F440581

General Info

Members Datasets Scaffolds Average Seq Length
423 246 846 201

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0149280|Ga0466959_0149280_432_1019
Length 185
Sequence MSAVPSERRGELLDIAANLFAERGLKTTTVRDIADAAGILSGSLYHHFDSKESMVDEILRSFLDELFGEYEAIIARALPPRDRFEDRSHAAVAIYQNEARLLADQPRFGYIRERLAEFKTMWTDLLREGIEDGSFRADLDLDLAYRFFRDTVWVGVRWYRPGGTTAVRDVTKQYLTIVLDGIGVG

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
131 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
132 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
133 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
230 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
231 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
232 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
233 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
235 2547132424 Nocardia nova SH22a Isolate Unclassified
236 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
237 2643221615 Nocardioides sp. Root224 Isolate Unclassified
238 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
239 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
240 2643221692 Nocardia sp. Root136 Isolate Unclassified
241 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
242 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
243 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
244 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
245 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
246 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 0
Isolates 2.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.09
Nodule 0
Rhizoplane 6.62
Rhizosphere 78.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0149280 3300045049 Bacteria 1648
2 JGI24739J22299_10114286 3300001989 Bacteria 809
3 JGI24743J22301_10012995 3300001991 Bacteria 1522
4 JGI24738J21930_10051790 3300002075 Bacteria 837
5 rootH2_10001455 3300003320 Bacteria 1487
6 Ga0068869_100164021 3300005334 Bacteria 1731
7 Ga0070680_100504770 3300005336 Bacteria 1035
8 Ga0070682_100219386 3300005337 Bacteria 1352
9 Ga0070682_100661769 3300005337 Bacteria 833
10 Ga0070687_100129950 3300005343 Bacteria 1453
11 Ga0070668_100162815 3300005347 Bacteria 1811
12 Ga0070668_100609828 3300005347 Bacteria 956
13 Ga0070669_100026590 3300005353 Bacteria 4164
14 Ga0070675_100311504 3300005354 Bacteria 1389
15 Ga0070675_101205442 3300005354 Bacteria 697
16 Ga0070674_100149406 3300005356 Bacteria 1761
17 Ga0070688_100244686 3300005365 Bacteria 1275
18 Ga0070667_100000220 3300005367 Bacteria 65980
19 Ga0070667_100123880 3300005367 Bacteria 2251
20 Ga0070667_100131419 3300005367 Bacteria 2185
21 Ga0070703_10064313 3300005406 Bacteria 1208
22 Ga0070714_100092724 3300005435 Bacteria 2648
23 Ga0070714_100833768 3300005435 Bacteria 894
24 Ga0070713_100038729 3300005436 Bacteria 3865
25 Ga0070710_10000214 3300005437 Bacteria 27065
26 Ga0070710_10014005 3300005437 Bacteria 4028
27 Ga0070711_100013428 3300005439 Bacteria 5145
28 Ga0070711_100596829 3300005439 Bacteria 921
29 Ga0070694_100030804 3300005444 Bacteria 3513
30 Ga0070663_100549130 3300005455 Bacteria 965
31 Ga0070678_100023788 3300005456 Bacteria 4089
32 Ga0068867_100048866 3300005459 Bacteria 3113
33 Ga0070685_10007364 3300005466 Bacteria 5628
34 Ga0068853_100017747 3300005539 Bacteria 5874
35 Ga0070696_100007868 3300005546 Bacteria 7117
36 Ga0070693_100491475 3300005547 Bacteria 869
37 Ga0070665_100003091 3300005548 Bacteria 17919
38 Ga0070665_100040096 3300005548 Bacteria 4707
39 Ga0070704_100062709 3300005549 Bacteria 2665
40 Ga0068855_100023578 3300005563 Bacteria 7369
41 Ga0068855_100024311 3300005563 Bacteria 7252
42 Ga0068854_100346211 3300005578 Bacteria 1215
43 Ga0068856_100091508 3300005614 Bacteria 3026
44 Ga0068856_100752594 3300005614 Bacteria 994
45 Ga0068852_100587919 3300005616 Bacteria 1117
46 Ga0068859_100001001 3300005617 Bacteria 28962
47 Ga0068859_100089207 3300005617 Bacteria 3133
48 Ga0068866_10128135 3300005718 Bacteria 1439
49 Ga0068861_100026054 3300005719 Bacteria 4247
50 Ga0068870_10141535 3300005840 Bacteria 1408
51 Ga0068863_100000442 3300005841 Bacteria 42019
52 Ga0068863_100177754 3300005841 Bacteria 2043
53 Ga0068858_100120226 3300005842 Bacteria 2456
54 Ga0068860_100000150 3300005843 Bacteria 113021
55 Ga0068860_100000410 3300005843 Bacteria 55852
56 Ga0068860_100137772 3300005843 Bacteria 2344
57 Ga0068862_100000078 3300005844 Bacteria 114008
58 Ga0068862_100106987 3300005844 Bacteria 2452
59 Ga0081539_10072861 3300005985 Bacteria 1834
60 Ga0075365_10015565 3300006038 Bacteria 4603
61 Ga0075365_10184476 3300006038 Bacteria 1459
62 Ga0075365_10527992 3300006038 Bacteria 834
63 Ga0075368_10184509 3300006042 Bacteria 880
64 Ga0075363_100150192 3300006048 Bacteria 1315
65 Ga0075363_100201982 3300006048 Bacteria 1136
66 Ga0075363_100256730 3300006048 Bacteria 1007
67 Ga0075364_10002095 3300006051 Bacteria 11138
68 Ga0070712_100014159 3300006175 Bacteria 5117
69 Ga0070712_100138664 3300006175 Bacteria 1853
70 Ga0075362_10093818 3300006177 Bacteria 1396
71 Ga0075369_10000696 3300006186 Bacteria 10788
72 Ga0075370_10179298 3300006353 Bacteria 1246
73 Ga0068871_100275081 3300006358 Bacteria 1472
74 Ga0068865_100295966 3300006881 Bacteria 1293
75 Ga0068865_100644532 3300006881 Bacteria 900
76 Ga0097620_100001001 3300006931 Bacteria 28962
77 Ga0097620_100089211 3300006931 Bacteria 3133
78 Ga0075435_100550194 3300007076 Bacteria 999
79 Ga0099795_10005494 3300007788 Bacteria 3378
80 Ga0105250_10058800 3300009092 Bacteria 1543
81 Ga0111539_10221471 3300009094 Bacteria 2204
82 Ga0111539_10715593 3300009094 Bacteria 1165
83 Ga0105245_10952647 3300009098 Bacteria 901
84 Ga0105245_11093759 3300009098 Bacteria 843
85 Ga0105247_10000074 3300009101 Bacteria 113207
86 Ga0105241_10035128 3300009174 Bacteria 3770
87 Ga0105241_10073826 3300009174 Bacteria 2655
88 Ga0105242_10043702 3300009176 Bacteria 3625
89 Ga0105248_10000077 3300009177 Bacteria 113148
90 Ga0105248_10344401 3300009177 Bacteria 1678
91 Ga0105237_10224366 3300009545 Bacteria 1879
92 Ga0105238_11382393 3300009551 Bacteria 731
93 Ga0105249_10000111 3300009553 Bacteria 109164
94 Ga0105249_10964007 3300009553 Bacteria 921
95 Ga0099796_10059906 3300010159 Bacteria 1346
96 Ga0105239_10049287 3300010375 Bacteria 4618
97 Ga0105239_10086863 3300010375 Bacteria 3447
98 Ga0105239_10611708 3300010375 Bacteria 1243
99 Ga0157369_10075781 3300013105 Bacteria 3606
100 Ga0157369_10258355 3300013105 Bacteria 1817
101 Ga0157374_10117484 3300013296 Bacteria 2563
102 Ga0157378_10087298 3300013297 Bacteria 2829
103 Ga0163162_10073074 3300013306 Bacteria 3485
104 Ga0163162_10125894 3300013306 Bacteria 2668
105 Ga0163162_10268176 3300013306 Bacteria 1839
106 Ga0157372_10511422 3300013307 Bacteria 1400
107 Ga0157375_10136801 3300013308 Bacteria 2575
108 Ga0157377_10264620 3300014745 Bacteria 1120
109 Ga0157379_10163181 3300014968 Bacteria 2011
110 Ga0163161_10043996 3300017792 Bacteria 3215
111 Ga0213874_10015348 3300021377 Bacteria 2019
112 Ga0213876_10020731 3300021384 Bacteria 3476
113 Ga0213875_10071801 3300021388 Bacteria 1616
114 Ga0209051_1001136 3300025303 Bacteria 24323
115 Ga0207696_1040605 3300025711 Bacteria 1362
116 Ga0207653_10057906 3300025885 Bacteria 1301
117 Ga0207692_10038501 3300025898 Bacteria 2346
118 Ga0207642_10003035 3300025899 Bacteria 5262
119 Ga0207710_10000086 3300025900 Bacteria 129918
120 Ga0207688_10001417 3300025901 Bacteria 12499
121 Ga0207647_10007775 3300025904 Bacteria 7716
122 Ga0207647_10057383 3300025904 Bacteria 2387
123 Ga0207685_10014346 3300025905 Bacteria 2478
124 Ga0207699_10072261 3300025906 Bacteria 2112
125 Ga0207654_10193426 3300025911 Bacteria 1335
126 Ga0207695_10658316 3300025913 Bacteria 928
127 Ga0207671_10178308 3300025914 Bacteria 1652
128 Ga0207671_10228914 3300025914 Bacteria 1458
129 Ga0207693_10012467 3300025915 Bacteria 6867
130 Ga0207663_10010070 3300025916 Bacteria 5013
131 Ga0207663_10344792 3300025916 Bacteria 1126
132 Ga0207662_10043318 3300025918 Bacteria 2655
133 Ga0207681_10008462 3300025923 Bacteria 6286
134 Ga0207694_10258637 3300025924 Bacteria 1426
135 Ga0207687_10009115 3300025927 Bacteria 6488
136 Ga0207664_10039433 3300025929 Bacteria 3667
137 Ga0207664_10080094 3300025929 Bacteria 2654
138 Ga0207664_10977526 3300025929 Bacteria 759
139 Ga0207644_10315681 3300025931 Bacteria 1263
140 Ga0207690_10441771 3300025932 Bacteria 1044
141 Ga0207706_10026045 3300025933 Bacteria 5236
142 Ga0207686_10578537 3300025934 Bacteria 881
143 Ga0207709_10012151 3300025935 Bacteria 4745
144 Ga0207665_10010073 3300025939 Bacteria 6209
145 Ga0207711_10000577 3300025941 Bacteria 37314
146 Ga0207689_10022919 3300025942 Bacteria 5245
147 Ga0207661_10300093 3300025944 Bacteria 1440
148 Ga0207712_10000359 3300025961 Bacteria 40273
149 Ga0207712_10288605 3300025961 Bacteria 1342
150 Ga0207668_10166225 3300025972 Bacteria 1725
151 Ga0207640_10111908 3300025981 Bacteria 1937
152 Ga0207658_10000314 3300025986 Bacteria 48821
153 Ga0207658_10102600 3300025986 Bacteria 2244
154 Ga0207677_10095531 3300026023 Bacteria 2172
155 Ga0207703_10079418 3300026035 Bacteria 2730
156 Ga0207703_10748454 3300026035 Bacteria 931
157 Ga0207639_10132954 3300026041 Bacteria 2062
158 Ga0207678_10011775 3300026067 Bacteria 7680
159 Ga0207708_10025392 3300026075 Bacteria 4481
160 Ga0207702_10199252 3300026078 Bacteria 1855
161 Ga0207702_10303204 3300026078 Bacteria 1516
162 Ga0207702_10560987 3300026078 Bacteria 1118
163 Ga0207641_10001022 3300026088 Bacteria 28402
164 Ga0207641_10550637 3300026088 Bacteria 1125
165 Ga0207648_10013426 3300026089 Bacteria 7623
166 Ga0207676_10471482 3300026095 Bacteria 1187
167 Ga0207675_100025176 3300026118 Bacteria 5538
168 Ga0207683_10005999 3300026121 Bacteria 10407
169 Ga0207698_10306537 3300026142 Bacteria 1481
170 Ga0207698_10468034 3300026142 Bacteria 1220
171 Ga0207698_10652875 3300026142 Bacteria 1042
172 Ga0209179_1046571 3300027512 Bacteria 922
173 Ga0268266_10006489 3300028379 Bacteria 10708
174 Ga0268266_10083634 3300028379 Bacteria 2786
175 Ga0268266_10105608 3300028379 Bacteria 2489
176 Ga0268265_10000012 3300028380 Bacteria 343132
177 Ga0268264_10000104 3300028381 Bacteria 217837
178 Ga0268264_10000155 3300028381 Bacteria 156029
179 Ga0268264_10356886 3300028381 Bacteria 1393
180 Ga0316177_1108775 3300030731 Bacteria 2346
181 Ga0316176_1015315 3300030732 Bacteria 1344
182 Ga0314311_1200840 3300030733 Bacteria 3738
183 Ga0316180_1190980 3300030736 Bacteria 1293
184 Ga0265327_10000274 3300031251 Bacteria 101723
185 Ga0265327_10011181 3300031251 Bacteria 6218
186 Ga0307413_10208672 3300031824 Bacteria 1417
187 Ga0307410_10107378 3300031852 Bacteria 2013
188 Ga0307410_10571817 3300031852 Bacteria 939
189 Ga0307409_100109157 3300031995 Bacteria 2316
190 Ga0307409_100393040 3300031995 Bacteria 1322
191 Ga0307409_100450833 3300031995 Bacteria 1242
192 Ga0307416_100032180 3300032002 Bacteria 3959
193 Ga0307414_10993167 3300032004 Bacteria 772
194 Ga0307411_10049194 3300032005 Bacteria 2738
195 Ga0307411_10065381 3300032005 Bacteria 2439
196 Ga0307415_100007955 3300032126 Bacteria 5841
197 Ga0307415_100757246 3300032126 Bacteria 882
198 Ga0373949_0018641 3300035090 Bacteria 1575
199 Ga0373960_0049406 3300035121 Bacteria 1244
200 Ga0373931_0092115 3300035691 Bacteria 1690
201 Ga0395900_0474747 3300037418 Bacteria 1204
202 Ga0395905_0189097 3300037471 Bacteria 1932
203 Ga0436364_0506337 3300037853 Bacteria 16554
204 Ga0436364_0875121 3300037853 Bacteria 650
205 Ga0436365_0205941 3300039437 Bacteria 4952
206 Ga0436365_1058407 3300039437 Bacteria 2746
207 Ga0436361_0746311 3300039447 Bacteria 1867
208 Ga0436363_0122539 3300039450 Bacteria 657
209 Ga0436363_0138465 3300039450 Bacteria 1007
210 Ga0436363_0362677 3300039450 Bacteria 820
211 Ga0436363_0699768 3300039450 Bacteria 3404
212 Ga0436363_0885899 3300039450 Bacteria 1668
213 Ga0451853_0725462 3300041512 Bacteria 890
214 Ga0451853_2157059 3300041512 Bacteria 3220
215 Ga0439457_055134 3300042014 Bacteria 896
216 Ga0466969_0015031 3300044656 Bacteria 4061
217 Ga0466969_0026923 3300044656 Bacteria 2947
218 Ga0466969_0054865 3300044656 Bacteria 1951
219 Ga0466972_0001757 3300044658 Bacteria 10627
220 Ga0466972_0002884 3300044658 Bacteria 8508
221 Ga0466972_0003969 3300044658 Bacteria 7373
222 Ga0466972_0248564 3300044658 Bacteria 832
223 Ga0466965_0004898 3300044683 Bacteria 5980
224 Ga0466965_0015374 3300044683 Bacteria 3636
225 Ga0466965_0022786 3300044683 Bacteria 3021
226 Ga0466966_0001808 3300044684 Bacteria 13869
227 Ga0466966_0008398 3300044684 Bacteria 6836
228 Ga0466966_0013780 3300044684 Bacteria 5349
229 Ga0466966_0048681 3300044684 Bacteria 2700
230 Ga0466966_0079576 3300044684 Bacteria 2042
231 Ga0466966_0079865 3300044684 Bacteria 2038
232 Ga0466966_0117478 3300044684 Bacteria 1636
233 Ga0466966_0245416 3300044684 Bacteria 1079
234 Ga0466961_0013220 3300044693 Bacteria 5282
235 Ga0466961_0049146 3300044693 Bacteria 2696
236 Ga0466961_0067678 3300044693 Bacteria 2268
237 Ga0466961_0073601 3300044693 Bacteria 2167
238 Ga0466961_0269858 3300044693 Bacteria 1042
239 Ga0466963_0006045 3300044694 Bacteria 7132
240 Ga0466963_0012781 3300044694 Bacteria 5143
241 Ga0466963_0035917 3300044694 Bacteria 3229
242 Ga0466963_0093882 3300044694 Bacteria 2046
243 Ga0466963_0467973 3300044694 Bacteria 889
244 Ga0466964_0020137 3300044706 Bacteria 2568
245 Ga0466964_0067985 3300044706 Bacteria 1499
246 Ga0466964_0091733 3300044706 Bacteria 1323
247 Ga0466964_0129157 3300044706 Bacteria 1149
248 Ga0466964_0196268 3300044706 Bacteria 966
249 Ga0466964_0249154 3300044706 Bacteria 875
250 Ga0466971_0022765 3300044719 Bacteria 2792
251 Ga0466971_0033107 3300044719 Bacteria 2316
252 Ga0466971_0036835 3300044719 Bacteria 2194
253 Ga0466971_0037270 3300044719 Bacteria 2179
254 Ga0466968_0005137 3300044735 Bacteria 4896
255 Ga0466968_0014277 3300044735 Bacteria 3137
256 Ga0466968_0031057 3300044735 Bacteria 2215
257 Ga0466968_0033405 3300044735 Bacteria 2144
258 Ga0466968_0039944 3300044735 Bacteria 1977
259 Ga0466970_0001885 3300044765 Bacteria 10139
260 Ga0466970_0004334 3300044765 Bacteria 6984
261 Ga0466970_0021113 3300044765 Bacteria 3389
262 Ga0466970_0025578 3300044765 Bacteria 3091
263 Ga0466970_0102542 3300044765 Bacteria 1559
264 Ga0466970_0203806 3300044765 Bacteria 1101
265 Ga0466970_0249275 3300044765 Bacteria 995
266 Ga0466957_0004509 3300044842 Bacteria 7772
267 Ga0466957_0006910 3300044842 Bacteria 6415
268 Ga0466957_0007356 3300044842 Bacteria 6226
269 Ga0466957_0016024 3300044842 Bacteria 4381
270 Ga0466957_0057298 3300044842 Bacteria 2384
271 Ga0466957_0586920 3300044842 Bacteria 779
272 Ga0466957_0611052 3300044842 Bacteria 764
273 Ga0466960_0001982 3300044901 Bacteria 7586
274 Ga0466960_0002249 3300044901 Bacteria 7211
275 Ga0466960_0002705 3300044901 Bacteria 6699
276 Ga0466960_0024904 3300044901 Bacteria 2703
277 Ga0466960_0122639 3300044901 Bacteria 1363
278 Ga0466959_0012305 3300045049 Bacteria 6178
279 Ga0466959_0037952 3300045049 Bacteria 3560
280 Ga0466959_0098543 3300045049 Bacteria 2094
281 Ga0466959_0106471 3300045049 Bacteria 2005
282 Ga0466959_0226797 3300045049 Bacteria 1294
283 Ga0466959_0295942 3300045049 Bacteria 1109
284 Ga0466959_0319976 3300045049 Bacteria 1061
285 Ga0466959_0445925 3300045049 Bacteria 877
286 Ga0466958_0000490 3300045836 Bacteria 16540
287 Ga0466958_0001134 3300045836 Bacteria 12323
288 Ga0466958_0031861 3300045836 Bacteria 3133
289 Ga0466958_0069205 3300045836 Bacteria 2158
290 Ga0466958_0075633 3300045836 Bacteria 2066
291 Ga0466958_0132389 3300045836 Bacteria 1566
292 Ga0466958_0157795 3300045836 Bacteria 1432
293 Ga0466967_0004982 3300045976 Bacteria 9093
294 Ga0466967_0016927 3300045976 Bacteria 5766
295 Ga0466967_0065958 3300045976 Bacteria 3224
296 Ga0466967_0132577 3300045976 Bacteria 2314
297 Ga0466967_0151681 3300045976 Bacteria 2167
298 Ga0466967_0212679 3300045976 Bacteria 1834
299 Ga0466967_0220529 3300045976 Bacteria 1802
300 Ga0466967_0264711 3300045976 Bacteria 1646
301 Ga0466967_0277843 3300045976 Bacteria 1606
302 Ga0466967_0282223 3300045976 Bacteria 1594
303 Ga0466967_0292816 3300045976 Bacteria 1564
304 Ga0466967_0449509 3300045976 Bacteria 1259
305 Ga0466967_0501260 3300045976 Bacteria 1191
306 Ga0466967_0708401 3300045976 Bacteria 997
307 Ga0495603_0028271 3300046455 Bacteria 3382
308 Ga0495641_0087561 3300046461 Bacteria 1393
309 Ga0495582_0249856 3300046473 Bacteria 1017
310 Ga0495639_0072168 3300046475 Bacteria 1596
311 Ga0495607_0050075 3300046501 Bacteria 2434
312 Ga0495640_0041246 3300046533 Bacteria 3226
313 Ga0495635_0126134 3300046663 Bacteria 1746
314 Ga0495658_0454810 3300046683 Bacteria 818
315 Ga0495676_0155030 3300047321 Bacteria 1626
316 Ga0495683_0001552 3300047323 Bacteria 14875
317 Ga0495593_0178925 3300047673 Bacteria 1068
318 Ga0496100_0010584 3300048903 Bacteria 5225
319 Ga0496100_0232395 3300048903 Bacteria 1357
320 Ga0496100_0307002 3300048903 Bacteria 1189
321 Ga0496101_0003106 3300048904 Bacteria 10271
322 Ga0496101_0089469 3300048904 Bacteria 2288
323 Ga0496102_0000621 3300048905 Bacteria 36593
324 Ga0496102_0451098 3300048905 Bacteria 1206
325 Ga0496102_0543159 3300048905 Bacteria 1085
326 Ga0496102_0659457 3300048905 Bacteria 969
327 Ga0496103_0001320 3300048906 Bacteria 16826
328 Ga0496103_0601366 3300048906 Bacteria 700
329 Ga0496105_0429149 3300048908 Bacteria 1045
330 Ga0496106_0958108 3300048909 Bacteria 674
331 Ga0496107_0223360 3300048910 Bacteria 1401
332 Ga0496108_0039578 3300048911 Bacteria 3929
333 Ga0496108_0427637 3300048911 Bacteria 1157
334 Ga0496108_0708561 3300048911 Bacteria 873
335 Ga0496109_0004787 3300048912 Bacteria 11300
336 Ga0496109_0048160 3300048912 Bacteria 3878
337 Ga0496110_0031193 3300048913 Bacteria 4598
338 Ga0496110_0137810 3300048913 Bacteria 2206
339 Ga0496110_0690752 3300048913 Bacteria 922
340 Ga0496113_0579185 3300048916 Bacteria 899
341 Ga0496114_0074414 3300048917 Bacteria 2859
342 Ga0496114_0079392 3300048917 Bacteria 2770
343 Ga0496114_0241436 3300048917 Bacteria 1589
344 Ga0496114_0270061 3300048917 Bacteria 1498
345 Ga0496115_0042889 3300048918 Bacteria 3606
346 Ga0496116_0039396 3300048919 Bacteria 3268
347 Ga0496117_0001789 3300048920 Bacteria 29284
348 Ga0496118_0000160 3300048921 Bacteria 120349
349 Ga0496118_0000331 3300048921 Bacteria 80747
350 Ga0496119_0004066 3300048922 Bacteria 14758
351 Ga0496120_0015737 3300048923 Bacteria 4974
352 Ga0496121_0082526 3300048924 Bacteria 2540
353 Ga0496125_0043966 3300048928 Bacteria 3784
354 Ga0496126_0012377 3300048929 Bacteria 8748
355 Ga0496126_0084869 3300048929 Bacteria 2792
356 Ga0501032_0036847 3300049569 Bacteria 3337
357 Ga0501033_0406569 3300049570 Bacteria 949
358 Ga0501033_0548659 3300049570 Bacteria 796
359 Ga0501034_0028091 3300049571 Bacteria 5722
360 Ga0501034_0399788 3300049571 Bacteria 1297
361 Ga0501034_0544565 3300049571 Bacteria 1070
362 Ga0501034_0619868 3300049571 Bacteria 986
363 Ga0501039_0357106 3300049575 Bacteria 1148
364 Ga0501040_0205486 3300049576 Bacteria 1399
365 Ga0501042_0104032 3300049578 Bacteria 2043
366 Ga0501047_0007610 3300049581 Bacteria 10195
367 Ga0501047_0455332 3300049581 Bacteria 1109
368 Ga0501048_0341371 3300049582 Bacteria 1068
369 Ga0501067_0032542 3300049583 Bacteria 2895
370 Ga0501068_0009232 3300049584 Bacteria 5512
371 Ga0501068_0357372 3300049584 Bacteria 939
372 Ga0501070_0060665 3300049586 Bacteria 3134
373 Ga0501070_0337106 3300049586 Bacteria 1225
374 Ga0501072_0050642 3300049588 Bacteria 3270
375 Ga0501074_0517093 3300049590 Bacteria 846
376 Ga0501076_0281623 3300049592 Bacteria 1362
377 Ga0501077_0386640 3300049593 Bacteria 894
378 Ga0501080_0257040 3300049742 Bacteria 1592
379 Ga0501081_0301710 3300049743 Bacteria 1175
380 Ga0501083_0452448 3300049744 Bacteria 836
381 Ga0501035_0000218 3300049822 Bacteria 68475
382 Ga0501044_0000639 3300049823 Bacteria 42286
383 Ga0501044_0063129 3300049823 Bacteria 3785
384 Ga0501044_0463076 3300049823 Bacteria 1173
385 nmdc:mga03n38_2817_c1 3300050490 Bacteria 5467
386 nmdc:mga00v17_112672_c1 3300050491 Bacteria 1726
387 nmdc:mga00v17_488237_c1 3300050491 Bacteria 799
388 nmdc:mga00v17_68685_c1 3300050491 Bacteria 2191
389 nmdc:mga0yw44_200325_c1 3300050492 Bacteria 1318
390 nmdc:mga0yw44_349897_c1 3300050492 Bacteria 995
391 nmdc:mga0yw44_651670_c1 3300050492 Bacteria 716
392 nmdc:mga0yw44_698403_c1 3300050492 Bacteria 689
393 nmdc:mga0yw44_81981_c1 3300050492 Bacteria 2023
394 nmdc:mga0k408_268154_c1 3300050493 Bacteria 1019
395 nmdc:mga06z11_21829_c2 3300050494 Bacteria 2103
396 nmdc:mga07m45_105077_c1 3300050496 Bacteria 1624
397 nmdc:mga07m45_16563_c1 3300050496 Bacteria 3946
398 nmdc:mga08y16_319968_c1 3300050511 Bacteria 1597
399 nmdc:mga0rr50_497528_c1 3300050513 Bacteria 1036
400 Ga0495655_0178273 3300053083 Bacteria 684
401 Ga0495619_0067032 3300053085 Bacteria 2396
402 Ga0500643_104502 3300053087 Bacteria 767
403 Ga0500583_0248137 3300053092 Bacteria 879
404 Ga0500556_0002557 3300053104 Bacteria 5751
405 Ga0500652_016706 3300053131 Bacteria 2677
406 Ga0500568_0164304 3300053139 Bacteria 818
407 Ga0466962_0009762 3300061719 Bacteria 4604
408 Ga0466962_0018353 3300061719 Bacteria 3365
409 Ga0466962_0022890 3300061719 Bacteria 3002
410 Ga0466962_0092950 3300061719 Bacteria 1446
411 Ga0466962_0264917 3300061719 Bacteria 846
412 2548692780 2547132424 Bacteria 8348532
413 2552105368 2551306166 Bacteria 9731570
414 2644089247 2643221615 Bacteria 5487866
415 2644319092 2643221657 Bacteria 5490246
416 2644491396 2643221687 Bacteria 6500351
417 2644515688 2643221692 Bacteria 7282860
418 2753038534 2751185725 Bacteria 5740550
419 2753327001 2751185792 Bacteria 5739090
420 2919717991 2919713450 Bacteria 7431245
421 2932401672 2932398195 Bacteria 3847976
422 8047715969 8047710418 Bacteria 11023148
423 8056210778 8056207758 Bacteria 8639239
424 Ga0466959_0149280
425 JGI24739J22299_10114286
426 JGI24743J22301_10012995
427 JGI24738J21930_10051790
428 rootH2_10001455
429 Ga0068869_100164021
430 Ga0070680_100504770
431 Ga0070682_100219386
432 Ga0070682_100661769
433 Ga0070687_100129950
434 Ga0070668_100162815
435 Ga0070668_100609828
436 Ga0070669_100026590
437 Ga0070675_100311504
438 Ga0070675_101205442
439 Ga0070674_100149406
440 Ga0070688_100244686
441 Ga0070667_100000220
442 Ga0070667_100123880
443 Ga0070667_100131419
444 Ga0070703_10064313
445 Ga0070714_100092724
446 Ga0070714_100833768
447 Ga0070713_100038729
448 Ga0070710_10000214
449 Ga0070710_10014005
450 Ga0070711_100013428
451 Ga0070711_100596829
452 Ga0070694_100030804
453 Ga0070663_100549130
454 Ga0070678_100023788
455 Ga0068867_100048866
456 Ga0070685_10007364
457 Ga0068853_100017747
458 Ga0070696_100007868
459 Ga0070693_100491475
460 Ga0070665_100003091
461 Ga0070665_100040096
462 Ga0070704_100062709
463 Ga0068855_100023578
464 Ga0068855_100024311
465 Ga0068854_100346211
466 Ga0068856_100091508
467 Ga0068856_100752594
468 Ga0068852_100587919
469 Ga0068859_100001001
470 Ga0068859_100089207
471 Ga0068866_10128135
472 Ga0068861_100026054
473 Ga0068870_10141535
474 Ga0068863_100000442
475 Ga0068863_100177754
476 Ga0068858_100120226
477 Ga0068860_100000150
478 Ga0068860_100000410
479 Ga0068860_100137772
480 Ga0068862_100000078
481 Ga0068862_100106987
482 Ga0081539_10072861
483 Ga0075365_10015565
484 Ga0075365_10184476
485 Ga0075365_10527992
486 Ga0075368_10184509
487 Ga0075363_100150192
488 Ga0075363_100201982
489 Ga0075363_100256730
490 Ga0075364_10002095
491 Ga0070712_100014159
492 Ga0070712_100138664
493 Ga0075362_10093818
494 Ga0075369_10000696
495 Ga0075370_10179298
496 Ga0068871_100275081
497 Ga0068865_100295966
498 Ga0068865_100644532
499 Ga0097620_100001001
500 Ga0097620_100089211
501 Ga0075435_100550194
502 Ga0099795_10005494
503 Ga0105250_10058800
504 Ga0111539_10221471
505 Ga0111539_10715593
506 Ga0105245_10952647
507 Ga0105245_11093759
508 Ga0105247_10000074
509 Ga0105241_10035128
510 Ga0105241_10073826
511 Ga0105242_10043702
512 Ga0105248_10000077
513 Ga0105248_10344401
514 Ga0105237_10224366
515 Ga0105238_11382393
516 Ga0105249_10000111
517 Ga0105249_10964007
518 Ga0099796_10059906
519 Ga0105239_10049287
520 Ga0105239_10086863
521 Ga0105239_10611708
522 Ga0157369_10075781
523 Ga0157369_10258355
524 Ga0157374_10117484
525 Ga0157378_10087298
526 Ga0163162_10073074
527 Ga0163162_10125894
528 Ga0163162_10268176
529 Ga0157372_10511422
530 Ga0157375_10136801
531 Ga0157377_10264620
532 Ga0157379_10163181
533 Ga0163161_10043996
534 Ga0213874_10015348
535 Ga0213876_10020731
536 Ga0213875_10071801
537 Ga0209051_1001136
538 Ga0207696_1040605
539 Ga0207653_10057906
540 Ga0207692_10038501
541 Ga0207642_10003035
542 Ga0207710_10000086
543 Ga0207688_10001417
544 Ga0207647_10007775
545 Ga0207647_10057383
546 Ga0207685_10014346
547 Ga0207699_10072261
548 Ga0207654_10193426
549 Ga0207695_10658316
550 Ga0207671_10178308
551 Ga0207671_10228914
552 Ga0207693_10012467
553 Ga0207663_10010070
554 Ga0207663_10344792
555 Ga0207662_10043318
556 Ga0207681_10008462
557 Ga0207694_10258637
558 Ga0207687_10009115
559 Ga0207664_10039433
560 Ga0207664_10080094
561 Ga0207664_10977526
562 Ga0207644_10315681
563 Ga0207690_10441771
564 Ga0207706_10026045
565 Ga0207686_10578537
566 Ga0207709_10012151
567 Ga0207665_10010073
568 Ga0207711_10000577
569 Ga0207689_10022919
570 Ga0207661_10300093
571 Ga0207712_10000359
572 Ga0207712_10288605
573 Ga0207668_10166225
574 Ga0207640_10111908
575 Ga0207658_10000314
576 Ga0207658_10102600
577 Ga0207677_10095531
578 Ga0207703_10079418
579 Ga0207703_10748454
580 Ga0207639_10132954
581 Ga0207678_10011775
582 Ga0207708_10025392
583 Ga0207702_10199252
584 Ga0207702_10303204
585 Ga0207702_10560987
586 Ga0207641_10001022
587 Ga0207641_10550637
588 Ga0207648_10013426
589 Ga0207676_10471482
590 Ga0207675_100025176
591 Ga0207683_10005999
592 Ga0207698_10306537
593 Ga0207698_10468034
594 Ga0207698_10652875
595 Ga0209179_1046571
596 Ga0268266_10006489
597 Ga0268266_10083634
598 Ga0268266_10105608
599 Ga0268265_10000012
600 Ga0268264_10000104
601 Ga0268264_10000155
602 Ga0268264_10356886
603 Ga0316177_1108775
604 Ga0316176_1015315
605 Ga0314311_1200840
606 Ga0316180_1190980
607 Ga0265327_10000274
608 Ga0265327_10011181
609 Ga0307413_10208672
610 Ga0307410_10107378
611 Ga0307410_10571817
612 Ga0307409_100109157
613 Ga0307409_100393040
614 Ga0307409_100450833
615 Ga0307416_100032180
616 Ga0307414_10993167
617 Ga0307411_10049194
618 Ga0307411_10065381
619 Ga0307415_100007955
620 Ga0307415_100757246
621 Ga0373949_0018641
622 Ga0373960_0049406
623 Ga0373931_0092115
624 Ga0395900_0474747
625 Ga0395905_0189097
626 Ga0436364_0506337
627 Ga0436364_0875121
628 Ga0436365_0205941
629 Ga0436365_1058407
630 Ga0436361_0746311
631 Ga0436363_0122539
632 Ga0436363_0138465
633 Ga0436363_0362677
634 Ga0436363_0699768
635 Ga0436363_0885899
636 Ga0451853_0725462
637 Ga0451853_2157059
638 Ga0439457_055134
639 Ga0466969_0015031
640 Ga0466969_0026923
641 Ga0466969_0054865
642 Ga0466972_0001757
643 Ga0466972_0002884
644 Ga0466972_0003969
645 Ga0466972_0248564
646 Ga0466965_0004898
647 Ga0466965_0015374
648 Ga0466965_0022786
649 Ga0466966_0001808
650 Ga0466966_0008398
651 Ga0466966_0013780
652 Ga0466966_0048681
653 Ga0466966_0079576
654 Ga0466966_0079865
655 Ga0466966_0117478
656 Ga0466966_0245416
657 Ga0466961_0013220
658 Ga0466961_0049146
659 Ga0466961_0067678
660 Ga0466961_0073601
661 Ga0466961_0269858
662 Ga0466963_0006045
663 Ga0466963_0012781
664 Ga0466963_0035917
665 Ga0466963_0093882
666 Ga0466963_0467973
667 Ga0466964_0020137
668 Ga0466964_0067985
669 Ga0466964_0091733
670 Ga0466964_0129157
671 Ga0466964_0196268
672 Ga0466964_0249154
673 Ga0466971_0022765
674 Ga0466971_0033107
675 Ga0466971_0036835
676 Ga0466971_0037270
677 Ga0466968_0005137
678 Ga0466968_0014277
679 Ga0466968_0031057
680 Ga0466968_0033405
681 Ga0466968_0039944
682 Ga0466970_0001885
683 Ga0466970_0004334
684 Ga0466970_0021113
685 Ga0466970_0025578
686 Ga0466970_0102542
687 Ga0466970_0203806
688 Ga0466970_0249275
689 Ga0466957_0004509
690 Ga0466957_0006910
691 Ga0466957_0007356
692 Ga0466957_0016024
693 Ga0466957_0057298
694 Ga0466957_0586920
695 Ga0466957_0611052
696 Ga0466960_0001982
697 Ga0466960_0002249
698 Ga0466960_0002705
699 Ga0466960_0024904
700 Ga0466960_0122639
701 Ga0466959_0012305
702 Ga0466959_0037952
703 Ga0466959_0098543
704 Ga0466959_0106471
705 Ga0466959_0226797
706 Ga0466959_0295942
707 Ga0466959_0319976
708 Ga0466959_0445925
709 Ga0466958_0000490
710 Ga0466958_0001134
711 Ga0466958_0031861
712 Ga0466958_0069205
713 Ga0466958_0075633
714 Ga0466958_0132389
715 Ga0466958_0157795
716 Ga0466967_0004982
717 Ga0466967_0016927
718 Ga0466967_0065958
719 Ga0466967_0132577
720 Ga0466967_0151681
721 Ga0466967_0212679
722 Ga0466967_0220529
723 Ga0466967_0264711
724 Ga0466967_0277843
725 Ga0466967_0282223
726 Ga0466967_0292816
727 Ga0466967_0449509
728 Ga0466967_0501260
729 Ga0466967_0708401
730 Ga0495603_0028271
731 Ga0495641_0087561
732 Ga0495582_0249856
733 Ga0495639_0072168
734 Ga0495607_0050075
735 Ga0495640_0041246
736 Ga0495635_0126134
737 Ga0495658_0454810
738 Ga0495676_0155030
739 Ga0495683_0001552
740 Ga0495593_0178925
741 Ga0496100_0010584
742 Ga0496100_0232395
743 Ga0496100_0307002
744 Ga0496101_0003106
745 Ga0496101_0089469
746 Ga0496102_0000621
747 Ga0496102_0451098
748 Ga0496102_0543159
749 Ga0496102_0659457
750 Ga0496103_0001320
751 Ga0496103_0601366
752 Ga0496105_0429149
753 Ga0496106_0958108
754 Ga0496107_0223360
755 Ga0496108_0039578
756 Ga0496108_0427637
757 Ga0496108_0708561
758 Ga0496109_0004787
759 Ga0496109_0048160
760 Ga0496110_0031193
761 Ga0496110_0137810
762 Ga0496110_0690752
763 Ga0496113_0579185
764 Ga0496114_0074414
765 Ga0496114_0079392
766 Ga0496114_0241436
767 Ga0496114_0270061
768 Ga0496115_0042889
769 Ga0496116_0039396
770 Ga0496117_0001789
771 Ga0496118_0000160
772 Ga0496118_0000331
773 Ga0496119_0004066
774 Ga0496120_0015737
775 Ga0496121_0082526
776 Ga0496125_0043966
777 Ga0496126_0012377
778 Ga0496126_0084869
779 Ga0501032_0036847
780 Ga0501033_0406569
781 Ga0501033_0548659
782 Ga0501034_0028091
783 Ga0501034_0399788
784 Ga0501034_0544565
785 Ga0501034_0619868
786 Ga0501039_0357106
787 Ga0501040_0205486
788 Ga0501042_0104032
789 Ga0501047_0007610
790 Ga0501047_0455332
791 Ga0501048_0341371
792 Ga0501067_0032542
793 Ga0501068_0009232
794 Ga0501068_0357372
795 Ga0501070_0060665
796 Ga0501070_0337106
797 Ga0501072_0050642
798 Ga0501074_0517093
799 Ga0501076_0281623
800 Ga0501077_0386640
801 Ga0501080_0257040
802 Ga0501081_0301710
803 Ga0501083_0452448
804 Ga0501035_0000218
805 Ga0501044_0000639
806 Ga0501044_0063129
807 Ga0501044_0463076
808 nmdc:mga03n38_2817_c1
809 nmdc:mga00v17_112672_c1
810 nmdc:mga00v17_488237_c1
811 nmdc:mga00v17_68685_c1
812 nmdc:mga0yw44_200325_c1
813 nmdc:mga0yw44_349897_c1
814 nmdc:mga0yw44_651670_c1
815 nmdc:mga0yw44_698403_c1
816 nmdc:mga0yw44_81981_c1
817 nmdc:mga0k408_268154_c1
818 nmdc:mga06z11_21829_c2
819 nmdc:mga07m45_105077_c1
820 nmdc:mga07m45_16563_c1
821 nmdc:mga08y16_319968_c1
822 nmdc:mga0rr50_497528_c1
823 Ga0495655_0178273
824 Ga0495619_0067032
825 Ga0500643_104502
826 Ga0500583_0248137
827 Ga0500556_0002557
828 Ga0500652_016706
829 Ga0500568_0164304
830 Ga0466962_0009762
831 Ga0466962_0018353
832 Ga0466962_0022890
833 Ga0466962_0092950
834 Ga0466962_0264917
835 2548692780
836 2552105368
837 2644089247
838 2644319092
839 2644491396
840 2644515688
841 2753038534
842 2753327001
843 2919717991
844 2932401672
845 8047715969
846 8056210778

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

12

58

0.97

PF17932

TetR_C_24

Tetracyclin repressor-like, C-terminal domain

83

182

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4w97-assembly1.cif.gz_A structure of ketosteroid transcriptional regulator kstr2 of mycobacterium tuberculosis 0.9879 9 200
4w97-assembly1.cif.gz_A structure of ketosteroid transcriptional regulator kstr2 of mycobacterium tuberculosis 0.963 9 200
2ibd-assembly1.cif.gz_B crystal structure of probable transcriptional regulatory protein rha5900 0.9488 13 199
2ibd-assembly1.cif.gz_B crystal structure of probable transcriptional regulatory protein rha5900 0.939 13 199
3vpr-assembly2.cif.gz_C crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8 0.8792 15 199
ID Description Score Start End Superfamily
4w97A02 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9952 55 200 1.10.357.10
4w97A02 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9818 55 200 1.10.357.10
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9396 14 59 1.10.10.60
2ibdB02 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9371 55 199 1.10.357.10
4xk4D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.93 14 59 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A3E2N1Y8-F1-model_v4 HTH-type transcriptional repressor KstR2 0.9956 19 202 GO:0000976
GO:0003700
AF-A0A1X1YD75-F1-model_v4 TetR family transcriptional regulator 0.9937 12 202 GO:0000976
GO:0003700
AF-A0A4R7A2F8-F1-model_v4 deleted 0.9926 20 199
AF-A0A1H4HPK2-F1-model_v4 deleted 0.9894 24 199
AF-H5U3Z9-F1-model_v4 Putative TetR family transcriptional regulator 0.9894 24 200 GO:0000976
GO:0003700

Map