0501070_0352770
781 Ga0501071_0002949
782 Ga0501071_0011791
783 Ga0501072_0001745
784 Ga0501072_0084812
785 Ga0501073_0255738
786 Ga0501074_0001212
787 Ga0501074_0024964
788 Ga0501074_0775589
789 Ga0501075_0002323
790 Ga0501075_0010362
791 Ga0501075_1102287
792 Ga0501076_0002510
793 Ga0501076_0004900
794 Ga0501076_1069315
795 Ga0501077_0000462
796 Ga0501077_0055834
797 Ga0501079_0002263
798 Ga0501079_0002910
799 Ga0501080_0048992
800 Ga0501080_0137188
801 Ga0501080_1066147
802 Ga0501081_0002060
803 Ga0501081_0139077
804 Ga0501083_0084316
805 Ga0501035_0008143
806 Ga0501035_0171864
807 Ga0501044_0128739
808 Ga0501045_0000551
809 Ga0501045_0001308
810 nmdc:mga03n38_12402_c1
811 nmdc:mga0yw44_1206997_c1
812 nmdc:mga06z11_448468_c1
813 nmdc:mga05p37_1289296_c1
814 nmdc:mga05p37_35837_c1
815 nmdc:mga05p37_394146_c1
816 nmdc:mga05p37_506670_c1
817 nmdc:mga05p37_954934_c2
818 nmdc:mga05p37_98428_c1
819 nmdc:mga09592_1067455_c1
820 nmdc:mga09592_548023_c1
821 nmdc:mga0qj67_3393_c1
822 nmdc:mga0qj67_53678_c1
823 nmdc:mga06r32_295057_c1
824 nmdc:mga06r32_400599_c1
825 nmdc:mga06r32_667687_c1
826 nmdc:mga08y16_314736_c1
827 nmdc:mga08y16_43444_c1
828 nmdc:mga08y16_930560_c1
829 nmdc:mga0n895_106048_c1
830 nmdc:mga0n895_213517_c1
831 nmdc:mga0n895_23038_c1
832 nmdc:mga0rr50_1213363_c1
833 nmdc:mga0a205_1048360_c1
834 nmdc:mga0a205_32257_c1
835 nmdc:mga0a205_93747_c1
836 Ga0500559_0426634
837 Ga0501084_0015505
838 Ga0501084_0019408
839 Ga0501084_1216368
840 Ga0590071_103641
841 Ga0590074_002125
842 Ga0590075_046610
843 Ga0501082_0008235
844 Ga0501082_0095638
845 Ga0501082_0155042
846 Ga0501082_1609087
847 Ga0530510_0000652
848 Ga0530510_0063901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11305

DUF3107

Protein of unknown function (DUF3107)

14

87

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rur-assembly1.cif.gz_B crystal structure of the hexadecameric form of rv3208a 0.9549 1 64
7rus-assembly1.cif.gz_A crystal structure of the octameric form of rv3208a 0.9541 1 63
7rur-assembly1.cif.gz_C crystal structure of the hexadecameric form of rv3208a 0.9435 1 63
7rur-assembly1.cif.gz_A crystal structure of the hexadecameric form of rv3208a 0.9435 1 63
7rur-assembly1.cif.gz_B crystal structure of the hexadecameric form of rv3208a 0.9122 1 64
ID Description Score Start End Superfamily
3hfoB00 Mainly Beta;Roll;SH3 type barrels.; 0.704 2 60 2.30.30.100
af_O05781_146_201_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.6845 2 61 2.30.30.60
2eyqB05 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.6665 39 66 2.40.10.170
2k57A00 Mainly Beta;Roll;SH3 type barrels.; 0.6563 2 61 2.30.30.100
af_Q8T126_19_128_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.6424 38 53 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A1L5KR63-F1-model_v4 Uncharacterized protein 0.9427 1 65
AF-A0A1L5KR63-F1-model_v4 Uncharacterized protein 0.9289 1 65
AF-A0A0Q9SRS6-F1-model_v4 ATP-binding protein 0.8828 1 73 GO:0005524
AF-A0A1H1L7X6-F1-model_v4 deleted 0.8808 1 68
AF-A0A7K1C356-F1-model_v4 DUF3107 family protein 0.8714 1 61

Map