F440587

General Info

Members Datasets Scaffolds Average Seq Length
423 213 846 263

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0044084|Ga0495580_0044084_396_1262
Length 288
Sequence MTAANSTQTRISRQFAALRESGELGIVAYITAGDPSLDATHKFVLALGEAGADVIELGIPFSDPLADGPTIQRASERALKAHTTLAQVIDLVREIRKSSEVPLVLFSYYNPVLQMGLEEFASAASAAGADGVLITDLTPEESDDYRQILAAHHLDTIFLGAPTSTDDRLAKIAAVSSGFLYLISRTGVTGAKDALPDDLPALLRRARKVTQLPLAVGFGISLPGHVSVLGGLADAAVVGSALVSEIEKATTASPTPSNIDTAAAALAIRIRSLKQAARHGLSRREVAP

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
155 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
156 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
157 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
158 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
159 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
160 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.84
Nodule 0
Rhizoplane 1.65
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0044084 3300046472 Bacteria 3174
2 Ga0065704_10157531 3300005289 Bacteria 1379
3 Ga0065715_10096479 3300005293 Bacteria 3871
4 Ga0065707_10002244 3300005295 Bacteria 5943
5 Ga0065707_10128740 3300005295 Bacteria 1960
6 Ga0070676_10122441 3300005328 Bacteria 1635
7 Ga0070683_100001440 3300005329 Bacteria 18271
8 Ga0070683_100003811 3300005329 Bacteria 12321
9 Ga0070683_100056199 3300005329 Bacteria 3654
10 Ga0070683_100344986 3300005329 Bacteria 1418
11 Ga0070670_100009850 3300005331 Bacteria 8161
12 Ga0070670_100017512 3300005331 Bacteria 6148
13 Ga0070670_100045471 3300005331 Bacteria 3775
14 Ga0070670_100059421 3300005331 Bacteria 3282
15 Ga0070677_10024493 3300005333 Bacteria 2245
16 Ga0070677_10097179 3300005333 Bacteria 1292
17 Ga0070677_10216857 3300005333 Bacteria 932
18 Ga0068869_100025795 3300005334 Bacteria 4085
19 Ga0068869_100343773 3300005334 Bacteria 1215
20 Ga0070680_100034987 3300005336 Bacteria 4053
21 Ga0070680_100271652 3300005336 Bacteria 1435
22 Ga0070660_100393248 3300005339 Bacteria 1145
23 Ga0070689_100135064 3300005340 Bacteria 1980
24 Ga0070689_100222334 3300005340 Bacteria 1549
25 Ga0070661_100359712 3300005344 Bacteria 1144
26 Ga0070692_10049189 3300005345 Bacteria 2186
27 Ga0070668_100161731 3300005347 Bacteria 1817
28 Ga0070669_100018893 3300005353 Bacteria 4926
29 Ga0070675_100021756 3300005354 Bacteria 5123
30 Ga0070675_100080067 3300005354 Bacteria 2722
31 Ga0070675_100117216 3300005354 Bacteria 2260
32 Ga0070675_100259318 3300005354 Bacteria 1523
33 Ga0070671_100001437 3300005355 Bacteria 17796
34 Ga0070671_100166187 3300005355 Bacteria 1866
35 Ga0070671_100292759 3300005355 Bacteria 1386
36 Ga0070674_100136452 3300005356 Bacteria 1835
37 Ga0070673_100003282 3300005364 Bacteria 10038
38 Ga0070673_100229543 3300005364 Bacteria 1610
39 Ga0070688_100126613 3300005365 Bacteria 1718
40 Ga0070688_100168252 3300005365 Bacteria 1510
41 Ga0070659_100094505 3300005366 Bacteria 2401
42 Ga0070659_100312582 3300005366 Bacteria 1312
43 Ga0070659_100410229 3300005366 Bacteria 1145
44 Ga0070667_100158847 3300005367 Bacteria 1990
45 Ga0070667_100673855 3300005367 Bacteria 956
46 Ga0070713_100143182 3300005436 Bacteria 2119
47 Ga0070701_10012223 3300005438 Bacteria 3864
48 Ga0070701_10131833 3300005438 Bacteria 1421
49 Ga0070705_100000088 3300005440 Bacteria 51329
50 Ga0070700_100165884 3300005441 Unclassified 1525
51 Ga0070694_100007040 3300005444 Bacteria 6842
52 Ga0070694_100066402 3300005444 Bacteria 2474
53 Ga0070694_100174739 3300005444 Bacteria 1584
54 Ga0070662_100299574 3300005457 Bacteria 1306
55 Ga0070681_10486988 3300005458 Bacteria 1146
56 Ga0068867_100001765 3300005459 Bacteria 15044
57 Ga0070685_10097506 3300005466 Bacteria 1790
58 Ga0070706_100521311 3300005467 Bacteria 1106
59 Ga0070707_100043347 3300005468 Bacteria 4307
60 Ga0070707_100149532 3300005468 Bacteria 2274
61 Ga0070698_100005658 3300005471 Bacteria 13683
62 Ga0070698_100066521 3300005471 Bacteria 3627
63 Ga0070698_100228730 3300005471 Bacteria 1793
64 Ga0070699_100030212 3300005518 Bacteria 4677
65 Ga0070699_100034488 3300005518 Bacteria 4374
66 Ga0070699_100070601 3300005518 Bacteria 3036
67 Ga0070699_100472905 3300005518 Bacteria 1137
68 Ga0070679_100007331 3300005530 Bacteria 10304
69 Ga0070684_100002824 3300005535 Bacteria 12893
70 Ga0070697_100022746 3300005536 Bacteria 4981
71 Ga0070697_100299714 3300005536 Bacteria 1382
72 Ga0070672_100035605 3300005543 Bacteria 3785
73 Ga0070672_100041049 3300005543 Bacteria 3554
74 Ga0070672_100052696 3300005543 Bacteria 3178
75 Ga0070672_100064210 3300005543 Bacteria 2900
76 Ga0070672_100123638 3300005543 Bacteria 2120
77 Ga0070686_100093064 3300005544 Bacteria 2020
78 Ga0070686_100144294 3300005544 Bacteria 1661
79 Ga0070686_100162065 3300005544 Bacteria 1576
80 Ga0070686_100330294 3300005544 Bacteria 1140
81 Ga0070695_100000021 3300005545 Bacteria 60669
82 Ga0070695_100302584 3300005545 Unclassified 1182
83 Ga0070695_100313115 3300005545 Bacteria 1164
84 Ga0070696_100000016 3300005546 Bacteria 76371
85 Ga0070704_100002034 3300005549 Bacteria 11210
86 Ga0070704_100130901 3300005549 Bacteria 1944
87 Ga0070704_100190961 3300005549 Bacteria 1646
88 Ga0070704_100363651 3300005549 Bacteria 1225
89 Ga0070664_100042927 3300005564 Bacteria 3815
90 Ga0070664_100044468 3300005564 Bacteria 3750
91 Ga0070664_100075998 3300005564 Bacteria 2885
92 Ga0070664_100213557 3300005564 Bacteria 1725
93 Ga0068857_100045406 3300005577 Bacteria 3898
94 Ga0070702_100140402 3300005615 Bacteria 1538
95 Ga0068852_100811647 3300005616 Bacteria 950
96 Ga0068859_100002429 3300005617 Bacteria 18976
97 Ga0068859_100038232 3300005617 Bacteria 4815
98 Ga0068859_100060094 3300005617 Bacteria 3830
99 Ga0068859_100148099 3300005617 Bacteria 2423
100 Ga0068864_100260641 3300005618 Bacteria 1612
101 Ga0068864_100575581 3300005618 Bacteria 1091
102 Ga0068870_10006003 3300005840 Bacteria 5335
103 Ga0068870_10215765 3300005840 Bacteria 1172
104 Ga0068863_100128791 3300005841 Bacteria 2416
105 Ga0068863_100235034 3300005841 Bacteria 1768
106 Ga0068863_100253547 3300005841 Bacteria 1700
107 Ga0068858_100233981 3300005842 Bacteria 1742
108 Ga0068862_100002348 3300005844 Bacteria 16851
109 Ga0068862_100460411 3300005844 Bacteria 1200
110 Ga0081539_10001461 3300005985 Bacteria 40211
111 Ga0081539_10080911 3300005985 Bacteria 1707
112 Ga0070717_10149771 3300006028 Bacteria 2018
113 Ga0070717_10206967 3300006028 Bacteria 1721
114 Ga0075365_10047859 3300006038 Bacteria 2812
115 Ga0075368_10014497 3300006042 Bacteria 2913
116 Ga0075364_10004718 3300006051 Bacteria 7867
117 Ga0075367_10014379 3300006178 Bacteria 4285
118 Ga0068871_100278621 3300006358 Bacteria 1462
119 Ga0075428_100000561 3300006844 Bacteria 38057
120 Ga0075428_100026543 3300006844 Bacteria 6411
121 Ga0075428_100158266 3300006844 Bacteria 2459
122 Ga0075430_100000634 3300006846 Bacteria 26757
123 Ga0075431_100004099 3300006847 Bacteria 14230
124 Ga0075431_100127128 3300006847 Bacteria 2630
125 Ga0075431_100181623 3300006847 Bacteria 2159
126 Ga0075433_10008517 3300006852 Bacteria 8179
127 Ga0075433_10062187 3300006852 Bacteria 3270
128 Ga0075433_10202980 3300006852 Bacteria 1762
129 Ga0075433_10206802 3300006852 Bacteria 1745
130 Ga0075434_100003140 3300006871 Bacteria 14727
131 Ga0075434_100011772 3300006871 Bacteria 8263
132 Ga0075434_100057280 3300006871 Bacteria 3873
133 Ga0075434_100178190 3300006871 Bacteria 2145
134 Ga0075434_100210838 3300006871 Bacteria 1963
135 Ga0075434_100543565 3300006871 Bacteria 1182
136 Ga0075434_100597920 3300006871 Bacteria 1122
137 Ga0075429_100002724 3300006880 Bacteria 14910
138 Ga0075429_100009669 3300006880 Bacteria 8361
139 Ga0075429_100043784 3300006880 Bacteria 3895
140 Ga0075429_100064214 3300006880 Bacteria 3198
141 Ga0075429_100269343 3300006880 Bacteria 1492
142 Ga0068865_100136961 3300006881 Bacteria 1841
143 Ga0068865_100320989 3300006881 Bacteria 1246
144 Ga0068865_100347292 3300006881 Bacteria 1201
145 Ga0075436_100099683 3300006914 Bacteria 2023
146 Ga0097620_100002429 3300006931 Bacteria 18976
147 Ga0097620_100038232 3300006931 Bacteria 4815
148 Ga0097620_100060094 3300006931 Bacteria 3830
149 Ga0097620_100148093 3300006931 Bacteria 2423
150 Ga0097620_100659746 3300006931 Bacteria 1138
151 Ga0075435_100003163 3300007076 Bacteria 11138
152 Ga0075435_100023885 3300007076 Bacteria 4736
153 Ga0075435_100043553 3300007076 Bacteria 3593
154 Ga0075435_100076291 3300007076 Bacteria 2746
155 Ga0075435_100295890 3300007076 Bacteria 1384
156 Ga0105240_10116562 3300009093 Bacteria 3222
157 Ga0111539_10001329 3300009094 Bacteria 32962
158 Ga0111539_10006200 3300009094 Bacteria 15430
159 Ga0111539_10015546 3300009094 Bacteria 9463
160 Ga0111539_10043989 3300009094 Bacteria 5352
161 Ga0111539_10046777 3300009094 Bacteria 5174
162 Ga0111539_10163270 3300009094 Bacteria 2605
163 Ga0111539_10397157 3300009094 Bacteria 1606
164 Ga0114129_10002708 3300009147 Bacteria 24682
165 Ga0114129_10003670 3300009147 Bacteria 21598
166 Ga0114129_10007770 3300009147 Bacteria 15258
167 Ga0114129_10020210 3300009147 Bacteria 9477
168 Ga0114129_10024134 3300009147 Bacteria 8617
169 Ga0114129_10105943 3300009147 Bacteria 3885
170 Ga0114129_10108231 3300009147 Bacteria 3838
171 Ga0114129_10233584 3300009147 Bacteria 2476
172 Ga0114129_10381749 3300009147 Bacteria 1861
173 Ga0114129_10404949 3300009147 Bacteria 1797
174 Ga0114129_10424187 3300009147 Bacteria 1749
175 Ga0105243_10373820 3300009148 Bacteria 1316
176 Ga0105242_10477957 3300009176 Bacteria 1180
177 Ga0105248_10201246 3300009177 Bacteria 2244
178 Ga0105238_10010341 3300009551 Bacteria 9362
179 Ga0105249_10016096 3300009553 Bacteria 6628
180 Ga0105249_10102742 3300009553 Bacteria 2691
181 Ga0157370_10268866 3300013104 Bacteria 1575
182 Ga0157374_10350571 3300013296 Bacteria 1467
183 Ga0157375_10087759 3300013308 Bacteria 3164
184 Ga0157375_10360649 3300013308 Bacteria 1619
185 Ga0163163_10023158 3300014325 Bacteria 5892
186 Ga0163163_10109307 3300014325 Bacteria 2792
187 Ga0163163_10673141 3300014325 Bacteria 1098
188 Ga0157380_10278397 3300014326 Bacteria 1529
189 Ga0157377_10497100 3300014745 Unclassified 851
190 Ga0157379_10112078 3300014968 Bacteria 2451
191 Ga0157376_10185330 3300014969 Bacteria 1905
192 Ga0206356_11687783 3300020070 Bacteria 1123
193 Ga0207682_10154082 3300025893 Bacteria 1038
194 Ga0207645_10127611 3300025907 Bacteria 1654
195 Ga0207643_10108497 3300025908 Bacteria 1633
196 Ga0207695_10168801 3300025913 Bacteria 2115
197 Ga0207695_10212773 3300025913 Bacteria 1843
198 Ga0207660_10096513 3300025917 Bacteria 2201
199 Ga0207662_10474438 3300025918 Bacteria 858
200 Ga0207657_10258345 3300025919 Bacteria 1387
201 Ga0207652_10109405 3300025921 Bacteria 2450
202 Ga0207652_10658139 3300025921 Bacteria 936
203 Ga0207646_10014862 3300025922 Bacteria 7374
204 Ga0207681_10096458 3300025923 Bacteria 2123
205 Ga0207694_10059123 3300025924 Bacteria 2982
206 Ga0207650_10002645 3300025925 Bacteria 12392
207 Ga0207650_10010728 3300025925 Bacteria 6290
208 Ga0207650_10044450 3300025925 Bacteria 3264
209 Ga0207650_10245016 3300025925 Bacteria 1449
210 Ga0207659_10018020 3300025926 Bacteria 4622
211 Ga0207659_10148037 3300025926 Bacteria 1830
212 Ga0207659_10233387 3300025926 Bacteria 1485
213 Ga0207659_10444224 3300025926 Bacteria 1091
214 Ga0207659_10473136 3300025926 Bacteria 1058
215 Ga0207687_10343930 3300025927 Bacteria 1213
216 Ga0207700_10088317 3300025928 Bacteria 2440
217 Ga0207644_10004753 3300025931 Bacteria 8831
218 Ga0207644_10033691 3300025931 Bacteria 3582
219 Ga0207644_10088884 3300025931 Bacteria 2299
220 Ga0207690_10296829 3300025932 Bacteria 1263
221 Ga0207706_10305143 3300025933 Bacteria 1386
222 Ga0207686_10130524 3300025934 Bacteria 1723
223 Ga0207670_10013368 3300025936 Bacteria 4837
224 Ga0207669_10102763 3300025937 Bacteria 1894
225 Ga0207691_10024353 3300025940 Bacteria 5693
226 Ga0207691_10182008 3300025940 Bacteria 1836
227 Ga0207691_10326236 3300025940 Bacteria 1316
228 Ga0207689_10119943 3300025942 Bacteria 2164
229 Ga0207689_10125203 3300025942 Bacteria 2114
230 Ga0207661_10007265 3300025944 Bacteria 7880
231 Ga0207661_10020983 3300025944 Bacteria 4892
232 Ga0207679_10036064 3300025945 Bacteria 3504
233 Ga0207679_10104766 3300025945 Bacteria 2220
234 Ga0207679_10255228 3300025945 Bacteria 1493
235 Ga0207679_10312513 3300025945 Bacteria 1358
236 Ga0207651_10003589 3300025960 Bacteria 7632
237 Ga0207651_10329487 3300025960 Bacteria 1279
238 Ga0207712_10145486 3300025961 Bacteria 1824
239 Ga0207668_10094761 3300025972 Bacteria 2202
240 Ga0207640_10345554 3300025981 Bacteria 1193
241 Ga0207677_10384903 3300026023 Bacteria 1185
242 Ga0207639_10667144 3300026041 Unclassified 963
243 Ga0207678_10171024 3300026067 Bacteria 1855
244 Ga0207678_10436873 3300026067 Bacteria 1136
245 Ga0207708_10052207 3300026075 Bacteria 3114
246 Ga0207708_10099221 3300026075 Bacteria 2252
247 Ga0207708_10342266 3300026075 Bacteria 1225
248 Ga0207702_10329175 3300026078 Bacteria 1457
249 Ga0207641_10080974 3300026088 Bacteria 2819
250 Ga0207641_10125990 3300026088 Bacteria 2293
251 Ga0207641_10230541 3300026088 Bacteria 1721
252 Ga0207648_10000338 3300026089 Bacteria 51422
253 Ga0207676_10044767 3300026095 Bacteria 3416
254 Ga0207676_10067251 3300026095 Bacteria 2862
255 Ga0207674_10010709 3300026116 Bacteria 10356
256 Ga0207674_10015388 3300026116 Bacteria 8404
257 Ga0207675_100252853 3300026118 Bacteria 1706
258 Ga0207683_10100077 3300026121 Bacteria 2588
259 Ga0207698_10693305 3300026142 Bacteria 1013
260 Ga0209813_10020875 3300027866 Bacteria 1837
261 Ga0209974_10030536 3300027876 Bacteria 1786
262 Ga0207428_10000438 3300027907 Bacteria 51028
263 Ga0207428_10001787 3300027907 Bacteria 22018
264 Ga0207428_10002109 3300027907 Bacteria 20038
265 Ga0207428_10106556 3300027907 Bacteria 2161
266 Ga0207428_10228177 3300027907 Bacteria 1394
267 Ga0265354_1000007 3300028016 Bacteria 30899
268 Ga0268266_10197992 3300028379 Bacteria 1837
269 Ga0268265_10002063 3300028380 Bacteria 15717
270 Ga0268264_10167110 3300028381 Bacteria 1987
271 Ga0265770_1000764 3300030878 Bacteria 4482
272 Ga0307408_100004358 3300031548 Bacteria 9615
273 Ga0307408_100010125 3300031548 Bacteria 6217
274 Ga0307408_100126982 3300031548 Bacteria 1984
275 Ga0307408_100192658 3300031548 Bacteria 1644
276 Ga0307405_10069025 3300031731 Bacteria 2264
277 Ga0307405_10176862 3300031731 Bacteria 1528
278 Ga0307413_10091647 3300031824 Bacteria 1981
279 Ga0307413_10172485 3300031824 Bacteria 1532
280 Ga0307413_10416979 3300031824 Bacteria 1056
281 Ga0307410_10004204 3300031852 Bacteria 7397
282 Ga0307410_10053453 3300031852 Bacteria 2733
283 Ga0307406_10006470 3300031901 Bacteria 6469
284 Ga0307406_10052543 3300031901 Bacteria 2592
285 Ga0307407_10030091 3300031903 Bacteria 2925
286 Ga0307412_10005263 3300031911 Bacteria 7259
287 Ga0307416_100018256 3300032002 Bacteria 4936
288 Ga0307416_100032265 3300032002 Bacteria 3954
289 Ga0307416_100186831 3300032002 Bacteria 1949
290 Ga0307416_100224153 3300032002 Bacteria 1806
291 Ga0307416_100386739 3300032002 Bacteria 1431
292 Ga0307416_100428706 3300032002 Bacteria 1369
293 Ga0307416_100626596 3300032002 Bacteria 1158
294 Ga0307414_10036056 3300032004 Bacteria 3298
295 Ga0307414_10310402 3300032004 Bacteria 1338
296 Ga0307411_10003183 3300032005 Bacteria 7549
297 Ga0307411_10065184 3300032005 Bacteria 2442
298 Ga0307411_10223860 3300032005 Bacteria 1461
299 Ga0307415_100002939 3300032126 Bacteria 8552
300 Ga0316212_1008094 3300033547 Bacteria 1514
301 Ga0373943_0055395 3300035170 Bacteria 1964
302 Ga0373943_0171593 3300035170 Bacteria 1187
303 Ga0373931_0287579 3300035691 Bacteria 1011
304 Ga0373937_0021998 3300036401 Bacteria 5726
305 Ga0373937_0043760 3300036401 Bacteria 4089
306 Ga0373937_0141805 3300036401 Bacteria 2249
307 Ga0373925_0002903 3300037068 Bacteria 13525
308 Ga0373925_0081834 3300037068 Bacteria 2456
309 Ga0439431_0020029 3300041997 Bacteria 1595
310 Ga0439433_0007263 3300041999 Bacteria 2393
311 Ga0439450_000446 3300042008 Bacteria 5361
312 Ga0439446_0012167 3300042156 Bacteria 2347
313 Ga0439446_0056244 3300042156 Bacteria 1182
314 Ga0439435_0008408 3300042436 Bacteria 2391
315 Ga0439435_0033075 3300042436 Bacteria 1414
316 Ga0439464_0013618 3300042439 Bacteria 2180
317 Ga0439464_0018038 3300042439 Bacteria 1919
318 Ga0439440_0022697 3300042993 Bacteria 1424
319 Ga0451576_0127252 3300045051 Bacteria 2654
320 Ga0451576_0269752 3300045051 Bacteria 1779
321 Ga0495580_0312673 3300046472 Bacteria 1068
322 Ga0495594_0022890 3300046499 Bacteria 3345
323 Ga0495663_0012544 3300046525 Bacteria 2361
324 Ga0495642_0021194 3300046528 Bacteria 2555
325 Ga0495642_0089416 3300046528 Bacteria 1303
326 Ga0495665_0223206 3300046531 Unclassified 974
327 Ga0495621_0016609 3300046539 Bacteria 2365
328 Ga0495633_0155812 3300046558 Bacteria 1054
329 Ga0495656_0036623 3300046615 Bacteria 2022
330 Ga0495659_0016703 3300046664 Bacteria 2424
331 Ga0495659_0037049 3300046664 Bacteria 1726
332 Ga0495588_0003893 3300046674 Bacteria 6543
333 Ga0495669_0027674 3300046684 Bacteria 2481
334 Ga0495669_0194128 3300046684 Bacteria 969
335 Ga0495670_0027423 3300046691 Bacteria 2822
336 Ga0495674_0035771 3300047319 Bacteria 4477
337 Ga0496100_0115907 3300048903 Bacteria 1869
338 Ga0496108_0512005 3300048911 Bacteria 1048
339 Ga0496109_0106367 3300048912 Bacteria 2606
340 Ga0496109_0239702 3300048912 Bacteria 1707
341 Ga0496109_0316836 3300048912 Bacteria 1472
342 Ga0496112_0349821 3300048915 Bacteria 1420
343 Ga0496113_0094350 3300048916 Bacteria 2312
344 Ga0501292_005929 3300049515 Bacteria 1721
345 Ga0501033_0477090 3300049570 Bacteria 864
346 Ga0501034_0048126 3300049571 Bacteria 4303
347 Ga0501039_0076400 3300049575 Bacteria 2604
348 Ga0501042_0125894 3300049578 Bacteria 1845
349 Ga0501047_0041880 3300049581 Bacteria 4425
350 Ga0501071_0076839 3300049587 Bacteria 2439
351 Ga0501072_0079496 3300049588 Bacteria 2597
352 Ga0501072_0109407 3300049588 Bacteria 2199
353 Ga0501072_0139505 3300049588 Bacteria 1933
354 Ga0501076_0008027 3300049592 Bacteria 7712
355 Ga0501076_0109123 3300049592 Bacteria 2236
356 Ga0501077_0022773 3300049593 Bacteria 3970
357 Ga0501079_0008860 3300049741 Bacteria 7618
358 Ga0501079_0132276 3300049741 Bacteria 1941
359 Ga0501080_0042476 3300049742 Bacteria 4233
360 Ga0501080_0301271 3300049742 Bacteria 1454
361 Ga0501081_0107204 3300049743 Bacteria 1981
362 Ga0501045_0098828 3300049824 Bacteria 2159
363 nmdc:mga00v17_33595_c1 3300050491 Bacteria 3041
364 nmdc:mga0yw44_27236_c1 3300050492 Bacteria 3272
365 nmdc:mga0yw44_87706_c1 3300050492 Bacteria 1961
366 nmdc:mga0k408_105482_c1 3300050493 Bacteria 1664
367 nmdc:mga06z11_16832_c1 3300050494 Bacteria 3304
368 nmdc:mga06z11_29237_c1 3300050494 Bacteria 2653
369 nmdc:mga04h51_38696_c1 3300050495 Bacteria 1546
370 nmdc:mga05p37_1091778_c1 3300050507 Bacteria 837
371 nmdc:mga05p37_115472_c1 3300050507 Bacteria 3300
372 nmdc:mga05p37_117693_c1 3300050507 Bacteria 3265
373 nmdc:mga05p37_146098_c1 3300050507 Bacteria 2896
374 nmdc:mga05p37_296_c1 3300050507 Bacteria 52145
375 nmdc:mga05p37_390515_c1 3300050507 Bacteria 1628
376 nmdc:mga05p37_4938_c1 3300050507 Bacteria 15621
377 nmdc:mga05p37_77904_c1 3300050507 Bacteria 4081
378 nmdc:mga05p37_82282_c1 3300050507 Bacteria 3967
379 nmdc:mga09592_11185_c1 3300050508 Bacteria 7303
380 nmdc:mga09592_465523_c1 3300050508 Bacteria 1090
381 nmdc:mga09592_93296_c1 3300050508 Bacteria 2574
382 nmdc:mga0qj67_42857_c1 3300050509 Bacteria 3563
383 nmdc:mga06r32_1650_c1 3300050510 Bacteria 20144
384 nmdc:mga06r32_25151_c1 3300050510 Bacteria 5535
385 nmdc:mga06r32_725334_c1 3300050510 Unclassified 958
386 nmdc:mga06r32_78026_c1 3300050510 Bacteria 3218
387 nmdc:mga08y16_108349_c1 3300050511 Bacteria 2892
388 nmdc:mga08y16_11788_c1 3300050511 Bacteria 9186
389 nmdc:mga08y16_1409_c1 3300050511 Bacteria 24098
390 nmdc:mga08y16_19857_c1 3300050511 Bacteria 7087
391 nmdc:mga08y16_23195_c1 3300050511 Bacteria 6550
392 nmdc:mga08y16_254054_c1 3300050511 Bacteria 1816
393 nmdc:mga08y16_27777_c1 3300050511 Bacteria 5963
394 nmdc:mga08y16_459130_c1 3300050511 Bacteria 1298
395 nmdc:mga08y16_99445_c1 3300050511 Bacteria 3028
396 nmdc:mga0n895_197524_c1 3300050512 Bacteria 2043
397 nmdc:mga0n895_304825_c1 3300050512 Bacteria 1615
398 nmdc:mga0n895_349552_c1 3300050512 Bacteria 1497
399 nmdc:mga0n895_8549_c1 3300050512 Bacteria 8874
400 nmdc:mga0n895_98441_c1 3300050512 Bacteria 2931
401 nmdc:mga0rr50_152612_c1 3300050513 Bacteria 1868
402 nmdc:mga0rr50_72947_c1 3300050513 Bacteria 2623
403 nmdc:mga0rr50_90593_c1 3300050513 Bacteria 2380
404 nmdc:mga0a205_107641_c1 3300050515 Bacteria 2686
405 nmdc:mga0a205_19389_c1 3300050515 Bacteria 3298
406 nmdc:mga0a205_214834_c1 3300050515 Bacteria 1810
407 nmdc:mga0a205_323716_c1 3300050515 Bacteria 1412
408 nmdc:mga0a205_334117_c1 3300050515 Bacteria 1385
409 nmdc:mga0a205_41784_c1 3300050515 Bacteria 4417
410 nmdc:mga0a205_444007_c1 3300050515 Bacteria 1158
411 nmdc:mga0a205_47086_c1 3300050515 Bacteria 4160
412 Ga0495595_0202526 3300053084 Bacteria 988
413 Ga0495619_0020738 3300053085 Bacteria 4191
414 Ga0501084_0027973 3300054114 Bacteria 4711
415 Ga0501084_0038240 3300054114 Bacteria 4012
416 Ga0590074_005345 3300059423 Bacteria 2125
417 Ga0590075_000190 3300059424 Bacteria 17095
418 Ga0590077_000428 3300059426 Bacteria 11788
419 Ga0590077_000559 3300059426 Bacteria 10288
420 Ga0590077_006715 3300059426 Bacteria 2355
421 Ga0501082_0114093 3300060353 Bacteria 2340
422 Ga0501082_0200978 3300060353 Bacteria 1734
423 Ga0530510_0083716 3300061734 Bacteria 2323
424 Ga0495580_0044084
425 Ga0065704_10157531
426 Ga0065715_10096479
427 Ga0065707_10002244
428 Ga0065707_10128740
429 Ga0070676_10122441
430 Ga0070683_100001440
431 Ga0070683_100003811
432 Ga0070683_100056199
433 Ga0070683_100344986
434 Ga0070670_100009850
435 Ga0070670_100017512
436 Ga0070670_100045471
437 Ga0070670_100059421
438 Ga0070677_10024493
439 Ga0070677_10097179
440 Ga0070677_10216857
441 Ga0068869_100025795
442 Ga0068869_100343773
443 Ga0070680_100034987
444 Ga0070680_100271652
445 Ga0070660_100393248
446 Ga0070689_100135064
447 Ga0070689_100222334
448 Ga0070661_100359712
449 Ga0070692_10049189
450 Ga0070668_100161731
451 Ga0070669_100018893
452 Ga0070675_100021756
453 Ga0070675_100080067
454 Ga0070675_100117216
455 Ga0070675_100259318
456 Ga0070671_100001437
457 Ga0070671_100166187
458 Ga0070671_100292759
459 Ga0070674_100136452
460 Ga0070673_100003282
461 Ga0070673_100229543
462 Ga0070688_100126613
463 Ga0070688_100168252
464 Ga0070659_100094505
465 Ga0070659_100312582
466 Ga0070659_100410229
467 Ga0070667_100158847
468 Ga0070667_100673855
469 Ga0070713_100143182
470 Ga0070701_10012223
471 Ga0070701_10131833
472 Ga0070705_100000088
473 Ga0070700_100165884
474 Ga0070694_100007040
475 Ga0070694_100066402
476 Ga0070694_100174739
477 Ga0070662_100299574
478 Ga0070681_10486988
479 Ga0068867_100001765
480 Ga0070685_10097506
481 Ga0070706_100521311
482 Ga0070707_100043347
483 Ga0070707_100149532
484 Ga0070698_100005658
485 Ga0070698_100066521
486 Ga0070698_100228730
487 Ga0070699_100030212
488 Ga0070699_100034488
489 Ga0070699_100070601
490 Ga0070699_100472905
491 Ga0070679_100007331
492 Ga0070684_100002824
493 Ga0070697_100022746
494 Ga0070697_100299714
495 Ga0070672_100035605
496 Ga0070672_100041049
497 Ga0070672_100052696
498 Ga0070672_100064210
499 Ga0070672_100123638
500 Ga0070686_100093064
501 Ga0070686_100144294
502 Ga0070686_100162065
503 Ga0070686_100330294
504 Ga0070695_100000021
505 Ga0070695_100302584
506 Ga0070695_100313115
507 Ga0070696_100000016
508 Ga0070704_100002034
509 Ga0070704_100130901
510 Ga0070704_100190961
511 Ga0070704_100363651
512 Ga0070664_100042927
513 Ga0070664_100044468
514 Ga0070664_100075998
515 Ga0070664_100213557
516 Ga0068857_100045406
517 Ga0070702_100140402
518 Ga0068852_100811647
519 Ga0068859_100002429
520 Ga0068859_100038232
521 Ga0068859_100060094
522 Ga0068859_100148099
523 Ga0068864_100260641
524 Ga0068864_100575581
525 Ga0068870_10006003
526 Ga0068870_10215765
527 Ga0068863_100128791
528 Ga0068863_100235034
529 Ga0068863_100253547
530 Ga0068858_100233981
531 Ga0068862_100002348
532 Ga0068862_100460411
533 Ga0081539_10001461
534 Ga0081539_10080911
535 Ga0070717_10149771
536 Ga0070717_10206967
537 Ga0075365_10047859
538 Ga0075368_10014497
539 Ga0075364_10004718
540 Ga0075367_10014379
541 Ga0068871_100278621
542 Ga0075428_100000561
543 Ga0075428_100026543
544 Ga0075428_100158266
545 Ga0075430_100000634
546 Ga0075431_100004099
547 Ga0075431_100127128
548 Ga0075431_100181623
549 Ga0075433_10008517
550 Ga0075433_10062187
551 Ga0075433_10202980
552 Ga0075433_10206802
553 Ga0075434_100003140
554 Ga0075434_100011772
555 Ga0075434_100057280
556 Ga0075434_100178190
557 Ga0075434_100210838
558 Ga0075434_100543565
559 Ga0075434_100597920
560 Ga0075429_100002724
561 Ga0075429_100009669
562 Ga0075429_100043784
563 Ga0075429_100064214
564 Ga0075429_100269343
565 Ga0068865_100136961
566 Ga0068865_100320989
567 Ga0068865_100347292
568 Ga0075436_100099683
569 Ga0097620_100002429
570 Ga0097620_100038232
571 Ga0097620_100060094
572 Ga0097620_100148093
573 Ga0097620_100659746
574 Ga0075435_100003163
575 Ga0075435_100023885
576 Ga0075435_100043553
577 Ga0075435_100076291
578 Ga0075435_100295890
579 Ga0105240_10116562
580 Ga0111539_10001329
581 Ga0111539_10006200
582 Ga0111539_10015546
583 Ga0111539_10043989
584 Ga0111539_10046777
585 Ga0111539_10163270
586 Ga0111539_10397157
587 Ga0114129_10002708
588 Ga0114129_10003670
589 Ga0114129_10007770
590 Ga0114129_10020210
591 Ga0114129_10024134
592 Ga0114129_10105943
593 Ga0114129_10108231
594 Ga0114129_10233584
595 Ga0114129_10381749
596 Ga0114129_10404949
597 Ga0114129_10424187
598 Ga0105243_10373820
599 Ga0105242_10477957
600 Ga0105248_10201246
601 Ga0105238_10010341
602 Ga0105249_10016096
603 Ga0105249_10102742
604 Ga0157370_10268866
605 Ga0157374_10350571
606 Ga0157375_10087759
607 Ga0157375_10360649
608 Ga0163163_10023158
609 Ga0163163_10109307
610 Ga0163163_10673141
611 Ga0157380_10278397
612 Ga0157377_10497100
613 Ga0157379_10112078
614 Ga0157376_10185330
615 Ga0206356_11687783
616 Ga0207682_10154082
617 Ga0207645_10127611
618 Ga0207643_10108497
619 Ga0207695_10168801
620 Ga0207695_10212773
621 Ga0207660_10096513
622 Ga0207662_10474438
623 Ga0207657_10258345
624 Ga0207652_10109405
625 Ga0207652_10658139
626 Ga0207646_10014862
627 Ga0207681_10096458
628 Ga0207694_10059123
629 Ga0207650_10002645
630 Ga0207650_10010728
631 Ga0207650_10044450
632 Ga0207650_10245016
633 Ga0207659_10018020
634 Ga0207659_10148037
635 Ga0207659_10233387
636 Ga0207659_10444224
637 Ga0207659_10473136
638 Ga0207687_10343930
639 Ga0207700_10088317
640 Ga0207644_10004753
641 Ga0207644_10033691
642 Ga0207644_10088884
643 Ga0207690_10296829
644 Ga0207706_10305143
645 Ga0207686_10130524
646 Ga0207670_10013368
647 Ga0207669_10102763
648 Ga0207691_10024353
649 Ga0207691_10182008
650 Ga0207691_10326236
651 Ga0207689_10119943
652 Ga0207689_10125203
653 Ga0207661_10007265
654 Ga0207661_10020983
655 Ga0207679_10036064
656 Ga0207679_10104766
657 Ga0207679_10255228
658 Ga0207679_10312513
659 Ga0207651_10003589
660 Ga0207651_10329487
661 Ga0207712_10145486
662 Ga0207668_10094761
663 Ga0207640_10345554
664 Ga0207677_10384903
665 Ga0207639_10667144
666 Ga0207678_10171024
667 Ga0207678_10436873
668 Ga0207708_10052207
669 Ga0207708_10099221
670 Ga0207708_10342266
671 Ga0207702_10329175
672 Ga0207641_10080974
673 Ga0207641_10125990
674 Ga0207641_10230541
675 Ga0207648_10000338
676 Ga0207676_10044767
677 Ga0207676_10067251
678 Ga0207674_10010709
679 Ga0207674_10015388
680 Ga0207675_100252853
681 Ga0207683_10100077
682 Ga0207698_10693305
683 Ga0209813_10020875
684 Ga0209974_10030536
685 Ga0207428_10000438
686 Ga0207428_10001787
687 Ga0207428_10002109
688 Ga0207428_10106556
689 Ga0207428_10228177
690 Ga0265354_1000007
691 Ga0268266_10197992
692 Ga0268265_10002063
693 Ga0268264_10167110
694 Ga0265770_1000764
695 Ga0307408_100004358
696 Ga0307408_100010125
697 Ga0307408_100126982
698 Ga0307408_100192658
699 Ga0307405_10069025
700 Ga0307405_10176862
701 Ga0307413_10091647
702 Ga0307413_10172485
703 Ga0307413_10416979
704 Ga0307410_10004204
705 Ga0307410_10053453
706 Ga0307406_10006470
707 Ga0307406_10052543
708 Ga0307407_10030091
709 Ga0307412_10005263
710 Ga0307416_100018256
711 Ga0307416_100032265
712 Ga0307416_100186831
713 Ga0307416_100224153
714 Ga0307416_100386739
715 Ga0307416_100428706
716 Ga0307416_100626596
717 Ga0307414_10036056
718 Ga0307414_10310402
719 Ga0307411_10003183
720 Ga0307411_10065184
721 Ga0307411_10223860
722 Ga0307415_100002939
723 Ga0316212_1008094
724 Ga0373943_0055395
725 Ga0373943_0171593
726 Ga0373931_0287579
727 Ga0373937_0021998
728 Ga0373937_0043760
729 Ga0373937_0141805
730 Ga0373925_0002903
731 Ga0373925_0081834
732 Ga0439431_0020029
733 Ga0439433_0007263
734 Ga0439450_000446
735 Ga0439446_0012167
736 Ga0439446_0056244
737 Ga0439435_0008408
738 Ga0439435_0033075
739 Ga0439464_0013618
740 Ga0439464_0018038
741 Ga0439440_0022697
742 Ga0451576_0127252
743 Ga0451576_0269752
744 Ga0495580_0312673
745 Ga0495594_0022890
746 Ga0495663_0012544
747 Ga0495642_0021194
748 Ga0495642_0089416
749 Ga0495665_0223206
750 Ga0495621_0016609
751 Ga0495633_0155812
752 Ga0495656_0036623
753 Ga0495659_0016703
754 Ga0495659_0037049
755 Ga0495588_0003893
756 Ga0495669_0027674
757 Ga0495669_0194128
758 Ga0495670_0027423
759 Ga0495674_0035771
760 Ga0496100_0115907
761 Ga0496108_0512005
762 Ga0496109_0106367
763 Ga0496109_0239702
764 Ga0496109_0316836
765 Ga0496112_0349821
766 Ga0496113_0094350
767 Ga0501292_005929
768 Ga0501033_0477090
769 Ga0501034_0048126
770 Ga0501039_0076400
771 Ga0501042_0125894
772 Ga0501047_0041880
773 Ga0501071_0076839
774 Ga0501072_0079496
775 Ga0501072_0109407
776 Ga0501072_0139505
777 Ga0501076_0008027
778 Ga0501076_0109123
779 Ga0501077_0022773
780 Ga0501079_0008860
781 Ga0501079_0132276
782 Ga0501080_0042476
783 Ga0501080_0301271
784 Ga0501081_0107204
785 Ga0501045_0098828
786 nmdc:mga00v17_33595_c1
787 nmdc:mga0yw44_27236_c1
788 nmdc:mga0yw44_87706_c1
789 nmdc:mga0k408_105482_c1
790 nmdc:mga06z11_16832_c1
791 nmdc:mga06z11_29237_c1
792 nmdc:mga04h51_38696_c1
793 nmdc:mga05p37_1091778_c1
794 nmdc:mga05p37_115472_c1
795 nmdc:mga05p37_117693_c1
796 nmdc:mga05p37_146098_c1
797 nmdc:mga05p37_296_c1
798 nmdc:mga05p37_390515_c1
799 nmdc:mga05p37_4938_c1
800 nmdc:mga05p37_77904_c1
801 nmdc:mga05p37_82282_c1
802 nmdc:mga09592_11185_c1
803 nmdc:mga09592_465523_c1
804 nmdc:mga09592_93296_c1
805 nmdc:mga0qj67_42857_c1
806 nmdc:mga06r32_1650_c1
807 nmdc:mga06r32_25151_c1
808 nmdc:mga06r32_725334_c1
809 nmdc:mga06r32_78026_c1
810 nmdc:mga08y16_108349_c1
811 nmdc:mga08y16_11788_c1
812 nmdc:mga08y16_1409_c1
813 nmdc:mga08y16_19857_c1
814 nmdc:mga08y16_23195_c1
815 nmdc:mga08y16_254054_c1
816 nmdc:mga08y16_27777_c1
817 nmdc:mga08y16_459130_c1
818 nmdc:mga08y16_99445_c1
819 nmdc:mga0n895_197524_c1
820 nmdc:mga0n895_304825_c1
821 nmdc:mga0n895_349552_c1
822 nmdc:mga0n895_8549_c1
823 nmdc:mga0n895_98441_c1
824 nmdc:mga0rr50_152612_c1
825 nmdc:mga0rr50_72947_c1
826 nmdc:mga0rr50_90593_c1
827 nmdc:mga0a205_107641_c1
828 nmdc:mga0a205_19389_c1
829 nmdc:mga0a205_214834_c1
830 nmdc:mga0a205_323716_c1
831 nmdc:mga0a205_334117_c1
832 nmdc:mga0a205_41784_c1
833 nmdc:mga0a205_444007_c1
834 nmdc:mga0a205_47086_c1
835 Ga0495595_0202526
836 Ga0495619_0020738
837 Ga0501084_0027973
838 Ga0501084_0038240
839 Ga0590074_005345
840 Ga0590075_000190
841 Ga0590077_000428
842 Ga0590077_000559
843 Ga0590077_006715
844 Ga0501082_0114093
845 Ga0501082_0200978
846 Ga0530510_0083716

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00290

Trp_syntA

Tryptophan synthase alpha chain

15

278

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e9p-assembly2.cif.gz_C crystal structure of tryptophan synthase from m. tuberculosis - open form with brd0059 bound 0.9657 1 260
5tcf-assembly2.cif.gz_E crystal structure of tryptophan synthase from m. tuberculosis - ligand-free form 0.9656 1 260
1wdw-assembly3.cif.gz_K structural basis of mutual activation of the tryptophan synthase a2b2 complex from a hyperthermophile, pyrococcus furiosus 0.965 15 259
5e0k-assembly3.cif.gz_K x-ray crystal structure of tryptophan synthase complex from pyrococcus furiosus at 2.76 a 0.9619 18 259
5ocw-assembly1.cif.gz_A structure of mycobacterium tuberculosis tryptophan synthase in space group f222 0.9612 1 260
ID Description Score Start End Superfamily
af_A0A1D8PMH6_3_266_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9668 2 259 3.20.20.70
6du1C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9591 1 260 3.20.20.70
af_B4F800_73_338_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.957 4 260 3.20.20.70
1wdwE00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.955 15 259 3.20.20.70
af_A0A1D8PMH6_3_266_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9523 2 259 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7Y5WVA3-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.988 1 175 GO:0004834
GO:0005829
GO:0006568
AF-A0A3N5XWI8-F1-model_v4 Tryptophan synthase alpha chain (EC 4.2.1.20) 0.9847 3 259 GO:0004834
GO:0005829
GO:0006568
AF-A0A2V9R529-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.9826 27 241 GO:0004834
GO:0005829
GO:0006568
AF-T1M3U0-F1-model_v4 deleted 0.9819 18 175
AF-A0A7W1TER6-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.9808 1 174 GO:0004834
GO:0005829
GO:0006568

Map