F440771

General Info

Members Datasets Scaffolds Average Seq Length
424 268 846 50

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10407593|Ga0207684_104075932
Length 49
Sequence MMSFLAELWLFLRVRKKFWLLPIILMMALFGALLGVSQTAVAPYIYTLF

Samples

Sample ID Description Type Environment
1 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
83 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
84 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
172 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
175 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
178 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
218 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
219 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
245 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
265 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 4.25
Rhizosphere 93.4
Stem 0
Stem Tuber 0
Unclassified 15.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207684_10407593 3300025910 Bacteria 1168
2 MBSR1b_contig_11458998 2162886012 Unclassified 1438
3 Ga0065704_10494962 3300005289 Bacteria 671
4 Ga0065715_10775073 3300005293 Unclassified 620
5 Ga0070683_101764654 3300005329 Bacteria 595
6 Ga0070690_101041495 3300005330 Bacteria 646
7 Ga0070670_100007465 3300005331 Bacteria 9284
8 Ga0070670_101417158 3300005331 Bacteria 637
9 Ga0068869_100923459 3300005334 Bacteria 756
10 Ga0070666_10292889 3300005335 Bacteria 1158
11 Ga0070680_101379386 3300005336 Bacteria 610
12 Ga0070689_100085950 3300005340 Bacteria 2473
13 Ga0070691_10481131 3300005341 Bacteria 714
14 Ga0070668_100285857 3300005347 Bacteria 1379
15 Ga0070669_101519517 3300005353 Bacteria 582
16 Ga0070675_100827067 3300005354 Bacteria 847
17 Ga0070675_101836125 3300005354 Bacteria 559
18 Ga0070671_100475096 3300005355 Bacteria 1074
19 Ga0070674_100242836 3300005356 Bacteria 1411
20 Ga0070673_100744323 3300005364 Bacteria 902
21 Ga0070688_100377470 3300005365 Bacteria 1044
22 Ga0070667_100167536 3300005367 Bacteria 1938
23 Ga0070703_10039010 3300005406 Bacteria 1470
24 Ga0070709_10568985 3300005434 Bacteria 869
25 Ga0070709_10781416 3300005434 Bacteria 748
26 Ga0070713_100437755 3300005436 Bacteria 1226
27 Ga0070713_101270685 3300005436 Bacteria 713
28 Ga0070713_101776491 3300005436 Bacteria 598
29 Ga0070701_10957658 3300005438 Bacteria 594
30 Ga0070711_100379813 3300005439 Bacteria 1142
31 Ga0070705_100020974 3300005440 Bacteria 3469
32 Ga0070705_101786079 3300005440 Bacteria 521
33 Ga0070694_100088023 3300005444 Bacteria 2174
34 Ga0070708_100275017 3300005445 Unclassified 1584
35 Ga0070708_100555154 3300005445 Unclassified 1083
36 Ga0070663_100902256 3300005455 Bacteria 763
37 Ga0070706_100070115 3300005467 Bacteria 3242
38 Ga0070706_100105358 3300005467 Unclassified 2624
39 Ga0070706_100108329 3300005467 Bacteria 2585
40 Ga0070706_100392032 3300005467 Bacteria 1293
41 Ga0070706_101886314 3300005467 Unclassified 542
42 Ga0070707_100234542 3300005468 Unclassified 1786
43 Ga0070707_101304749 3300005468 Unclassified 692
44 Ga0070707_101482457 3300005468 Bacteria 645
45 Ga0070698_100236502 3300005471 Bacteria 1760
46 Ga0070698_100627017 3300005471 Bacteria 1016
47 Ga0070699_100696182 3300005518 Bacteria 928
48 Ga0070679_100460800 3300005530 Bacteria 1216
49 Ga0070679_100530403 3300005530 Bacteria 1121
50 Ga0070684_100504827 3300005535 Bacteria 1120
51 Ga0070697_100143381 3300005536 Bacteria 2010
52 Ga0070697_100413035 3300005536 Bacteria 1172
53 Ga0070697_101408893 3300005536 Unclassified 622
54 Ga0070697_101939202 3300005536 Unclassified 527
55 Ga0068853_100030253 3300005539 Bacteria 4573
56 Ga0068853_100311161 3300005539 Unclassified 1458
57 Ga0070672_100508117 3300005543 Bacteria 1043
58 Ga0070686_101853837 3300005544 Bacteria 514
59 Ga0070696_100227414 3300005546 Bacteria 1402
60 Ga0070693_101568440 3300005547 Unclassified 516
61 Ga0070665_100647410 3300005548 Bacteria 1070
62 Ga0070704_100192418 3300005549 Bacteria 1641
63 Ga0070704_100452028 3300005549 Bacteria 1106
64 Ga0070704_101359765 3300005549 Bacteria 651
65 Ga0068855_100263863 3300005563 Bacteria 1918
66 Ga0068855_101311246 3300005563 Bacteria 749
67 Ga0068852_101533963 3300005616 Unclassified 689
68 Ga0068859_100155170 3300005617 Bacteria 2366
69 Ga0068859_100230220 3300005617 Unclassified 1941
70 Ga0068859_100777680 3300005617 Bacteria 1046
71 Ga0068859_101775014 3300005617 Bacteria 681
72 Ga0068864_101006460 3300005618 Bacteria 827
73 Ga0068864_101738608 3300005618 Bacteria 629
74 Ga0068864_102228563 3300005618 Unclassified 554
75 Ga0068864_102720335 3300005618 Bacteria 500
76 Ga0068866_11391589 3300005718 Unclassified 512
77 Ga0068861_100926975 3300005719 Bacteria 827
78 Ga0068861_101307280 3300005719 Bacteria 705
79 Ga0068861_101601883 3300005719 Unclassified 641
80 Ga0068851_10977860 3300005834 Unclassified 533
81 Ga0068870_10684692 3300005840 Bacteria 706
82 Ga0068858_100246255 3300005842 Bacteria 1697
83 Ga0068858_101007570 3300005842 Unclassified 816
84 Ga0068858_101037807 3300005842 Bacteria 804
85 Ga0068860_100840392 3300005843 Bacteria 933
86 Ga0068862_100006325 3300005844 Bacteria 9848
87 Ga0068862_100206872 3300005844 Bacteria 1772
88 Ga0068862_101650033 3300005844 Unclassified 649
89 Ga0081455_10053266 3300005937 Bacteria 3457
90 Ga0081538_10046465 3300005981 Bacteria 2677
91 Ga0081538_10117578 3300005981 Bacteria 1287
92 Ga0081538_10150954 3300005981 Bacteria 1052
93 Ga0070717_10046714 3300006028 Bacteria 3544
94 Ga0070715_10114665 3300006163 Bacteria 1276
95 Ga0070716_100294361 3300006173 Unclassified 1126
96 Ga0070716_100663875 3300006173 Unclassified 792
97 Ga0070712_100760099 3300006175 Bacteria 830
98 Ga0070712_101694085 3300006175 Unclassified 553
99 Ga0075427_10011191 3300006194 Bacteria 1351
100 Ga0075428_100088139 3300006844 Bacteria 3385
101 Ga0075428_100262839 3300006844 Bacteria 1858
102 Ga0075428_102476963 3300006844 Bacteria 532
103 Ga0075430_100016177 3300006846 Bacteria 6354
104 Ga0075430_100343590 3300006846 Bacteria 1232
105 Ga0075431_100301026 3300006847 Bacteria 1620
106 Ga0075431_100491339 3300006847 Unclassified 1219
107 Ga0075433_10335232 3300006852 Bacteria 1337
108 Ga0075434_100138667 3300006871 Bacteria 2452
109 Ga0075434_101907692 3300006871 Unclassified 600
110 Ga0075429_100050781 3300006880 Bacteria 3608
111 Ga0068865_100859540 3300006881 Bacteria 786
112 Ga0097620_100155171 3300006931 Bacteria 2366
113 Ga0097620_100230222 3300006931 Unclassified 1941
114 Ga0097620_100777701 3300006931 Bacteria 1046
115 Ga0097620_101774871 3300006931 Bacteria 681
116 Ga0075435_100196855 3300007076 Unclassified 1707
117 Ga0099795_10030995 3300007788 Bacteria 1839
118 Ga0105240_10583252 3300009093 Bacteria 1233
119 Ga0105240_10668760 3300009093 Bacteria 1136
120 Ga0105240_12279341 3300009093 Unclassified 561
121 Ga0111539_10005181 3300009094 Bacteria 16890
122 Ga0111539_10012724 3300009094 Bacteria 10538
123 Ga0111539_10684110 3300009094 Bacteria 1194
124 Ga0105245_12613811 3300009098 Bacteria 558
125 Ga0105247_10277509 3300009101 Bacteria 1155
126 Ga0105247_10547390 3300009101 Bacteria 850
127 Ga0114129_10088480 3300009147 Bacteria 4293
128 Ga0114129_12242716 3300009147 Unclassified 656
129 Ga0105243_10536389 3300009148 Unclassified 1115
130 Ga0105241_11235821 3300009174 Bacteria 709
131 Ga0105237_10447514 3300009545 Bacteria 1297
132 Ga0105238_10116849 3300009551 Bacteria 2647
133 Ga0105249_10039545 3300009553 Bacteria 4283
134 Ga0105249_10093861 3300009553 Bacteria 2812
135 Ga0105249_12759703 3300009553 Bacteria 563
136 Ga0105148_109267 3300009978 Bacteria 741
137 Ga0105030_105085 3300009987 Bacteria 1113
138 Ga0105028_101456 3300009993 Bacteria 2492
139 Ga0099796_10008778 3300010159 Bacteria 2707
140 Ga0105239_10152721 3300010375 Bacteria 2577
141 Ga0105239_11051823 3300010375 Bacteria 936
142 Ga0105239_12574870 3300010375 Bacteria 593
143 Ga0105239_12989519 3300010375 Unclassified 551
144 Ga0157370_10342931 3300013104 Bacteria 1377
145 Ga0157374_10567439 3300013296 Unclassified 1143
146 Ga0157374_11196923 3300013296 Bacteria 781
147 Ga0157374_12779611 3300013296 Bacteria 517
148 Ga0157378_10564522 3300013297 Unclassified 1145
149 Ga0163162_10149984 3300013306 Bacteria 2448
150 Ga0157372_11378372 3300013307 Bacteria 813
151 Ga0157372_11779754 3300013307 Unclassified 708
152 Ga0157375_10354953 3300013308 Bacteria 1632
153 Ga0157375_13236040 3300013308 Bacteria 543
154 Ga0163163_11366151 3300014325 Bacteria 770
155 Ga0163163_12111252 3300014325 Bacteria 623
156 Ga0163163_12298354 3300014325 Bacteria 598
157 Ga0157380_12944675 3300014326 Bacteria 542
158 Ga0157379_11941772 3300014968 Bacteria 581
159 Ga0224712_10299102 3300022467 Unclassified 752
160 Ga0207656_10498919 3300025321 Unclassified 618
161 Ga0207692_10246642 3300025898 Bacteria 1069
162 Ga0207710_10133687 3300025900 Bacteria 1193
163 Ga0207647_10586791 3300025904 Unclassified 616
164 Ga0207685_10069900 3300025905 Bacteria 1419
165 Ga0207684_10038568 3300025910 Bacteria 4054
166 Ga0207684_10063706 3300025910 Bacteria 3130
167 Ga0207684_10115420 3300025910 Unclassified 2300
168 Ga0207707_10195657 3300025912 Bacteria 1764
169 Ga0207695_10759942 3300025913 Bacteria 849
170 Ga0207671_10590755 3300025914 Unclassified 885
171 Ga0207693_10249358 3300025915 Bacteria 1393
172 Ga0207693_11259291 3300025915 Unclassified 555
173 Ga0207663_10073297 3300025916 Bacteria 2215
174 Ga0207662_11223662 3300025918 Bacteria 534
175 Ga0207652_10507795 3300025921 Bacteria 1085
176 Ga0207652_11882056 3300025921 Bacteria 504
177 Ga0207646_10001557 3300025922 Bacteria 28079
178 Ga0207646_10794320 3300025922 Unclassified 843
179 Ga0207694_10076316 3300025924 Bacteria 2624
180 Ga0207650_10011914 3300025925 Bacteria 5993
181 Ga0207659_11012145 3300025926 Bacteria 715
182 Ga0207659_11102530 3300025926 Bacteria 683
183 Ga0207659_11128686 3300025926 Unclassified 674
184 Ga0207700_10282807 3300025928 Bacteria 1427
185 Ga0207700_11418918 3300025928 Bacteria 617
186 Ga0207700_11479385 3300025928 Bacteria 603
187 Ga0207664_11429167 3300025929 Bacteria 613
188 Ga0207706_10037818 3300025933 Bacteria 4283
189 Ga0207665_10483911 3300025939 Bacteria 954
190 Ga0207691_10645572 3300025940 Bacteria 894
191 Ga0207689_10771615 3300025942 Bacteria 811
192 Ga0207661_11927458 3300025944 Bacteria 537
193 Ga0207667_10489128 3300025949 Bacteria 1249
194 Ga0207651_10969081 3300025960 Bacteria 759
195 Ga0207712_11261053 3300025961 Bacteria 660
196 Ga0207668_10638577 3300025972 Unclassified 931
197 Ga0207640_11425139 3300025981 Unclassified 621
198 Ga0207703_10301866 3300026035 Bacteria 1461
199 Ga0207703_10808978 3300026035 Bacteria 895
200 Ga0207639_10079961 3300026041 Bacteria 2585
201 Ga0207639_10126201 3300026041 Bacteria 2111
202 Ga0207639_10943059 3300026041 Bacteria 807
203 Ga0207641_11457553 3300026088 Bacteria 686
204 Ga0207676_10535437 3300026095 Bacteria 1117
205 Ga0207676_10864859 3300026095 Bacteria 885
206 Ga0207675_100774037 3300026118 Unclassified 972
207 Ga0207683_11228296 3300026121 Bacteria 694
208 Ga0209969_1000815 3300027360 Bacteria 4185
209 Ga0209967_1004545 3300027364 Bacteria 1845
210 Ga0209981_1006566 3300027378 Bacteria 1558
211 Ga0209996_1019896 3300027395 Bacteria 939
212 Ga0209984_1045624 3300027424 Bacteria 636
213 Ga0210000_1003369 3300027462 Bacteria 2306
214 Ga0209995_1002149 3300027471 Bacteria 3093
215 Ga0209179_1012964 3300027512 Bacteria 1506
216 Ga0209968_1022450 3300027526 Bacteria 1029
217 Ga0209968_1048582 3300027526 Bacteria 734
218 Ga0209999_1002024 3300027543 Bacteria 3538
219 Ga0210002_1105926 3300027617 Bacteria 510
220 Ga0209971_1028071 3300027682 Bacteria 1346
221 Ga0209966_1026839 3300027695 Bacteria 1149
222 Ga0209974_10002315 3300027876 Bacteria 6912
223 Ga0209974_10391370 3300027876 Bacteria 544
224 Ga0207428_10000505 3300027907 Bacteria 46673
225 Ga0268266_10712505 3300028379 Bacteria 968
226 Ga0268265_10113140 3300028380 Bacteria 2220
227 Ga0268265_11852394 3300028380 Unclassified 610
228 Ga0268264_10422295 3300028381 Bacteria 1286
229 Ga0265328_10158948 3300031239 Bacteria 851
230 Ga0265327_10003628 3300031251 Bacteria 14516
231 Ga0265316_10002742 3300031344 Bacteria 18045
232 Ga0316579_10303209 3300031691 Bacteria 772
233 Ga0307405_12139457 3300031731 Bacteria 503
234 Ga0307409_101767714 3300031995 Unclassified 647
235 Ga0307416_102415297 3300032002 Bacteria 625
236 Ga0307416_102516995 3300032002 Unclassified 613
237 Ga0307411_11277229 3300032005 Bacteria 668
238 Ga0307415_100266898 3300032126 Bacteria 1400
239 Ga0373928_0260226 3300035084 Bacteria 520
240 Ga0373923_0083810 3300035111 Bacteria 1386
241 Ga0373953_0012899 3300035117 Bacteria 2970
242 Ga0373953_0522120 3300035117 Bacteria 527
243 Ga0373954_0001815 3300035118 Bacteria 8802
244 Ga0373954_0213517 3300035118 Bacteria 949
245 Ga0373954_0703520 3300035118 Bacteria 501
246 Ga0373956_0451754 3300035119 Bacteria 613
247 Ga0373957_0002978 3300035120 Bacteria 4915
248 Ga0373955_0041596 3300035172 Bacteria 2464
249 Ga0373955_0985473 3300035172 Bacteria 519
250 Ga0373924_0203901 3300035410 Bacteria 873
251 Ga0373935_0437873 3300035692 Bacteria 943
252 Ga0373935_0596153 3300035692 Bacteria 808
253 Ga0373927_0279543 3300035695 Bacteria 1098
254 Ga0373933_0008185 3300035724 Bacteria 5706
255 Ga0373933_0096646 3300035724 Bacteria 1829
256 Ga0373947_0127571 3300035725 Bacteria 1622
257 Ga0373937_0010401 3300036401 Bacteria 8125
258 Ga0373937_1385486 3300036401 Bacteria 651
259 Ga0373937_1507968 3300036401 Bacteria 620
260 Ga0316582_0133106 3300036647 Bacteria 1672
261 Ga0316582_1008026 3300036647 Unclassified 568
262 Ga0316584_0164241 3300036712 Unclassified 1649
263 Ga0316584_0607902 3300036712 Unclassified 758
264 Ga0373925_0236834 3300037068 Bacteria 1461
265 Ga0373925_0483647 3300037068 Bacteria 1016
266 Ga0400486_23343 3300038742 Bacteria 3386
267 Ga0400483_084009 3300039062 Bacteria 4177
268 Ga0400483_146554 3300039062 Bacteria 26861
269 Ga0400483_150771 3300039062 Bacteria 14748
270 Ga0400483_250559 3300039062 Bacteria 15225
271 Ga0436363_0916558 3300039450 Unclassified 600
272 Ga0439437_037030 3300042000 Bacteria 626
273 Ga0439434_0349132 3300042435 Unclassified 516
274 Ga0453683_0072932 3300044673 Bacteria 2149
275 Ga0453683_0335969 3300044673 Bacteria 969
276 Ga0453684_0686797 3300044712 Unclassified 1114
277 Ga0451576_0271074 3300045051 Bacteria 1774
278 Ga0451576_0403932 3300045051 Bacteria 1432
279 Ga0495592_0723645 3300046454 Bacteria 597
280 Ga0495580_0503089 3300046472 Bacteria 809
281 Ga0495608_0342431 3300046511 Bacteria 921
282 Ga0495618_0546870 3300046514 Bacteria 694
283 Ga0495652_0707820 3300046529 Bacteria 677
284 Ga0495640_0044162 3300046533 Bacteria 3100
285 Ga0495640_0292927 3300046533 Bacteria 1012
286 Ga0495640_0792976 3300046533 Bacteria 565
287 Ga0495667_0027364 3300046559 Bacteria 3843
288 Ga0495635_0041825 3300046663 Bacteria 3166
289 Ga0495635_0444374 3300046663 Bacteria 858
290 Ga0495635_0526453 3300046663 Bacteria 777
291 Ga0495657_0030997 3300046675 Bacteria 3740
292 Ga0495657_0670002 3300046675 Bacteria 597
293 Ga0495623_0582167 3300046679 Bacteria 583
294 Ga0495647_0640304 3300046681 Bacteria 500
295 Ga0495674_0356379 3300047319 Bacteria 1187
296 Ga0495674_0587041 3300047319 Bacteria 884
297 Ga0495672_0022595 3300047320 Bacteria 4086
298 Ga0495680_0067950 3300047322 Bacteria 2724
299 Ga0495680_0487031 3300047322 Bacteria 839
300 Ga0495684_0844825 3300047471 Bacteria 594
301 Ga0495686_0344899 3300047472 Bacteria 811
302 Ga0495602_0879552 3300048088 Bacteria 597
303 Ga0495614_0607299 3300048089 Bacteria 526
304 Ga0496101_0457215 3300048904 Bacteria 1007
305 Ga0496102_0004824 3300048905 Bacteria 11401
306 Ga0496103_0018874 3300048906 Bacteria 4141
307 Ga0496104_0064992 3300048907 Bacteria 3461
308 Ga0496105_0225479 3300048908 Bacteria 1524
309 Ga0496106_0052573 3300048909 Bacteria 3074
310 Ga0496106_0059895 3300048909 Bacteria 2885
311 Ga0496107_1235860 3300048910 Unclassified 536
312 Ga0496108_0254599 3300048911 Bacteria 1527
313 Ga0496108_1641969 3300048911 Bacteria 531
314 Ga0496109_0033091 3300048912 Bacteria 4650
315 Ga0496110_0006081 3300048913 Bacteria 9512
316 Ga0496111_0018654 3300048914 Bacteria 4809
317 Ga0496111_0891204 3300048914 Bacteria 641
318 Ga0496112_0045600 3300048915 Bacteria 4298
319 Ga0496113_0019820 3300048916 Bacteria 4715
320 Ga0496113_0845301 3300048916 Unclassified 726
321 Ga0496114_0752603 3300048917 Bacteria 852
322 Ga0496121_0724146 3300048924 Bacteria 595
323 Ga0496126_0159287 3300048929 Bacteria 1930
324 Ga0501305_092268 3300049161 Bacteria 556
325 Ga0501291_140778 3300049514 Unclassified 538
326 Ga0501298_055043 3300049521 Bacteria 832
327 Ga0501299_199698 3300049522 Bacteria 531
328 Ga0501031_0269126 3300049568 Bacteria 1106
329 Ga0501032_0070345 3300049569 Bacteria 2334
330 Ga0501033_0489121 3300049570 Bacteria 852
331 Ga0501034_1673091 3300049571 Bacteria 509
332 Ga0501036_0280581 3300049572 Bacteria 1394
333 Ga0501037_0139227 3300049573 Bacteria 1737
334 Ga0501037_0786190 3300049573 Bacteria 629
335 Ga0501038_0118193 3300049574 Bacteria 2189
336 Ga0501039_0004433 3300049575 Bacteria 10598
337 Ga0501039_0756649 3300049575 Bacteria 759
338 Ga0501040_0169922 3300049576 Bacteria 1543
339 Ga0501040_0318026 3300049576 Bacteria 1113
340 Ga0501040_1030928 3300049576 Bacteria 597
341 Ga0501041_0067128 3300049577 Bacteria 2198
342 Ga0501041_0807236 3300049577 Bacteria 602
343 Ga0501041_1113754 3300049577 Bacteria 509
344 Ga0501042_0015733 3300049578 Bacteria 5184
345 Ga0501042_0253930 3300049578 Bacteria 1269
346 Ga0501042_0353474 3300049578 Bacteria 1063
347 Ga0501043_0048185 3300049579 Bacteria 3350
348 Ga0501046_0435820 3300049580 Bacteria 943
349 Ga0501046_0665314 3300049580 Unclassified 735
350 Ga0501048_0077289 3300049582 Bacteria 2349
351 Ga0501048_0634743 3300049582 Bacteria 767
352 Ga0501048_0838045 3300049582 Bacteria 661
353 Ga0501068_0409415 3300049584 Bacteria 875
354 Ga0501068_0818676 3300049584 Bacteria 611
355 Ga0501069_0745733 3300049585 Bacteria 592
356 Ga0501070_0255505 3300049586 Bacteria 1433
357 Ga0501071_0005047 3300049587 Bacteria 8444
358 Ga0501071_0366678 3300049587 Bacteria 1097
359 Ga0501072_0030282 3300049588 Bacteria 4232
360 Ga0501072_0212954 3300049588 Bacteria 1540
361 Ga0501073_0327238 3300049589 Bacteria 1058
362 Ga0501074_0182379 3300049590 Bacteria 1497
363 Ga0501075_0097546 3300049591 Bacteria 2230
364 Ga0501075_0120114 3300049591 Bacteria 2000
365 Ga0501076_0212057 3300049592 Bacteria 1582
366 Ga0501076_0240111 3300049592 Bacteria 1482
367 Ga0501076_0555354 3300049592 Bacteria 947
368 Ga0501076_0706033 3300049592 Bacteria 832
369 Ga0501076_1786144 3300049592 Bacteria 504
370 Ga0501077_0083889 3300049593 Bacteria 2019
371 Ga0501077_0536791 3300049593 Bacteria 750
372 Ga0501077_0839037 3300049593 Bacteria 591
373 Ga0501216_167153 3300049660 Bacteria 531
374 Ga0501259_143632 3300049688 Unclassified 586
375 Ga0501079_0152164 3300049741 Bacteria 1803
376 Ga0501079_0555063 3300049741 Unclassified 903
377 Ga0501079_1028103 3300049741 Bacteria 649
378 Ga0501079_1061814 3300049741 Bacteria 638
379 Ga0501080_0117591 3300049742 Bacteria 2464
380 Ga0501081_0029705 3300049743 Bacteria 3696
381 Ga0501081_0419238 3300049743 Bacteria 992
382 Ga0501081_0950509 3300049743 Bacteria 649
383 Ga0501083_0159867 3300049744 Bacteria 1474
384 Ga0501035_0131252 3300049822 Bacteria 2184
385 Ga0501045_0026500 3300049824 Bacteria 4170
386 Ga0501045_0458729 3300049824 Bacteria 947
387 Ga0501045_1039555 3300049824 Bacteria 600
388 Ga0501045_1419918 3300049824 Bacteria 504
389 nmdc:mga05p37_1688646_c1 3300050507 Unclassified 618
390 nmdc:mga05p37_1694205_c1 3300050507 Unclassified 617
391 nmdc:mga05p37_265281_c1 3300050507 Bacteria 2054
392 nmdc:mga09592_124072_c1 3300050508 Bacteria 2220
393 nmdc:mga09592_39023_c1 3300050508 Bacteria 3988
394 nmdc:mga09592_829912_c1 3300050508 Bacteria 780
395 nmdc:mga0qj67_11457_c1 3300050509 Bacteria 6644
396 nmdc:mga0qj67_61840_c1 3300050509 Bacteria 2974
397 nmdc:mga06r32_141532_c1 3300050510 Bacteria 2382
398 nmdc:mga06r32_1714701_c1 3300050510 Unclassified 565
399 nmdc:mga06r32_347827_c1 3300050510 Bacteria 1467
400 nmdc:mga08y16_25365_c1 3300050511 Bacteria 6251
401 nmdc:mga08y16_29325_c1 3300050511 Bacteria 5798
402 nmdc:mga0n895_1591938_c1 3300050512 Bacteria 618
403 nmdc:mga0n895_975312_c1 3300050512 Bacteria 830
404 nmdc:mga0rr50_592332_c1 3300050513 Bacteria 945
405 nmdc:mga0a205_192145_c1 3300050515 Unclassified 1933
406 nmdc:mga0a205_339087_c1 3300050515 Bacteria 1372
407 Ga0495601_0019900 3300053077 Bacteria 4097
408 Ga0495612_0397971 3300053078 Bacteria 626
409 Ga0495595_0008901 3300053084 Bacteria 4136
410 Ga0495619_0002987 3300053085 Bacteria 10987
411 Ga0495619_0492027 3300053085 Unclassified 844
412 Ga0495619_0538381 3300053085 Bacteria 802
413 Ga0500578_0033160 3300053086 Bacteria 3320
414 Ga0500645_004999 3300053730 Bacteria 4968
415 Ga0501084_0008240 3300054114 Bacteria 8597
416 Ga0501084_0520372 3300054114 Bacteria 1006
417 Ga0501084_1225826 3300054114 Bacteria 629
418 Ga0501084_1825992 3300054114 Bacteria 507
419 Ga0501082_0127392 3300060353 Bacteria 2208
420 Ga0501082_1926742 3300060353 Bacteria 515
421 Ga0530510_0137725 3300061734 Bacteria 1797
422 Ga0530510_0878111 3300061734 Bacteria 685
423 Ga0530510_1500932 3300061734 Bacteria 517
424 Ga0207684_10407593
425 MBSR1b_contig_11458998
426 Ga0065704_10494962
427 Ga0065715_10775073
428 Ga0070683_101764654
429 Ga0070690_101041495
430 Ga0070670_100007465
431 Ga0070670_101417158
432 Ga0068869_100923459
433 Ga0070666_10292889
434 Ga0070680_101379386
435 Ga0070689_100085950
436 Ga0070691_10481131
437 Ga0070668_100285857
438 Ga0070669_101519517
439 Ga0070675_100827067
440 Ga0070675_101836125
441 Ga0070671_100475096
442 Ga0070674_100242836
443 Ga0070673_100744323
444 Ga0070688_100377470
445 Ga0070667_100167536
446 Ga0070703_10039010
447 Ga0070709_10568985
448 Ga0070709_10781416
449 Ga0070713_100437755
450 Ga0070713_101270685
451 Ga0070713_101776491
452 Ga0070701_10957658
453 Ga0070711_100379813
454 Ga0070705_100020974
455 Ga0070705_101786079
456 Ga0070694_100088023
457 Ga0070708_100275017
458 Ga0070708_100555154
459 Ga0070663_100902256
460 Ga0070706_100070115
461 Ga0070706_100105358
462 Ga0070706_100108329
463 Ga0070706_100392032
464 Ga0070706_101886314
465 Ga0070707_100234542
466 Ga0070707_101304749
467 Ga0070707_101482457
468 Ga0070698_100236502
469 Ga0070698_100627017
470 Ga0070699_100696182
471 Ga0070679_100460800
472 Ga0070679_100530403
473 Ga0070684_100504827
474 Ga0070697_100143381
475 Ga0070697_100413035
476 Ga0070697_101408893
477 Ga0070697_101939202
478 Ga0068853_100030253
479 Ga0068853_100311161
480 Ga0070672_100508117
481 Ga0070686_101853837
482 Ga0070696_100227414
483 Ga0070693_101568440
484 Ga0070665_100647410
485 Ga0070704_100192418
486 Ga0070704_100452028
487 Ga0070704_101359765
488 Ga0068855_100263863
489 Ga0068855_101311246
490 Ga0068852_101533963
491 Ga0068859_100155170
492 Ga0068859_100230220
493 Ga0068859_100777680
494 Ga0068859_101775014
495 Ga0068864_101006460
496 Ga0068864_101738608
497 Ga0068864_102228563
498 Ga0068864_102720335
499 Ga0068866_11391589
500 Ga0068861_100926975
501 Ga0068861_101307280
502 Ga0068861_101601883
503 Ga0068851_10977860
504 Ga0068870_10684692
505 Ga0068858_100246255
506 Ga0068858_101007570
507 Ga0068858_101037807
508 Ga0068860_100840392
509 Ga0068862_100006325
510 Ga0068862_100206872
511 Ga0068862_101650033
512 Ga0081455_10053266
513 Ga0081538_10046465
514 Ga0081538_10117578
515 Ga0081538_10150954
516 Ga0070717_10046714
517 Ga0070715_10114665
518 Ga0070716_100294361
519 Ga0070716_100663875
520 Ga0070712_100760099
521 Ga0070712_101694085
522 Ga0075427_10011191
523 Ga0075428_100088139
524 Ga0075428_100262839
525 Ga0075428_102476963
526 Ga0075430_100016177
527 Ga0075430_100343590
528 Ga0075431_100301026
529 Ga0075431_100491339
530 Ga0075433_10335232
531 Ga0075434_100138667
532 Ga0075434_101907692
533 Ga0075429_100050781
534 Ga0068865_100859540
535 Ga0097620_100155171
536 Ga0097620_100230222
537 Ga0097620_100777701
538 Ga0097620_101774871
539 Ga0075435_100196855
540 Ga0099795_10030995
541 Ga0105240_10583252
542 Ga0105240_10668760
543 Ga0105240_12279341
544 Ga0111539_10005181
545 Ga0111539_10012724
546 Ga0111539_10684110
547 Ga0105245_12613811
548 Ga0105247_10277509
549 Ga0105247_10547390
550 Ga0114129_10088480
551 Ga0114129_12242716
552 Ga0105243_10536389
553 Ga0105241_11235821
554 Ga0105237_10447514
555 Ga0105238_10116849
556 Ga0105249_10039545
557 Ga0105249_10093861
558 Ga0105249_12759703
559 Ga0105148_109267
560 Ga0105030_105085
561 Ga0105028_101456
562 Ga0099796_10008778
563 Ga0105239_10152721
564 Ga0105239_11051823
565 Ga0105239_12574870
566 Ga0105239_12989519
567 Ga0157370_10342931
568 Ga0157374_10567439
569 Ga0157374_11196923
570 Ga0157374_12779611
571 Ga0157378_10564522
572 Ga0163162_10149984
573 Ga0157372_11378372
574 Ga0157372_11779754
575 Ga0157375_10354953
576 Ga0157375_13236040
577 Ga0163163_11366151
578 Ga0163163_12111252
579 Ga0163163_12298354
580 Ga0157380_12944675
581 Ga0157379_11941772
582 Ga0224712_10299102
583 Ga0207656_10498919
584 Ga0207692_10246642
585 Ga0207710_10133687
586 Ga0207647_10586791
587 Ga0207685_10069900
588 Ga0207684_10038568
589 Ga0207684_10063706
590 Ga0207684_10115420
591 Ga0207707_10195657
592 Ga0207695_10759942
593 Ga0207671_10590755
594 Ga0207693_10249358
595 Ga0207693_11259291
596 Ga0207663_10073297
597 Ga0207662_11223662
598 Ga0207652_10507795
599 Ga0207652_11882056
600 Ga0207646_10001557
601 Ga0207646_10794320
602 Ga0207694_10076316
603 Ga0207650_10011914
604 Ga0207659_11012145
605 Ga0207659_11102530
606 Ga0207659_11128686
607 Ga0207700_10282807
608 Ga0207700_11418918
609 Ga0207700_11479385
610 Ga0207664_11429167
611 Ga0207706_10037818
612 Ga0207665_10483911
613 Ga0207691_10645572
614 Ga0207689_10771615
615 Ga0207661_11927458
616 Ga0207667_10489128
617 Ga0207651_10969081
618 Ga0207712_11261053
619 Ga0207668_10638577
620 Ga0207640_11425139
621 Ga0207703_10301866
622 Ga0207703_10808978
623 Ga0207639_10079961
624 Ga0207639_10126201
625 Ga0207639_10943059
626 Ga0207641_11457553
627 Ga0207676_10535437
628 Ga0207676_10864859
629 Ga0207675_100774037
630 Ga0207683_11228296
631 Ga0209969_1000815
632 Ga0209967_1004545
633 Ga0209981_1006566
634 Ga0209996_1019896
635 Ga0209984_1045624
636 Ga0210000_1003369
637 Ga0209995_1002149
638 Ga0209179_1012964
639 Ga0209968_1022450
640 Ga0209968_1048582
641 Ga0209999_1002024
642 Ga0210002_1105926
643 Ga0209971_1028071
644 Ga0209966_1026839
645 Ga0209974_10002315
646 Ga0209974_10391370
647 Ga0207428_10000505
648 Ga0268266_10712505
649 Ga0268265_10113140
650 Ga0268265_11852394
651 Ga0268264_10422295
652 Ga0265328_10158948
653 Ga0265327_10003628
654 Ga0265316_10002742
655 Ga0316579_10303209
656 Ga0307405_12139457
657 Ga0307409_101767714
658 Ga0307416_102415297
659 Ga0307416_102516995
660 Ga0307411_11277229
661 Ga0307415_100266898
662 Ga0373928_0260226
663 Ga0373923_0083810
664 Ga0373953_0012899
665 Ga0373953_0522120
666 Ga0373954_0001815
667 Ga0373954_0213517
668 Ga0373954_0703520
669 Ga0373956_0451754
670 Ga0373957_0002978
671 Ga0373955_0041596
672 Ga0373955_0985473
673 Ga0373924_0203901
674 Ga0373935_0437873
675 Ga0373935_0596153
676 Ga0373927_0279543
677 Ga0373933_0008185
678 Ga0373933_0096646
679 Ga0373947_0127571
680 Ga0373937_0010401
681 Ga0373937_1385486
682 Ga0373937_1507968
683 Ga0316582_0133106
684 Ga0316582_1008026
685 Ga0316584_0164241
686 Ga0316584_0607902
687 Ga0373925_0236834
688 Ga0373925_0483647
689 Ga0400486_23343
690 Ga0400483_084009
691 Ga0400483_146554
692 Ga0400483_150771
693 Ga0400483_250559
694 Ga0436363_0916558
695 Ga0439437_037030
696 Ga0439434_0349132
697 Ga0453683_0072932
698 Ga0453683_0335969
699 Ga0453684_0686797
700 Ga0451576_0271074
701 Ga0451576_0403932
702 Ga0495592_0723645
703 Ga0495580_0503089
704 Ga0495608_0342431
705 Ga0495618_0546870
706 Ga0495652_0707820
707 Ga0495640_0044162
708 Ga0495640_0292927
709 Ga0495640_0792976
710 Ga0495667_0027364
711 Ga0495635_0041825
712 Ga0495635_0444374
713 Ga0495635_0526453
714 Ga0495657_0030997
715 Ga0495657_0670002
716 Ga0495623_0582167
717 Ga0495647_0640304
718 Ga0495674_0356379
719 Ga0495674_0587041
720 Ga0495672_0022595
721 Ga0495680_0067950
722 Ga0495680_0487031
723 Ga0495684_0844825
724 Ga0495686_0344899
725 Ga0495602_0879552
726 Ga0495614_0607299
727 Ga0496101_0457215
728 Ga0496102_0004824
729 Ga0496103_0018874
730 Ga0496104_0064992
731 Ga0496105_0225479
732 Ga0496106_0052573
733 Ga0496106_0059895
734 Ga0496107_1235860
735 Ga0496108_0254599
736 Ga0496108_1641969
737 Ga0496109_0033091
738 Ga0496110_0006081
739 Ga0496111_0018654
740 Ga0496111_0891204
741 Ga0496112_0045600
742 Ga0496113_0019820
743 Ga0496113_0845301
744 Ga0496114_0752603
745 Ga0496121_0724146
746 Ga0496126_0159287
747 Ga0501305_092268
748 Ga0501291_140778
749 Ga0501298_055043
750 Ga0501299_199698
751 Ga0501031_0269126
752 Ga0501032_0070345
753 Ga0501033_0489121
754 Ga0501034_1673091
755 Ga0501036_0280581
756 Ga0501037_0139227
757 Ga0501037_0786190
758 Ga0501038_0118193
759 Ga0501039_0004433
760 Ga0501039_0756649
761 Ga0501040_0169922
762 Ga0501040_0318026
763 Ga0501040_1030928
764 Ga0501041_0067128
765 Ga0501041_0807236
766 Ga0501041_1113754
767 Ga0501042_0015733
768 Ga0501042_0253930
769 Ga0501042_0353474
770 Ga0501043_0048185
771 Ga0501046_0435820
772 Ga0501046_0665314
773 Ga0501048_0077289
774 Ga0501048_0634743
775 Ga0501048_0838045
776 Ga0501068_0409415
777 Ga0501068_0818676
778 Ga0501069_0745733
779 Ga0501070_0255505
780 Ga0501071_0005047
781 Ga0501071_0366678
782 Ga0501072_0030282
783 Ga0501072_0212954
784 Ga0501073_0327238
785 Ga0501074_0182379
786 Ga0501075_0097546
787 Ga0501075_0120114
788 Ga0501076_0212057
789 Ga0501076_0240111
790 Ga0501076_0555354
791 Ga0501076_0706033
792 Ga0501076_1786144
793 Ga0501077_0083889
794 Ga0501077_0536791
795 Ga0501077_0839037
796 Ga0501216_167153
797 Ga0501259_143632
798 Ga0501079_0152164
799 Ga0501079_0555063
800 Ga0501079_1028103
801 Ga0501079_1061814
802 Ga0501080_0117591
803 Ga0501081_0029705
804 Ga0501081_0419238
805 Ga0501081_0950509
806 Ga0501083_0159867
807 Ga0501035_0131252
808 Ga0501045_0026500
809 Ga0501045_0458729
810 Ga0501045_1039555
811 Ga0501045_1419918
812 nmdc:mga05p37_1688646_c1
813 nmdc:mga05p37_1694205_c1
814 nmdc:mga05p37_265281_c1
815 nmdc:mga09592_124072_c1
816 nmdc:mga09592_39023_c1
817 nmdc:mga09592_829912_c1
818 nmdc:mga0qj67_11457_c1
819 nmdc:mga0qj67_61840_c1
820 nmdc:mga06r32_141532_c1
821 nmdc:mga06r32_1714701_c1
822 nmdc:mga06r32_347827_c1
823 nmdc:mga08y16_25365_c1
824 nmdc:mga08y16_29325_c1
825 nmdc:mga0n895_1591938_c1
826 nmdc:mga0n895_975312_c1
827 nmdc:mga0rr50_592332_c1
828 nmdc:mga0a205_192145_c1
829 nmdc:mga0a205_339087_c1
830 Ga0495601_0019900
831 Ga0495612_0397971
832 Ga0495595_0008901
833 Ga0495619_0002987
834 Ga0495619_0492027
835 Ga0495619_0538381
836 Ga0500578_0033160
837 Ga0500645_004999
838 Ga0501084_0008240
839 Ga0501084_0520372
840 Ga0501084_1225826
841 Ga0501084_1825992
842 Ga0501082_0127392
843 Ga0501082_1926742
844 Ga0530510_0137725
845 Ga0530510_0878111
846 Ga0530510_1500932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19451

DUF5989

Family of unknown function (DUF5989)

2

49

0.97

Map