F440734

General Info

Members Datasets Scaffolds Average Seq Length
424 223 848 138

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100068930|Ga0075436_1000689302
Length 149
Sequence VIFDPSRDQVRDIFFEAWRKYRTGTPLVGIETIALDVILAHPEYHAILSDPERNRTKDYVDEGNPFLHMSLHVALEEQLSIDQPPGIAQGFRALVQRHGERHKALHEAIECLAETMWRAQRDKMPPDAAAYLECLARRGGAGKGRPRTD

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
148 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
151 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
152 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
153 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
154 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
155 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
156 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
157 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
158 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
159 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
160 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
180 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
181 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
202 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
203 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
204 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 0.24
Rhizosphere 99.29
Stem 0
Stem Tuber 0
Unclassified 2.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100068930 3300006914 Bacteria 2444
2 JGI24750J21931_1010936 3300002070 Bacteria 1188
3 JGI25406J46586_10063759 3300003203 Bacteria 1180
4 Ga0065707_10038496 3300005295 Bacteria 1224
5 Ga0065707_10236636 3300005295 Bacteria 1163
6 Ga0070676_10031954 3300005328 Bacteria 3013
7 Ga0070683_100119265 3300005329 Bacteria 2492
8 Ga0070690_100000131 3300005330 Bacteria 38893
9 Ga0070690_100241638 3300005330 Bacteria 1274
10 Ga0070670_100432186 3300005331 Bacteria 1165
11 Ga0070677_10057580 3300005333 Bacteria 1593
12 Ga0068869_100000392 3300005334 Bacteria 23853
13 Ga0070666_10862951 3300005335 Bacteria 668
14 Ga0070680_100002214 3300005336 Bacteria 14332
15 Ga0070680_100133296 3300005336 Bacteria 2080
16 Ga0070680_100303446 3300005336 Bacteria 1354
17 Ga0070680_100899893 3300005336 Bacteria 764
18 Ga0070682_100001688 3300005337 Bacteria 12256
19 Ga0068868_100000656 3300005338 Bacteria 23322
20 Ga0068868_100528158 3300005338 Bacteria 1037
21 Ga0068868_100683392 3300005338 Bacteria 917
22 Ga0068868_101805649 3300005338 Bacteria 578
23 Ga0070689_100029541 3300005340 Bacteria 4151
24 Ga0070689_100178743 3300005340 Bacteria 1722
25 Ga0070691_10000200 3300005341 Bacteria 20142
26 Ga0070687_100000175 3300005343 Bacteria 22196
27 Ga0070687_100063181 3300005343 Bacteria 1963
28 Ga0070687_100065399 3300005343 Bacteria 1935
29 Ga0070687_101147058 3300005343 Bacteria 571
30 Ga0070692_10012378 3300005345 Bacteria 3947
31 Ga0070692_10020997 3300005345 Bacteria 3173
32 Ga0070692_10094424 3300005345 Bacteria 1630
33 Ga0070692_10285594 3300005345 Bacteria 1002
34 Ga0070668_100194369 3300005347 Bacteria 1663
35 Ga0070669_100015857 3300005353 Bacteria 5375
36 Ga0070669_100342431 3300005353 Bacteria 1212
37 Ga0070675_100095634 3300005354 Bacteria 2494
38 Ga0070675_100850622 3300005354 Bacteria 835
39 Ga0070671_100128595 3300005355 Bacteria 2133
40 Ga0070673_100086242 3300005364 Bacteria 2558
41 Ga0070673_100135874 3300005364 Bacteria 2069
42 Ga0070688_100249381 3300005365 Bacteria 1263
43 Ga0070703_10015984 3300005406 Bacteria 2151
44 Ga0070703_10018705 3300005406 Bacteria 2006
45 Ga0070703_10083914 3300005406 Bacteria 1091
46 Ga0070709_10496084 3300005434 Bacteria 927
47 Ga0070701_10000676 3300005438 Bacteria 12013
48 Ga0070701_10351503 3300005438 Bacteria 921
49 Ga0070701_10785786 3300005438 Bacteria 648
50 Ga0070711_101203331 3300005439 Bacteria 655
51 Ga0070705_100000431 3300005440 Bacteria 24090
52 Ga0070705_100006449 3300005440 Bacteria 5755
53 Ga0070705_100017527 3300005440 Bacteria 3739
54 Ga0070705_100034464 3300005440 Bacteria 2830
55 Ga0070700_100000587 3300005441 Bacteria 18243
56 Ga0070700_100010108 3300005441 Bacteria 5197
57 Ga0070700_100190841 3300005441 Bacteria 1432
58 Ga0070700_101006156 3300005441 Bacteria 685
59 Ga0070694_100000136 3300005444 Bacteria 36787
60 Ga0070694_100017654 3300005444 Bacteria 4510
61 Ga0070694_100019250 3300005444 Bacteria 4340
62 Ga0070694_100341538 3300005444 Bacteria 1158
63 Ga0070708_100535590 3300005445 Bacteria 1105
64 Ga0070678_100402941 3300005456 Bacteria 1189
65 Ga0070678_101036661 3300005456 Bacteria 755
66 Ga0070662_100575693 3300005457 Bacteria 945
67 Ga0070681_10014173 3300005458 Bacteria 7935
68 Ga0070681_10143612 3300005458 Bacteria 2316
69 Ga0068867_100001154 3300005459 Bacteria 18064
70 Ga0068867_100010882 3300005459 Bacteria 6417
71 Ga0068867_101089973 3300005459 Bacteria 729
72 Ga0070706_101069821 3300005467 Bacteria 743
73 Ga0070707_100743750 3300005468 Bacteria 944
74 Ga0070707_102033604 3300005468 Bacteria 542
75 Ga0070699_100073341 3300005518 Bacteria 2978
76 Ga0070699_100945514 3300005518 Unclassified 790
77 Ga0070679_100009411 3300005530 Bacteria 9240
78 Ga0070679_100130961 3300005530 Bacteria 2490
79 Ga0070684_100324261 3300005535 Bacteria 1415
80 Ga0070697_100116301 3300005536 Bacteria 2233
81 Ga0070697_100272853 3300005536 Bacteria 1450
82 Ga0070697_101346753 3300005536 Bacteria 637
83 Ga0070686_100000285 3300005544 Bacteria 34108
84 Ga0070686_100014887 3300005544 Bacteria 4491
85 Ga0070686_100376716 3300005544 Bacteria 1073
86 Ga0070695_100000705 3300005545 Bacteria 17853
87 Ga0070695_100006949 3300005545 Bacteria 6705
88 Ga0070695_100081935 3300005545 Bacteria 2136
89 Ga0070695_100211661 3300005545 Bacteria 1392
90 Ga0070695_101321440 3300005545 Bacteria 596
91 Ga0070696_100002173 3300005546 Bacteria 12924
92 Ga0070696_100007742 3300005546 Bacteria 7169
93 Ga0070696_100014585 3300005546 Bacteria 5275
94 Ga0070696_100075213 3300005546 Bacteria 2382
95 Ga0070696_100227521 3300005546 Bacteria 1402
96 Ga0070696_101005316 3300005546 Bacteria 697
97 Ga0070693_100000278 3300005547 Bacteria 24050
98 Ga0070704_100000103 3300005549 Bacteria 29844
99 Ga0070704_100085755 3300005549 Bacteria 2332
100 Ga0070704_100268288 3300005549 Bacteria 1409
101 Ga0070704_100458762 3300005549 Bacteria 1099
102 Ga0070704_100736544 3300005549 Bacteria 877
103 Ga0070664_101661832 3300005564 Bacteria 605
104 Ga0068857_100746963 3300005577 Bacteria 932
105 Ga0068854_100548463 3300005578 Bacteria 980
106 Ga0070702_100000039 3300005615 Bacteria 35203
107 Ga0070702_100078795 3300005615 Bacteria 1967
108 Ga0070702_100471804 3300005615 Bacteria 915
109 Ga0068852_100014459 3300005616 Bacteria 6079
110 Ga0068859_100413224 3300005617 Bacteria 1445
111 Ga0068859_101100525 3300005617 Bacteria 874
112 Ga0068859_101701636 3300005617 Bacteria 697
113 Ga0068866_10046525 3300005718 Bacteria 2183
114 Ga0068861_100012984 3300005719 Bacteria 5819
115 Ga0068861_100450944 3300005719 Bacteria 1153
116 Ga0068870_10049778 3300005840 Bacteria 2211
117 Ga0068860_101128462 3300005843 Bacteria 804
118 Ga0068860_102369643 3300005843 Bacteria 551
119 Ga0068862_100024739 3300005844 Bacteria 5039
120 Ga0068862_101536608 3300005844 Bacteria 672
121 Ga0081539_10000668 3300005985 Bacteria 68754
122 Ga0070715_10040898 3300006163 Bacteria 1940
123 Ga0070716_100215641 3300006173 Bacteria 1286
124 Ga0070716_101825068 3300006173 Bacteria 504
125 Ga0075366_10240302 3300006195 Bacteria 1104
126 Ga0097621_100083009 3300006237 Bacteria 2669
127 Ga0068871_100003849 3300006358 Bacteria 10344
128 Ga0068871_100003878 3300006358 Bacteria 10311
129 Ga0075428_100004852 3300006844 Bacteria 14923
130 Ga0075428_100059461 3300006844 Bacteria 4185
131 Ga0075428_100301577 3300006844 Bacteria 1722
132 Ga0075428_100912349 3300006844 Bacteria 932
133 Ga0075430_100054863 3300006846 Bacteria 3353
134 Ga0075430_100065152 3300006846 Bacteria 3061
135 Ga0075430_100112060 3300006846 Bacteria 2274
136 Ga0075430_100307765 3300006846 Bacteria 1310
137 Ga0075430_100481674 3300006846 Bacteria 1024
138 Ga0075430_100591453 3300006846 Bacteria 915
139 Ga0075431_100123305 3300006847 Bacteria 2673
140 Ga0075431_100141407 3300006847 Bacteria 2481
141 Ga0075431_100640187 3300006847 Bacteria 1044
142 Ga0075434_100181944 3300006871 Bacteria 2122
143 Ga0075434_101632422 3300006871 Bacteria 653
144 Ga0075429_100053570 3300006880 Bacteria 3510
145 Ga0075429_100135239 3300006880 Bacteria 2157
146 Ga0075429_100156228 3300006880 Bacteria 1997
147 Ga0075429_100757595 3300006880 Bacteria 850
148 Ga0068865_100005559 3300006881 Bacteria 7642
149 Ga0075436_100001949 3300006914 Bacteria 14215
150 Ga0075436_100032359 3300006914 Bacteria 3604
151 Ga0075436_100192615 3300006914 Bacteria 1443
152 Ga0097620_100413223 3300006931 Bacteria 1445
153 Ga0097620_101100650 3300006931 Bacteria 874
154 Ga0097620_101701842 3300006931 Bacteria 697
155 Ga0075435_100033247 3300007076 Bacteria 4076
156 Ga0075435_100035110 3300007076 Bacteria 3978
157 Ga0075435_100122957 3300007076 Bacteria 2167
158 Ga0075435_100299099 3300007076 Bacteria 1376
159 Ga0111539_10189146 3300009094 Bacteria 2403
160 Ga0111539_10352133 3300009094 Bacteria 1714
161 Ga0111539_10887895 3300009094 Bacteria 1037
162 Ga0111539_11754782 3300009094 Bacteria 720
163 Ga0114129_10053400 3300009147 Bacteria 5667
164 Ga0114129_10256426 3300009147 Bacteria 2346
165 Ga0114129_10456874 3300009147 Bacteria 1674
166 Ga0114129_11720789 3300009147 Bacteria 765
167 Ga0105243_10008512 3300009148 Bacteria 7872
168 Ga0105248_11235988 3300009177 Bacteria 845
169 Ga0105248_12030646 3300009177 Bacteria 653
170 Ga0105249_10047725 3300009553 Bacteria 3903
171 Ga0099796_10485921 3300010159 Bacteria 552
172 Ga0105246_10720646 3300011119 Bacteria 876
173 Ga0157378_10265197 3300013297 Bacteria 1649
174 Ga0163162_11101497 3300013306 Bacteria 900
175 Ga0157380_10021521 3300014326 Bacteria 4838
176 Ga0157380_11021305 3300014326 Bacteria 861
177 Ga0157380_12259688 3300014326 Bacteria 608
178 Ga0157377_10392606 3300014745 Bacteria 943
179 Ga0157377_11039450 3300014745 Bacteria 623
180 Ga0157376_10138766 3300014969 Bacteria 2178
181 Ga0163161_10213838 3300017792 Bacteria 1490
182 Ga0207653_10015400 3300025885 Bacteria 2399
183 Ga0207692_10647158 3300025898 Bacteria 683
184 Ga0207642_10000130 3300025899 Bacteria 20678
185 Ga0207642_10020202 3300025899 Bacteria 2595
186 Ga0207680_10601182 3300025903 Bacteria 787
187 Ga0207645_10073707 3300025907 Bacteria 2185
188 Ga0207645_10392973 3300025907 Bacteria 932
189 Ga0207643_10072696 3300025908 Bacteria 1981
190 Ga0207707_10194727 3300025912 Bacteria 1768
191 Ga0207707_10327504 3300025912 Bacteria 1322
192 Ga0207660_10159769 3300025917 Bacteria 1738
193 Ga0207660_10163138 3300025917 Bacteria 1721
194 Ga0207660_10184023 3300025917 Bacteria 1624
195 Ga0207660_10502929 3300025917 Bacteria 983
196 Ga0207662_10030275 3300025918 Bacteria 3140
197 Ga0207662_10161172 3300025918 Bacteria 1433
198 Ga0207652_10102482 3300025921 Bacteria 2530
199 Ga0207652_11594638 3300025921 Unclassified 557
200 Ga0207646_11323089 3300025922 Bacteria 629
201 Ga0207681_10002427 3300025923 Bacteria 11816
202 Ga0207650_11442388 3300025925 Bacteria 585
203 Ga0207659_10029828 3300025926 Bacteria 3721
204 Ga0207709_10003995 3300025935 Bacteria 8600
205 Ga0207670_10443276 3300025936 Bacteria 1046
206 Ga0207670_11494602 3300025936 Bacteria 574
207 Ga0207669_10119378 3300025937 Bacteria 1786
208 Ga0207704_10014155 3300025938 Bacteria 4020
209 Ga0207691_10098685 3300025940 Bacteria 2609
210 Ga0207689_10058738 3300025942 Bacteria 3164
211 Ga0207667_10010601 3300025949 Bacteria 10766
212 Ga0207651_10573718 3300025960 Bacteria 983
213 Ga0207651_11310325 3300025960 Bacteria 651
214 Ga0207712_10007895 3300025961 Bacteria 6722
215 Ga0207712_10024528 3300025961 Bacteria 3996
216 Ga0207668_10017311 3300025972 Bacteria 4513
217 Ga0207640_10470363 3300025981 Bacteria 1040
218 Ga0207677_10000832 3300026023 Bacteria 17660
219 Ga0207677_10054259 3300026023 Bacteria 2734
220 Ga0207677_11041084 3300026023 Bacteria 744
221 Ga0207708_10010641 3300026075 Bacteria 6832
222 Ga0207708_10031046 3300026075 Bacteria 4055
223 Ga0207708_10095722 3300026075 Bacteria 2293
224 Ga0207708_10823786 3300026075 Bacteria 800
225 Ga0207708_10999037 3300026075 Bacteria 727
226 Ga0207708_11278330 3300026075 Bacteria 642
227 Ga0207648_10018475 3300026089 Bacteria 6311
228 Ga0207648_10087272 3300026089 Bacteria 2723
229 Ga0207674_10102984 3300026116 Bacteria 2834
230 Ga0207675_100002436 3300026118 Bacteria 18434
231 Ga0207683_10066954 3300026121 Bacteria 3168
232 Ga0209996_1024114 3300027395 Bacteria 866
233 Ga0210000_1006927 3300027462 Bacteria 1654
234 Ga0209968_1009493 3300027526 Bacteria 1489
235 Ga0209999_1014189 3300027543 Bacteria 1446
236 Ga0209971_1032183 3300027682 Bacteria 1258
237 Ga0209966_1005888 3300027695 Bacteria 2116
238 Ga0209974_10125983 3300027876 Bacteria 910
239 Ga0209974_10214463 3300027876 Bacteria 715
240 Ga0207428_10003903 3300027907 Bacteria 14300
241 Ga0268265_10010254 3300028380 Bacteria 6328
242 Ga0268265_10724499 3300028380 Bacteria 963
243 Ga0268264_11037299 3300028381 Bacteria 827
244 Ga0307408_100179916 3300031548 Bacteria 1695
245 Ga0307408_101997625 3300031548 Bacteria 557
246 Ga0316575_10035868 3300031665 Bacteria 1950
247 Ga0307405_10265825 3300031731 Bacteria 1284
248 Ga0307405_10833380 3300031731 Bacteria 775
249 Ga0307406_11193984 3300031901 Bacteria 660
250 Ga0307412_10306658 3300031911 Bacteria 1257
251 Ga0307412_10415050 3300031911 Bacteria 1100
252 Ga0307412_11616498 3300031911 Bacteria 592
253 Ga0307416_100075310 3300032002 Bacteria 2824
254 Ga0307416_100273505 3300032002 Bacteria 1660
255 Ga0307416_100411050 3300032002 Bacteria 1394
256 Ga0307416_100497717 3300032002 Bacteria 1282
257 Ga0307416_102202767 3300032002 Bacteria 652
258 Ga0307411_10188353 3300032005 Bacteria 1573
259 Ga0316583_10001277 3300032133 Bacteria 8312
260 Ga0373934_0093965 3300035086 Bacteria 1210
261 Ga0373932_0184078 3300035112 Bacteria 735
262 Ga0373941_0000748 3300035115 Bacteria 6656
263 Ga0373960_0008621 3300035121 Bacteria 2448
264 Ga0373960_0254583 3300035121 Bacteria 639
265 Ga0373955_0028700 3300035172 Bacteria 2887
266 Ga0373961_0019745 3300035241 Bacteria 1773
267 Ga0373961_0055713 3300035241 Bacteria 1185
268 Ga0373961_0222277 3300035241 Bacteria 674
269 Ga0373962_0297746 3300035242 Bacteria 572
270 Ga0373924_0001386 3300035410 Bacteria 7846
271 Ga0373924_0116846 3300035410 Unclassified 1156
272 Ga0373931_0001537 3300035691 Bacteria 9951
273 Ga0373931_0183241 3300035691 Bacteria 1241
274 Ga0373931_0793666 3300035691 Bacteria 631
275 Ga0373935_0049001 3300035692 Bacteria 2677
276 Ga0373935_1418643 3300035692 Bacteria 519
277 Ga0373933_0103172 3300035724 Bacteria 1771
278 Ga0373933_0239253 3300035724 Bacteria 1167
279 Ga0373937_0026363 3300036401 Bacteria 5252
280 Ga0373937_0528436 3300036401 Bacteria 1121
281 Ga0439439_0152415 3300041406 Bacteria 657
282 Ga0439453_0044636 3300041408 Bacteria 879
283 Ga0451807_2032181 3300041486 Bacteria 779
284 Ga0451849_0775145 3300041505 Bacteria 753
285 Ga0439441_029196 3300042001 Bacteria 1060
286 Ga0439443_001559 3300042003 Bacteria 2564
287 Ga0439443_009726 3300042003 Bacteria 1384
288 Ga0439454_012410 3300042011 Bacteria 1156
289 Ga0439456_008760 3300042013 Bacteria 2091
290 Ga0439446_0038738 3300042156 Bacteria 1398
291 Ga0439434_0181569 3300042435 Bacteria 705
292 Ga0439435_0000065 3300042436 Bacteria 12662
293 Ga0439435_0000074 3300042436 Bacteria 11894
294 Ga0439435_0005893 3300042436 Bacteria 2724
295 Ga0439444_0002572 3300042437 Bacteria 2491
296 Ga0439444_0005522 3300042437 Bacteria 1879
297 Ga0439460_0001066 3300042461 Bacteria 6388
298 Ga0439460_0018708 3300042461 Bacteria 1868
299 Ga0450893_0040822 3300042532 Bacteria 850
300 Ga0451577_0333565 3300042876 Bacteria 1375
301 Ga0451577_0396193 3300042876 Bacteria 1253
302 Ga0453683_0096566 3300044673 Bacteria 1854
303 Ga0466960_0395590 3300044901 Bacteria 795
304 Ga0451576_0014808 3300045051 Bacteria 8668
305 Ga0451576_0142927 3300045051 Bacteria 2495
306 Ga0451576_1937276 3300045051 Bacteria 608
307 Ga0466967_0008390 3300045976 Bacteria 7562
308 Ga0495603_0709335 3300046455 Bacteria 575
309 Ga0495642_0201549 3300046528 Bacteria 868
310 Ga0495642_0305939 3300046528 Bacteria 697
311 Ga0495587_0401342 3300046536 Bacteria 762
312 Ga0495598_0090209 3300046537 Bacteria 998
313 Ga0495621_0102896 3300046539 Bacteria 1088
314 Ga0495645_0534038 3300046543 Bacteria 729
315 Ga0495667_0236905 3300046559 Bacteria 1163
316 Ga0495635_0281069 3300046663 Bacteria 1118
317 Ga0495659_0014714 3300046664 Bacteria 2566
318 Ga0495599_0649654 3300046678 Bacteria 611
319 Ga0495623_0254274 3300046679 Bacteria 987
320 Ga0495589_0420078 3300046794 Bacteria 613
321 Ga0495680_0339854 3300047322 Bacteria 1047
322 Ga0501291_116588 3300049514 Unclassified 575
323 Ga0501298_062712 3300049521 Bacteria 790
324 Ga0501298_063861 3300049521 Bacteria 784
325 Ga0501299_049747 3300049522 Bacteria 863
326 Ga0501031_0010790 3300049568 Bacteria 5951
327 Ga0501033_0391958 3300049570 Bacteria 969
328 Ga0501036_0055078 3300049572 Bacteria 3369
329 Ga0501036_0254783 3300049572 Bacteria 1470
330 Ga0501036_0700720 3300049572 Bacteria 837
331 Ga0501037_0552908 3300049573 Bacteria 777
332 Ga0501037_0826245 3300049573 Bacteria 611
333 Ga0501038_0170051 3300049574 Bacteria 1765
334 Ga0501038_0484105 3300049574 Bacteria 948
335 Ga0501039_0040310 3300049575 Bacteria 3605
336 Ga0501039_0136991 3300049575 Bacteria 1922
337 Ga0501040_0045845 3300049576 Bacteria 2983
338 Ga0501040_0052164 3300049576 Bacteria 2799
339 Ga0501040_0103977 3300049576 Bacteria 1983
340 Ga0501040_0260181 3300049576 Bacteria 1238
341 Ga0501041_0039174 3300049577 Bacteria 2876
342 Ga0501041_0040145 3300049577 Bacteria 2840
343 Ga0501042_0110831 3300049578 Bacteria 1976
344 Ga0501042_0137657 3300049578 Bacteria 1760
345 Ga0501042_0864178 3300049578 Bacteria 659
346 Ga0501046_0042277 3300049580 Bacteria 3634
347 Ga0501046_0219824 3300049580 Bacteria 1407
348 Ga0501046_0388842 3300049580 Unclassified 1009
349 Ga0501048_0058331 3300049582 Bacteria 2736
350 Ga0501048_0209799 3300049582 Bacteria 1381
351 Ga0501067_0178620 3300049583 Bacteria 1182
352 Ga0501069_0137665 3300049585 Bacteria 1400
353 Ga0501069_0288673 3300049585 Unclassified 961
354 Ga0501071_0012679 3300049587 Bacteria 5729
355 Ga0501071_0051614 3300049587 Bacteria 2964
356 Ga0501071_0144948 3300049587 Bacteria 1770
357 Ga0501071_0342964 3300049587 Bacteria 1136
358 Ga0501071_0499647 3300049587 Bacteria 933
359 Ga0501072_0174034 3300049588 Bacteria 1717
360 Ga0501072_0216855 3300049588 Bacteria 1525
361 Ga0501072_0309570 3300049588 Bacteria 1256
362 Ga0501074_0149177 3300049590 Bacteria 1672
363 Ga0501075_0005270 3300049591 Bacteria 8835
364 Ga0501076_0007316 3300049592 Bacteria 8032
365 Ga0501076_0598155 3300049592 Unclassified 910
366 Ga0501076_0600255 3300049592 Bacteria 908
367 Ga0501077_0143196 3300049593 Bacteria 1516
368 Ga0501199_023957 3300049650 Bacteria 722
369 Ga0501216_189068 3300049660 Bacteria 505
370 Ga0501217_116284 3300049661 Bacteria 773
371 Ga0501235_096075 3300049669 Bacteria 720
372 Ga0501079_0146625 3300049741 Bacteria 1839
373 Ga0501079_0568836 3300049741 Bacteria 892
374 Ga0501079_1457566 3300049741 Bacteria 539
375 Ga0501080_0147586 3300049742 Bacteria 2174
376 Ga0501080_1092485 3300049742 Bacteria 689
377 Ga0501081_0028596 3300049743 Bacteria 3762
378 Ga0501081_0364196 3300049743 Bacteria 1067
379 Ga0501081_0524028 3300049743 Bacteria 884
380 Ga0501081_0970087 3300049743 Bacteria 642
381 Ga0501035_0215353 3300049822 Bacteria 1642
382 Ga0501035_0273613 3300049822 Bacteria 1429
383 Ga0501035_1318625 3300049822 Bacteria 556
384 Ga0501044_0037382 3300049823 Bacteria 5075
385 Ga0501045_0024692 3300049824 Bacteria 4316
386 Ga0501045_0683296 3300049824 Bacteria 758
387 nmdc:mga05p37_113873_c1 3300050507 Bacteria 3325
388 nmdc:mga05p37_2162331_c1 3300050507 Unclassified 518
389 nmdc:mga05p37_562306_c1 3300050507 Bacteria 1296
390 nmdc:mga09592_128175_c1 3300050508 Bacteria 2182
391 nmdc:mga09592_130097_c1 3300050508 Bacteria 2166
392 nmdc:mga09592_278536_c1 3300050508 Bacteria 1451
393 nmdc:mga09592_63954_c1 3300050508 Bacteria 3115
394 nmdc:mga0qj67_170540_c1 3300050509 Bacteria 1767
395 nmdc:mga0qj67_229367_c1 3300050509 Bacteria 1507
396 nmdc:mga0qj67_34440_c1 3300050509 Bacteria 3956
397 nmdc:mga0qj67_509093_c1 3300050509 Unclassified 968
398 nmdc:mga0qj67_90228_c1 3300050509 Bacteria 2462
399 nmdc:mga06r32_1449286_c1 3300050510 Bacteria 628
400 nmdc:mga06r32_1476794_c1 3300050510 Bacteria 620
401 nmdc:mga06r32_174460_c1 3300050510 Bacteria 2134
402 nmdc:mga06r32_483110_c1 3300050510 Bacteria 1217
403 nmdc:mga06r32_899751_c1 3300050510 Bacteria 842
404 nmdc:mga08y16_1102614_c1 3300050511 Bacteria 769
405 nmdc:mga08y16_1503758_c1 3300050511 Bacteria 634
406 nmdc:mga08y16_156389_c1 3300050511 Bacteria 2369
407 nmdc:mga08y16_491614_c1 3300050511 Bacteria 1248
408 nmdc:mga08y16_622320_c1 3300050511 Bacteria 1086
409 nmdc:mga0n895_278687_c1 3300050512 Bacteria 1696
410 nmdc:mga0n895_332141_c1 3300050512 Bacteria 1540
411 nmdc:mga0rr50_1667146_c1 3300050513 Bacteria 538
412 nmdc:mga0rr50_28546_c1 3300050513 Bacteria 3923
413 nmdc:mga0rr50_85593_c1 3300050513 Bacteria 2443
414 nmdc:mga08x19_137367_c1 3300050514 Bacteria 1649
415 nmdc:mga08x19_199819_c1 3300050514 Bacteria 1370
416 nmdc:mga08x19_47577_c1 3300050514 Bacteria 2746
417 nmdc:mga08x19_53416_c1 3300050514 Bacteria 2600
418 nmdc:mga08x19_58156_c1 3300050514 Bacteria 2500
419 nmdc:mga0a205_205712_c1 3300050515 Bacteria 1857
420 Ga0501084_0113815 3300054114 Bacteria 2274
421 Ga0501084_0497462 3300054114 Bacteria 1030
422 Ga0590075_085950 3300059424 Bacteria 816
423 Ga0501082_0131870 3300060353 Bacteria 2168
424 Ga0530510_0005787 3300061734 Bacteria 8569
425 Ga0075436_100068930
426 JGI24750J21931_1010936
427 JGI25406J46586_10063759
428 Ga0065707_10038496
429 Ga0065707_10236636
430 Ga0070676_10031954
431 Ga0070683_100119265
432 Ga0070690_100000131
433 Ga0070690_100241638
434 Ga0070670_100432186
435 Ga0070677_10057580
436 Ga0068869_100000392
437 Ga0070666_10862951
438 Ga0070680_100002214
439 Ga0070680_100133296
440 Ga0070680_100303446
441 Ga0070680_100899893
442 Ga0070682_100001688
443 Ga0068868_100000656
444 Ga0068868_100528158
445 Ga0068868_100683392
446 Ga0068868_101805649
447 Ga0070689_100029541
448 Ga0070689_100178743
449 Ga0070691_10000200
450 Ga0070687_100000175
451 Ga0070687_100063181
452 Ga0070687_100065399
453 Ga0070687_101147058
454 Ga0070692_10012378
455 Ga0070692_10020997
456 Ga0070692_10094424
457 Ga0070692_10285594
458 Ga0070668_100194369
459 Ga0070669_100015857
460 Ga0070669_100342431
461 Ga0070675_100095634
462 Ga0070675_100850622
463 Ga0070671_100128595
464 Ga0070673_100086242
465 Ga0070673_100135874
466 Ga0070688_100249381
467 Ga0070703_10015984
468 Ga0070703_10018705
469 Ga0070703_10083914
470 Ga0070709_10496084
471 Ga0070701_10000676
472 Ga0070701_10351503
473 Ga0070701_10785786
474 Ga0070711_101203331
475 Ga0070705_100000431
476 Ga0070705_100006449
477 Ga0070705_100017527
478 Ga0070705_100034464
479 Ga0070700_100000587
480 Ga0070700_100010108
481 Ga0070700_100190841
482 Ga0070700_101006156
483 Ga0070694_100000136
484 Ga0070694_100017654
485 Ga0070694_100019250
486 Ga0070694_100341538
487 Ga0070708_100535590
488 Ga0070678_100402941
489 Ga0070678_101036661
490 Ga0070662_100575693
491 Ga0070681_10014173
492 Ga0070681_10143612
493 Ga0068867_100001154
494 Ga0068867_100010882
495 Ga0068867_101089973
496 Ga0070706_101069821
497 Ga0070707_100743750
498 Ga0070707_102033604
499 Ga0070699_100073341
500 Ga0070699_100945514
501 Ga0070679_100009411
502 Ga0070679_100130961
503 Ga0070684_100324261
504 Ga0070697_100116301
505 Ga0070697_100272853
506 Ga0070697_101346753
507 Ga0070686_100000285
508 Ga0070686_100014887
509 Ga0070686_100376716
510 Ga0070695_100000705
511 Ga0070695_100006949
512 Ga0070695_100081935
513 Ga0070695_100211661
514 Ga0070695_101321440
515 Ga0070696_100002173
516 Ga0070696_100007742
517 Ga0070696_100014585
518 Ga0070696_100075213
519 Ga0070696_100227521
520 Ga0070696_101005316
521 Ga0070693_100000278
522 Ga0070704_100000103
523 Ga0070704_100085755
524 Ga0070704_100268288
525 Ga0070704_100458762
526 Ga0070704_100736544
527 Ga0070664_101661832
528 Ga0068857_100746963
529 Ga0068854_100548463
530 Ga0070702_100000039
531 Ga0070702_100078795
532 Ga0070702_100471804
533 Ga0068852_100014459
534 Ga0068859_100413224
535 Ga0068859_101100525
536 Ga0068859_101701636
537 Ga0068866_10046525
538 Ga0068861_100012984
539 Ga0068861_100450944
540 Ga0068870_10049778
541 Ga0068860_101128462
542 Ga0068860_102369643
543 Ga0068862_100024739
544 Ga0068862_101536608
545 Ga0081539_10000668
546 Ga0070715_10040898
547 Ga0070716_100215641
548 Ga0070716_101825068
549 Ga0075366_10240302
550 Ga0097621_100083009
551 Ga0068871_100003849
552 Ga0068871_100003878
553 Ga0075428_100004852
554 Ga0075428_100059461
555 Ga0075428_100301577
556 Ga0075428_100912349
557 Ga0075430_100054863
558 Ga0075430_100065152
559 Ga0075430_100112060
560 Ga0075430_100307765
561 Ga0075430_100481674
562 Ga0075430_100591453
563 Ga0075431_100123305
564 Ga0075431_100141407
565 Ga0075431_100640187
566 Ga0075434_100181944
567 Ga0075434_101632422
568 Ga0075429_100053570
569 Ga0075429_100135239
570 Ga0075429_100156228
571 Ga0075429_100757595
572 Ga0068865_100005559
573 Ga0075436_100001949
574 Ga0075436_100032359
575 Ga0075436_100192615
576 Ga0097620_100413223
577 Ga0097620_101100650
578 Ga0097620_101701842
579 Ga0075435_100033247
580 Ga0075435_100035110
581 Ga0075435_100122957
582 Ga0075435_100299099
583 Ga0111539_10189146
584 Ga0111539_10352133
585 Ga0111539_10887895
586 Ga0111539_11754782
587 Ga0114129_10053400
588 Ga0114129_10256426
589 Ga0114129_10456874
590 Ga0114129_11720789
591 Ga0105243_10008512
592 Ga0105248_11235988
593 Ga0105248_12030646
594 Ga0105249_10047725
595 Ga0099796_10485921
596 Ga0105246_10720646
597 Ga0157378_10265197
598 Ga0163162_11101497
599 Ga0157380_10021521
600 Ga0157380_11021305
601 Ga0157380_12259688
602 Ga0157377_10392606
603 Ga0157377_11039450
604 Ga0157376_10138766
605 Ga0163161_10213838
606 Ga0207653_10015400
607 Ga0207692_10647158
608 Ga0207642_10000130
609 Ga0207642_10020202
610 Ga0207680_10601182
611 Ga0207645_10073707
612 Ga0207645_10392973
613 Ga0207643_10072696
614 Ga0207707_10194727
615 Ga0207707_10327504
616 Ga0207660_10159769
617 Ga0207660_10163138
618 Ga0207660_10184023
619 Ga0207660_10502929
620 Ga0207662_10030275
621 Ga0207662_10161172
622 Ga0207652_10102482
623 Ga0207652_11594638
624 Ga0207646_11323089
625 Ga0207681_10002427
626 Ga0207650_11442388
627 Ga0207659_10029828
628 Ga0207709_10003995
629 Ga0207670_10443276
630 Ga0207670_11494602
631 Ga0207669_10119378
632 Ga0207704_10014155
633 Ga0207691_10098685
634 Ga0207689_10058738
635 Ga0207667_10010601
636 Ga0207651_10573718
637 Ga0207651_11310325
638 Ga0207712_10007895
639 Ga0207712_10024528
640 Ga0207668_10017311
641 Ga0207640_10470363
642 Ga0207677_10000832
643 Ga0207677_10054259
644 Ga0207677_11041084
645 Ga0207708_10010641
646 Ga0207708_10031046
647 Ga0207708_10095722
648 Ga0207708_10823786
649 Ga0207708_10999037
650 Ga0207708_11278330
651 Ga0207648_10018475
652 Ga0207648_10087272
653 Ga0207674_10102984
654 Ga0207675_100002436
655 Ga0207683_10066954
656 Ga0209996_1024114
657 Ga0210000_1006927
658 Ga0209968_1009493
659 Ga0209999_1014189
660 Ga0209971_1032183
661 Ga0209966_1005888
662 Ga0209974_10125983
663 Ga0209974_10214463
664 Ga0207428_10003903
665 Ga0268265_10010254
666 Ga0268265_10724499
667 Ga0268264_11037299
668 Ga0307408_100179916
669 Ga0307408_101997625
670 Ga0316575_10035868
671 Ga0307405_10265825
672 Ga0307405_10833380
673 Ga0307406_11193984
674 Ga0307412_10306658
675 Ga0307412_10415050
676 Ga0307412_11616498
677 Ga0307416_100075310
678 Ga0307416_100273505
679 Ga0307416_100411050
680 Ga0307416_100497717
681 Ga0307416_102202767
682 Ga0307411_10188353
683 Ga0316583_10001277
684 Ga0373934_0093965
685 Ga0373932_0184078
686 Ga0373941_0000748
687 Ga0373960_0008621
688 Ga0373960_0254583
689 Ga0373955_0028700
690 Ga0373961_0019745
691 Ga0373961_0055713
692 Ga0373961_0222277
693 Ga0373962_0297746
694 Ga0373924_0001386
695 Ga0373924_0116846
696 Ga0373931_0001537
697 Ga0373931_0183241
698 Ga0373931_0793666
699 Ga0373935_0049001
700 Ga0373935_1418643
701 Ga0373933_0103172
702 Ga0373933_0239253
703 Ga0373937_0026363
704 Ga0373937_0528436
705 Ga0439439_0152415
706 Ga0439453_0044636
707 Ga0451807_2032181
708 Ga0451849_0775145
709 Ga0439441_029196
710 Ga0439443_001559
711 Ga0439443_009726
712 Ga0439454_012410
713 Ga0439456_008760
714 Ga0439446_0038738
715 Ga0439434_0181569
716 Ga0439435_0000065
717 Ga0439435_0000074
718 Ga0439435_0005893
719 Ga0439444_0002572
720 Ga0439444_0005522
721 Ga0439460_0001066
722 Ga0439460_0018708
723 Ga0450893_0040822
724 Ga0451577_0333565
725 Ga0451577_0396193
726 Ga0453683_0096566
727 Ga0466960_0395590
728 Ga0451576_0014808
729 Ga0451576_0142927
730 Ga0451576_1937276
731 Ga0466967_0008390
732 Ga0495603_0709335
733 Ga0495642_0201549
734 Ga0495642_0305939
735 Ga0495587_0401342
736 Ga0495598_0090209
737 Ga0495621_0102896
738 Ga0495645_0534038
739 Ga0495667_0236905
740 Ga0495635_0281069
741 Ga0495659_0014714
742 Ga0495599_0649654
743 Ga0495623_0254274
744 Ga0495589_0420078
745 Ga0495680_0339854
746 Ga0501291_116588
747 Ga0501298_062712
748 Ga0501298_063861
749 Ga0501299_049747
750 Ga0501031_0010790
751 Ga0501033_0391958
752 Ga0501036_0055078
753 Ga0501036_0254783
754 Ga0501036_0700720
755 Ga0501037_0552908
756 Ga0501037_0826245
757 Ga0501038_0170051
758 Ga0501038_0484105
759 Ga0501039_0040310
760 Ga0501039_0136991
761 Ga0501040_0045845
762 Ga0501040_0052164
763 Ga0501040_0103977
764 Ga0501040_0260181
765 Ga0501041_0039174
766 Ga0501041_0040145
767 Ga0501042_0110831
768 Ga0501042_0137657
769 Ga0501042_0864178
770 Ga0501046_0042277
771 Ga0501046_0219824
772 Ga0501046_0388842
773 Ga0501048_0058331
774 Ga0501048_0209799
775 Ga0501067_0178620
776 Ga0501069_0137665
777 Ga0501069_0288673
778 Ga0501071_0012679
779 Ga0501071_0051614
780 Ga0501071_0144948
781 Ga0501071_0342964
782 Ga0501071_0499647
783 Ga0501072_0174034
784 Ga0501072_0216855
785 Ga0501072_0309570
786 Ga0501074_0149177
787 Ga0501075_0005270
788 Ga0501076_0007316
789 Ga0501076_0598155
790 Ga0501076_0600255
791 Ga0501077_0143196
792 Ga0501199_023957
793 Ga0501216_189068
794 Ga0501217_116284
795 Ga0501235_096075
796 Ga0501079_0146625
797 Ga0501079_0568836
798 Ga0501079_1457566
799 Ga0501080_0147586
800 Ga0501080_1092485
801 Ga0501081_0028596
802 Ga0501081_0364196
803 Ga0501081_0524028
804 Ga0501081_0970087
805 Ga0501035_0215353
806 Ga0501035_0273613
807 Ga0501035_1318625
808 Ga0501044_0037382
809 Ga0501045_0024692
810 Ga0501045_0683296
811 nmdc:mga05p37_113873_c1
812 nmdc:mga05p37_2162331_c1
813 nmdc:mga05p37_562306_c1
814 nmdc:mga09592_128175_c1
815 nmdc:mga09592_130097_c1
816 nmdc:mga09592_278536_c1
817 nmdc:mga09592_63954_c1
818 nmdc:mga0qj67_170540_c1
819 nmdc:mga0qj67_229367_c1
820 nmdc:mga0qj67_34440_c1
821 nmdc:mga0qj67_509093_c1
822 nmdc:mga0qj67_90228_c1
823 nmdc:mga06r32_1449286_c1
824 nmdc:mga06r32_1476794_c1
825 nmdc:mga06r32_174460_c1
826 nmdc:mga06r32_483110_c1
827 nmdc:mga06r32_899751_c1
828 nmdc:mga08y16_1102614_c1
829 nmdc:mga08y16_1503758_c1
830 nmdc:mga08y16_156389_c1
831 nmdc:mga08y16_491614_c1
832 nmdc:mga08y16_622320_c1
833 nmdc:mga0n895_278687_c1
834 nmdc:mga0n895_332141_c1
835 nmdc:mga0rr50_1667146_c1
836 nmdc:mga0rr50_28546_c1
837 nmdc:mga0rr50_85593_c1
838 nmdc:mga08x19_137367_c1
839 nmdc:mga08x19_199819_c1
840 nmdc:mga08x19_47577_c1
841 nmdc:mga08x19_53416_c1
842 nmdc:mga08x19_58156_c1
843 nmdc:mga0a205_205712_c1
844 Ga0501084_0113815
845 Ga0501084_0497462
846 Ga0590075_085950
847 Ga0501082_0131870
848 Ga0530510_0005787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08897

DUF1841

Domain of unknown function (DUF1841)

6

137

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5eyt-assembly1.cif.gz_A crystal structure of adenylosuccinate lyase from schistosoma mansoni in complex with amp 0.5455 75 129
5zx2-assembly1.cif.gz_E mycobacterium tuberculosis rna polymerase transcription initiation complex with ecf sigma factor sigma h and 7nt rna 0.5286 69 127
5zx2-assembly1.cif.gz_E mycobacterium tuberculosis rna polymerase transcription initiation complex with ecf sigma factor sigma h and 7nt rna 0.4267 69 127
1gak-assembly1.cif.gz_A crystal structure of green abalone sp18 0.3806 54 128
3ufe-assembly1.cif.gz_B structure of transcriptional antiterminator (bglg-family) at 1.5 a resolution 0.3752 29 125
ID Description Score Start End Superfamily
4nqwA01 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.6164 76 128 1.10.1740.10
3bh1D02 Mainly Alpha;Up-down Bundle;dip2346 fold;dip2346 domain like 0.6058 89 127 1.20.1570.10
4nleB03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 0.5439 76 129 1.10.40.30
af_P9WGH9_17_102_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.5072 63 128 1.10.1740.10
af_P9WGH7_10_94_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.5011 59 128 1.10.1740.10
ID Description Score Start End GO Terms
AF-G9EJN3-F1-model_v4 Uncharacterized protein 0.979 78 125
AF-A0A5C7VJL0-F1-model_v4 DUF1841 family protein 0.9682 2 129
AF-A0A7C3D5P0-F1-model_v4 DUF1841 family protein 0.9676 2 129
AF-A0A4Q6BB78-F1-model_v4 DUF1841 family protein 0.9664 72 125
AF-A0A378KXV7-F1-model_v4 Domain of uncharacterized function (DUF1841) 0.9663 1 127

Map