F440463

General Info

Members Datasets Scaffolds Average Seq Length
423 291 846 91

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100235483|Ga0070713_1002354833
Length 104
Sequence MEFRLDYATKANPMFDSSELTSELQALKAHVSRLLSTANDGIFDASKNRAEALIDQIKAALNELGETLSEQEDHVENLISDRPITSLASAFALGVVVGFMLRRH

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
41 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
42 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
61 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
62 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
63 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
64 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
94 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
95 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
130 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
208 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
212 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
213 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
214 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
215 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
216 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
217 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
218 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
223 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
224 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
225 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
226 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
227 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
228 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
231 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
232 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
233 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
234 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
235 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
236 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
237 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
238 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
239 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
240 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
241 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
242 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
243 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
244 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
245 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
246 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
247 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
248 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
249 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
250 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
251 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
252 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
253 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
254 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
255 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
256 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
257 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
258 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
259 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
260 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
261 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
262 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
263 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
264 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
265 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
266 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
267 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
268 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
269 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
270 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
271 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
272 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
273 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
274 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
275 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
276 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
277 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
278 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
279 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
280 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
281 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
282 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
283 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
284 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
285 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
286 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
287 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
288 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
289 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
290 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
291 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.34
Metatranscriptomes 0
Isolates 14.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.51
Nodule 11.58
Rhizoplane 6.15
Rhizosphere 43.74
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100235483 3300005436 Bacteria 1666
2 JGI25150J39212_1045916 3300002774 Bacteria 551
3 JGI25153J46596_10000110 3300003215 Bacteria 93591
4 JGI25153J46596_10076569 3300003215 Bacteria 847
5 rootH1_10027768 3300003323 Bacteria 1248
6 rootH1_10098638 3300003323 Bacteria 1113
7 rootH1_10220872 3300003323 Bacteria 1187
8 rootH1_10243803 3300003323 Bacteria 1521
9 Ga0055542_1009632 3300003762 Bacteria 1812
10 Ga0055529_1031578 3300003763 Bacteria 648
11 Ga0055526_1029488 3300003771 Bacteria 1627
12 Ga0055531_10004631 3300003794 Bacteria 8264
13 Ga0065165_1009267 3300005262 Bacteria 4443
14 Ga0065165_1018614 3300005262 Bacteria 2507
15 Ga0070682_100770181 3300005337 Bacteria 779
16 Ga0070668_100964103 3300005347 Bacteria 765
17 Ga0070671_101910628 3300005355 Bacteria 528
18 Ga0070674_100265627 3300005356 Bacteria 1354
19 Ga0070714_100091805 3300005435 Bacteria 2661
20 Ga0070713_100133883 3300005436 Bacteria 2188
21 Ga0070713_101291697 3300005436 Bacteria 707
22 Ga0070708_100659131 3300005445 Bacteria 986
23 Ga0070663_100542818 3300005455 Bacteria 971
24 Ga0070678_101328306 3300005456 Bacteria 670
25 Ga0070662_101768016 3300005457 Bacteria 534
26 Ga0070706_100237738 3300005467 Bacteria 1701
27 Ga0070707_100393928 3300005468 Bacteria 1345
28 Ga0070697_100037653 3300005536 Bacteria 3908
29 Ga0070697_100377884 3300005536 Bacteria 1227
30 Ga0068853_102284418 3300005539 Bacteria 524
31 Ga0070686_100947291 3300005544 Bacteria 703
32 Ga0070665_100249513 3300005548 Bacteria 1776
33 Ga0070665_100286270 3300005548 Bacteria 1650
34 Ga0070665_100699244 3300005548 Bacteria 1027
35 Ga0068852_100088716 3300005616 Bacteria 2762
36 Ga0068852_100248489 3300005616 Bacteria 1703
37 Ga0068858_100432815 3300005842 Bacteria 1266
38 Ga0081540_1027227 3300005983 Bacteria 3243
39 Ga0070717_10003024 3300006028 Bacteria 11981
40 Ga0075365_10300915 3300006038 Bacteria 1129
41 Ga0075363_100514512 3300006048 Bacteria 712
42 Ga0075363_100966512 3300006048 Bacteria 524
43 Ga0075364_10007739 3300006051 Bacteria 6398
44 Ga0075364_10393715 3300006051 Bacteria 945
45 Ga0075364_11132411 3300006051 Bacteria 531
46 Ga0070715_10914110 3300006163 Bacteria 541
47 Ga0070716_100770713 3300006173 Bacteria 742
48 Ga0070716_101365120 3300006173 Bacteria 575
49 Ga0075362_10605918 3300006177 Bacteria 566
50 Ga0075367_10206674 3300006178 Bacteria 1227
51 Ga0075367_10328104 3300006178 Bacteria 965
52 Ga0075369_10067466 3300006186 Bacteria 1570
53 Ga0075366_10564871 3300006195 Bacteria 705
54 Ga0075370_10021613 3300006353 Bacteria 3526
55 Ga0075370_10199885 3300006353 Bacteria 1179
56 Ga0075370_10586542 3300006353 Bacteria 675
57 Ga0068871_102134271 3300006358 Bacteria 534
58 Ga0099825_1047101 3300006941 Bacteria 1029
59 Ga0099824_1039708 3300006942 Bacteria 1189
60 Ga0099823_1022744 3300006944 Bacteria 5787
61 Ga0099794_10010689 3300007265 Bacteria 3904
62 Ga0099795_10015025 3300007788 Bacteria 2415
63 Ga0105240_10004412 3300009093 Bacteria 21461
64 Ga0105240_11657983 3300009093 Bacteria 668
65 Ga0105245_10084344 3300009098 Bacteria 2910
66 Ga0105243_10506326 3300009148 Bacteria 1145
67 Ga0105243_12415088 3300009148 Bacteria 564
68 Ga0105241_10002293 3300009174 Bacteria 14379
69 Ga0105241_10021664 3300009174 Bacteria 4754
70 Ga0105242_11805586 3300009176 Bacteria 650
71 Ga0105248_10678225 3300009177 Bacteria 1163
72 Ga0105237_10000892 3300009545 Bacteria 40254
73 Ga0105238_10205869 3300009551 Bacteria 1943
74 Ga0105238_11639563 3300009551 Bacteria 674
75 Ga0099796_10026991 3300010159 Bacteria 1829
76 Ga0105239_10013543 3300010375 Bacteria 9054
77 Ga0105239_10034168 3300010375 Bacteria 5582
78 Ga0105239_10622656 3300010375 Bacteria 1232
79 Ga0105246_11086951 3300011119 Bacteria 729
80 Ga0157371_10098729 3300013102 Bacteria 2071
81 Ga0157378_10615405 3300013297 Bacteria 1099
82 Ga0163162_10835548 3300013306 Bacteria 1037
83 Ga0157380_11457156 3300014326 Bacteria 737
84 Ga0214544_1000055 3300021320 Bacteria 133217
85 Ga0214542_1000196 3300021321 Bacteria 95225
86 Ga0214542_1045471 3300021321 Bacteria 964
87 Ga0214545_1000028 3300021324 Bacteria 127957
88 Ga0214545_1046526 3300021324 Bacteria 964
89 Ga0214543_1000044 3300021327 Bacteria 158132
90 Ga0214543_1046246 3300021327 Bacteria 965
91 Ga0207425_1032230 3300025245 Bacteria 1039
92 Ga0209148_1000224 3300025254 Bacteria 92967
93 Ga0209148_1022080 3300025254 Bacteria 1026
94 Ga0209233_1062931 3300025261 Bacteria 710
95 Ga0209455_1003552 3300025272 Bacteria 5457
96 Ga0209130_1034681 3300025284 Bacteria 1014
97 Ga0209564_1003463 3300025295 Bacteria 10758
98 Ga0209758_1000075 3300025297 Bacteria 271585
99 Ga0209758_1003246 3300025297 Bacteria 15078
100 Ga0209758_1011329 3300025297 Bacteria 5182
101 Ga0209758_1045580 3300025297 Bacteria 1590
102 Ga0209256_1003035 3300025299 Bacteria 12390
103 Ga0209256_1022524 3300025299 Bacteria 1905
104 Ga0207426_1000160 3300025302 Bacteria 174540
105 Ga0207426_1007290 3300025302 Bacteria 4649
106 Ga0207426_1016163 3300025302 Bacteria 2688
107 Ga0209051_1038997 3300025303 Bacteria 1721
108 Ga0209051_1126765 3300025303 Bacteria 638
109 Ga0209257_1000795 3300025304 Bacteria 46064
110 Ga0209257_1030040 3300025304 Bacteria 1760
111 Ga0207680_10051077 3300025903 Bacteria 2471
112 Ga0207654_10016479 3300025911 Bacteria 3849
113 Ga0207654_10029119 3300025911 Bacteria 3018
114 Ga0207695_10000029 3300025913 Bacteria 548364
115 Ga0207671_10002337 3300025914 Bacteria 20455
116 Ga0207646_10169996 3300025922 Bacteria 1968
117 Ga0207659_11664784 3300025926 Bacteria 544
118 Ga0207687_10266342 3300025927 Bacteria 1368
119 Ga0207700_10105515 3300025928 Bacteria 2257
120 Ga0207700_10213240 3300025928 Bacteria 1634
121 Ga0207700_10219012 3300025928 Bacteria 1613
122 Ga0207644_10344079 3300025931 Bacteria 1210
123 Ga0207706_11556224 3300025933 Bacteria 537
124 Ga0207686_11286459 3300025934 Bacteria 600
125 Ga0207686_11688026 3300025934 Bacteria 524
126 Ga0207709_10183819 3300025935 Bacteria 1478
127 Ga0207709_10290367 3300025935 Bacteria 1212
128 Ga0207665_10487010 3300025939 Bacteria 951
129 Ga0207665_10795793 3300025939 Bacteria 747
130 Ga0207689_10025471 3300025942 Bacteria 4957
131 Ga0207703_10269341 3300026035 Bacteria 1542
132 Ga0207678_11324881 3300026067 Bacteria 637
133 Ga0207678_11440095 3300026067 Bacteria 609
134 Ga0207683_10213108 3300026121 Bacteria 1758
135 Ga0207698_10403206 3300026142 Bacteria 1307
136 Ga0207698_10470240 3300026142 Bacteria 1217
137 Ga0209389_1000137 3300027296 Bacteria 63287
138 Ga0209489_114122 3300027361 Bacteria 5856
139 Ga0209700_100046 3300027363 Bacteria 159296
140 Ga0209813_10382524 3300027866 Bacteria 564
141 Ga0268266_11397456 3300028379 Bacteria 675
142 Ga0307511_10048094 3300030521 Bacteria 3476
143 Ga0307511_10140842 3300030521 Bacteria 1418
144 Ga0265330_10002148 3300031235 Bacteria 10875
145 Ga0265340_10176262 3300031247 Bacteria 967
146 Ga0265331_10168630 3300031250 Bacteria 991
147 Ga0265316_10245184 3300031344 Bacteria 1317
148 Ga0307509_10312290 3300031507 Bacteria 1313
149 Ga0307508_10000058 3300031616 Bacteria 125293
150 Ga0307508_10130154 3300031616 Bacteria 2120
151 Ga0307508_10480306 3300031616 Bacteria 836
152 Ga0307508_10721342 3300031616 Bacteria 608
153 Ga0265314_10056897 3300031711 Bacteria 2690
154 Ga0265314_10075636 3300031711 Bacteria 2240
155 Ga0265342_10160629 3300031712 Bacteria 1242
156 Ga0307516_10006612 3300031730 Bacteria 13550
157 Ga0307516_10007049 3300031730 Bacteria 13010
158 Ga0307411_11731738 3300032005 Bacteria 579
159 Ga0307507_10085574 3300033179 Bacteria 2741
160 Ga0307510_10261626 3300033180 Bacteria 1211
161 Ga0373926_0098278 3300035083 Bacteria 1093
162 Ga0373926_0171982 3300035083 Bacteria 829
163 Ga0373945_0054051 3300035116 Bacteria 1484
164 Ga0373954_0017475 3300035118 Bacteria 3223
165 Ga0373957_0450955 3300035120 Bacteria 557
166 Ga0373943_0006170 3300035170 Bacteria 5379
167 Ga0373943_0151563 3300035170 Bacteria 1256
168 Ga0373946_0617385 3300035171 Bacteria 563
169 Ga0373955_0504271 3300035172 Bacteria 739
170 Ga0373924_0078458 3300035410 Bacteria 1402
171 Ga0373935_0004983 3300035692 Bacteria 7813
172 Ga0373935_0071435 3300035692 Bacteria 2239
173 Ga0373927_0008479 3300035695 Bacteria 6916
174 Ga0373927_0063217 3300035695 Bacteria 2394
175 Ga0373927_0063358 3300035695 Bacteria 2391
176 Ga0373947_0096428 3300035725 Bacteria 1852
177 Ga0373947_0699003 3300035725 Bacteria 692
178 Ga0373937_0272717 3300036401 Bacteria 1597
179 Ga0373925_0014554 3300037068 Bacteria 5685
180 Ga0373925_0105324 3300037068 Bacteria 2173
181 Ga0373925_0973230 3300037068 Unclassified 699
182 Ga0373925_1531317 3300037068 Bacteria 545
183 Ga0395900_1123602 3300037418 Bacteria 703
184 Ga0395905_0521661 3300037471 Bacteria 1089
185 Ga0395905_1449238 3300037471 Bacteria 591
186 Ga0436364_0809140 3300037853 Bacteria 570
187 Ga0436365_0603126 3300039437 Bacteria 640
188 Ga0436361_0421890 3300039447 Bacteria 668
189 Ga0451833_0271476 3300041491 Bacteria 810
190 Ga0451851_0449431 3300041507 Bacteria 854
191 Ga0466965_0271907 3300044683 Bacteria 913
192 Ga0466965_0296909 3300044683 Bacteria 876
193 Ga0466959_1214020 3300045049 Bacteria 501
194 Ga0495592_0073200 3300046454 Bacteria 2492
195 Ga0495603_0092137 3300046455 Bacteria 1771
196 Ga0495603_0488281 3300046455 Bacteria 705
197 Ga0495629_0014747 3300046459 Bacteria 5621
198 Ga0495629_1019719 3300046459 Bacteria 538
199 Ga0495651_0012637 3300046462 Bacteria 6515
200 Ga0495651_0027824 3300046462 Bacteria 4406
201 Ga0495653_0132701 3300046463 Bacteria 1761
202 Ga0495580_0025887 3300046472 Bacteria 4283
203 Ga0495582_0012538 3300046473 Bacteria 4670
204 Ga0495639_0002142 3300046475 Bacteria 8708
205 Ga0495664_0016165 3300046477 Bacteria 4249
206 Ga0495594_0002226 3300046499 Bacteria 10087
207 Ga0495606_0060985 3300046507 Bacteria 2414
208 Ga0495618_0094408 3300046514 Bacteria 1913
209 Ga0495618_0151332 3300046514 Bacteria 1482
210 Ga0495644_0397730 3300046523 Bacteria 545
211 Ga0495648_0017669 3300046524 Bacteria 5088
212 Ga0495648_0068834 3300046524 Bacteria 2063
213 Ga0495666_0059799 3300046526 Bacteria 1822
214 Ga0495665_0002068 3300046531 Bacteria 10862
215 Ga0495640_0015696 3300046533 Bacteria 5689
216 Ga0495640_0268377 3300046533 Bacteria 1065
217 Ga0495622_0011687 3300046557 Bacteria 4058
218 Ga0495622_0014798 3300046557 Bacteria 3626
219 Ga0495622_0097267 3300046557 Bacteria 1350
220 Ga0495634_0010636 3300046642 Bacteria 6735
221 Ga0495634_0162605 3300046642 Bacteria 1407
222 Ga0495625_0172033 3300046660 Bacteria 1446
223 Ga0495635_0005726 3300046663 Bacteria 8655
224 Ga0495635_0089129 3300046663 Bacteria 2110
225 Ga0495588_0046958 3300046674 Bacteria 2216
226 Ga0495646_0020097 3300046680 Bacteria 4222
227 Ga0495647_0305967 3300046681 Bacteria 717
228 Ga0495658_0003333 3300046683 Bacteria 7969
229 Ga0495613_0008228 3300046689 Bacteria 7744
230 Ga0495613_0068132 3300046689 Bacteria 2596
231 Ga0495624_0002520 3300046690 Bacteria 13853
232 Ga0495624_0823174 3300046690 Bacteria 548
233 Ga0495600_0117171 3300046809 Bacteria 1733
234 Ga0495581_0025017 3300047315 Bacteria 3459
235 Ga0495581_0339811 3300047315 Bacteria 877
236 Ga0495581_0911180 3300047315 Bacteria 502
237 Ga0495604_0050351 3300047317 Bacteria 3234
238 Ga0495604_0400513 3300047317 Bacteria 904
239 Ga0495674_0013608 3300047319 Bacteria 7643
240 Ga0495672_0424179 3300047320 Bacteria 604
241 Ga0495676_0037682 3300047321 Bacteria 4022
242 Ga0495676_0180147 3300047321 Bacteria 1481
243 Ga0495680_0888527 3300047322 Bacteria 576
244 Ga0495683_0229172 3300047323 Bacteria 825
245 Ga0495675_0452064 3300047444 Bacteria 743
246 Ga0495684_0603305 3300047471 Bacteria 740
247 Ga0495686_0030776 3300047472 Bacteria 3484
248 Ga0495686_0040848 3300047472 Bacteria 2956
249 Ga0495593_0002908 3300047673 Bacteria 10322
250 Ga0495593_0185676 3300047673 Bacteria 1047
251 Ga0495593_0234909 3300047673 Bacteria 919
252 Ga0495602_0078694 3300048088 Bacteria 2784
253 Ga0495602_0497941 3300048088 Bacteria 852
254 Ga0495614_0156565 3300048089 Bacteria 1018
255 Ga0496101_0356291 3300048904 Bacteria 1150
256 Ga0496101_1018615 3300048904 Bacteria 651
257 Ga0496102_0138532 3300048905 Bacteria 2281
258 Ga0496102_0267764 3300048905 Bacteria 1611
259 Ga0496103_0470023 3300048906 Bacteria 806
260 Ga0496104_0022383 3300048907 Bacteria 5805
261 Ga0496104_0178111 3300048907 Bacteria 2036
262 Ga0496104_1043205 3300048907 Bacteria 721
263 Ga0496104_1193163 3300048907 Bacteria 664
264 Ga0496105_0018352 3300048908 Bacteria 5619
265 Ga0496105_0371982 3300048908 Bacteria 1138
266 Ga0496106_0417149 3300048909 Bacteria 1079
267 Ga0496107_0705580 3300048910 Bacteria 742
268 Ga0496107_0956605 3300048910 Bacteria 623
269 Ga0496108_0081583 3300048911 Bacteria 2741
270 Ga0496111_0933388 3300048914 Bacteria 624
271 Ga0496111_1049630 3300048914 Bacteria 582
272 Ga0496112_0000382 3300048915 Bacteria 29045
273 Ga0496112_0781980 3300048915 Bacteria 880
274 Ga0496113_0125205 3300048916 Bacteria 2012
275 Ga0496113_0565709 3300048916 Bacteria 911
276 Ga0496114_0186514 3300048917 Bacteria 1813
277 Ga0496114_0194204 3300048917 Bacteria 1777
278 Ga0496114_1388337 3300048917 Bacteria 590
279 Ga0496115_0755425 3300048918 Bacteria 760
280 Ga0496115_0760377 3300048918 Bacteria 757
281 Ga0496117_0103044 3300048920 Bacteria 1800
282 Ga0496117_0157896 3300048920 Bacteria 1333
283 Ga0496118_0055750 3300048921 Bacteria 2978
284 Ga0496118_0398972 3300048921 Bacteria 715
285 Ga0496118_0484396 3300048921 Bacteria 619
286 Ga0496119_0020609 3300048922 Bacteria 4802
287 Ga0496119_0134093 3300048922 Bacteria 1345
288 Ga0496120_0434883 3300048923 Bacteria 574
289 Ga0496121_0002396 3300048924 Bacteria 28735
290 Ga0496121_0176916 3300048924 Bacteria 1544
291 Ga0496121_0313978 3300048924 Bacteria 1058
292 Ga0496122_0181391 3300048925 Bacteria 1255
293 Ga0496123_0250617 3300048926 Bacteria 874
294 Ga0496124_0349040 3300048927 Bacteria 1047
295 Ga0496124_0411811 3300048927 Unclassified 935
296 Ga0496124_0940472 3300048927 Bacteria 520
297 Ga0496125_0006206 3300048928 Bacteria 13017
298 Ga0496125_0018774 3300048928 Bacteria 6553
299 Ga0496126_0007810 3300048929 Bacteria 11663
300 Ga0496126_0053065 3300048929 Bacteria 3680
301 Ga0496126_0069990 3300048929 Bacteria 3127
302 Ga0496126_0114906 3300048929 Bacteria 2341
303 Ga0496126_0281961 3300048929 Bacteria 1376
304 Ga0496126_0684348 3300048929 Bacteria 799
305 Ga0496126_0820597 3300048929 Bacteria 712
306 Ga0496126_1270807 3300048929 Bacteria 538
307 Ga0496126_1318288 3300048929 Bacteria 525
308 Ga0501046_0042875 3300049580 Bacteria 3605
309 Ga0501071_0104583 3300049587 Bacteria 2090
310 Ga0501044_0054046 3300049823 Bacteria 4129
311 nmdc:mga03n38_738906_c1 3300050490 Bacteria 569
312 nmdc:mga00v17_201457_c1 3300050491 Bacteria 1287
313 nmdc:mga00v17_359879_c1 3300050491 Bacteria 946
314 nmdc:mga0yw44_234788_c1 3300050492 Bacteria 1218
315 nmdc:mga0yw44_23519_c1 3300050492 Bacteria 3473
316 nmdc:mga0yw44_280702_c1 3300050492 Bacteria 1113
317 nmdc:mga0yw44_311714_c1 3300050492 Bacteria 1056
318 nmdc:mga0k408_408882_c1 3300050493 Bacteria 807
319 nmdc:mga06z11_25213_c1 3300050494 Bacteria 2815
320 nmdc:mga04h51_438259_c1 3300050495 Bacteria 551
321 nmdc:mga04h51_442737_c1 3300050495 Bacteria 549
322 nmdc:mga07m45_177742_c1 3300050496 Bacteria 1237
323 nmdc:mga07m45_34836_c1 3300050496 Bacteria 2799
324 nmdc:mga07m45_570625_c1 3300050496 Bacteria 654
325 nmdc:mga07m45_609282_c1 3300050496 Bacteria 630
326 nmdc:mga07m45_864297_c1 3300050496 Bacteria 518
327 nmdc:mga0sz30_12419_c1 3300050516 Bacteria 3315
328 nmdc:mga0sz30_41912_c1 3300050516 Bacteria 1925
329 nmdc:mga0sz30_422566_c1 3300050516 Bacteria 598
330 nmdc:mga0sz30_47959_c2 3300050516 Bacteria 1374
331 Ga0500635_0010324 3300053080 Bacteria 2618
332 Ga0500635_0166823 3300053080 Bacteria 847
333 Ga0495595_0678587 3300053084 Bacteria 528
334 Ga0495595_0690965 3300053084 Bacteria 523
335 Ga0495619_0217630 3300053085 Bacteria 1323
336 Ga0500566_0004743 3300053094 Bacteria 8101
337 Ga0500566_0215238 3300053094 Bacteria 959
338 Ga0500554_244215 3300053102 Bacteria 593
339 Ga0500556_0022258 3300053104 Bacteria 2056
340 Ga0500558_100119 3300053106 Bacteria 1152
341 Ga0500569_306729 3300053109 Bacteria 533
342 Ga0500595_000181 3300053119 Bacteria 42687
343 Ga0500595_006363 3300053119 Bacteria 5017
344 Ga0500595_012033 3300053119 Bacteria 3358
345 Ga0500595_027390 3300053119 Bacteria 1952
346 Ga0500597_172876 3300053120 Bacteria 920
347 Ga0500559_0311640 3300053136 Bacteria 738
348 Ga0500559_0471107 3300053136 Bacteria 579
349 Ga0500568_0024110 3300053139 Bacteria 2579
350 Ga0500603_027024 3300053150 Bacteria 1456
351 Ga0500616_0082721 3300053153 Bacteria 1610
352 Ga0500638_051479 3300053162 Bacteria 1991
353 Ga0500638_066170 3300053162 Bacteria 1732
354 Ga0500639_081338 3300053163 Bacteria 1631
355 Ga0500636_0080342 3300053177 Bacteria 1879
356 Ga0500637_0000116 3300053178 Bacteria 29193
357 Ga0500637_0055030 3300053178 Bacteria 2271
358 Ga0500657_260577 3300053728 Bacteria 505
359 Ga0500552_022113 3300053733 Bacteria 916
360 Ga0500661_001097 3300055283 Bacteria 5094
361 Ga0501082_0214318 3300060353 Bacteria 1675
362 2507510584 2507262055 Bacteria 8048963
363 2509148576 2508501128 Bacteria 8613869
364 2513640223 2513237094 Bacteria 8789602
365 2513679239 2513237098 Bacteria 9902361
366 2514015068 2513237161 Bacteria 8871253
367 2524463611 2524023210 Bacteria 9029266
368 2617350002 2617270735 Bacteria 9163226
369 2617378681 2617270741 Bacteria 8201522
370 2793063349 2791355196 Bacteria 7323613
371 2805917131 2802429603 Bacteria 8777136
372 2824603897 2824600985 Bacteria 8488197
373 2824612538 2824609381 Bacteria 8672835
374 2824675879 2824671348 Bacteria 8369588
375 2824692001 2824687955 Bacteria 8360029
376 2824696603 2824696289 Bacteria 8335049
377 2824733692 2824732956 Bacteria 7810675
378 2824747950 2824746037 Bacteria 7911610
379 2824776758 2824773399 Bacteria 8360218
380 2838125415 2838122688 Bacteria 8803140
381 2841941925 2841941048 Bacteria 8688029
382 2841951359 2841949485 Bacteria 8680857
383 2841968642 2841966195 Bacteria 8673214
384 2841976157 2841974524 Bacteria 8931498
385 2841987522 2841983080 Bacteria 8395090
386 2842045106 2842038055 Bacteria 8002051
387 2842049233 2842045827 Bacteria 8006841
388 2844317342 2844315083 Bacteria 8138177
389 2847934049 2847930680 Bacteria 9342022
390 2849081066 2849076700 Bacteria 7039503
391 2857516158 2857509624 Bacteria 7472071
392 2874628465 2874620515 Bacteria 8290088
393 2876769413 2876761206 Bacteria 10111113
394 2879086862 2879083081 Bacteria 8587928
395 2885367437 2885366525 Bacteria 8326213
396 2885389474 2885383462 Bacteria 9473874
397 2888388621 2888388044 Bacteria 7304136
398 2888422646 2888419890 Bacteria 7857137
399 2903733272 2903727486 Bacteria 8281579
400 2903774723 2903768456 Bacteria 9749579
401 2904667255 2904666416 Bacteria 8226587
402 2906606238 2906602504 Bacteria 8295279
403 2906634075 2906626472 Bacteria 8826946
404 2906647555 2906643746 Bacteria 8722424
405 2908778286 2908775508 Bacteria 8092255
406 2935702743 2935694250 Bacteria 9291695
407 2935914501 2935908558 Bacteria 8568796
408 2935919051 2935916978 Bacteria 9113783
409 2935932118 2935926038 Bacteria 8601059
410 2935940716 2935934488 Bacteria 8602579
411 2935948697 2935942939 Bacteria 8599779
412 2935957196 2935951376 Bacteria 8602333
413 2935973832 2935967501 Bacteria 8603075
414 3005486340 3005483717 Bacteria 7877331
415 3005597040 3005594810 Bacteria 8716512
416 3005720471 3005718088 Bacteria 8283608
417 8006943684 8006933436 Bacteria 10410654
418 8006983935 8006973647 Bacteria 10679141
419 8016590089 8016583857 Bacteria 10421953
420 8019656024 8019648815 Bacteria 10014479
421 8019688002 8019687851 Bacteria 8712826
422 8056687705 8056681323 Bacteria 8472857
423 8056971947 8056967851 Bacteria 9038162
424 Ga0070713_100235483
425 JGI25150J39212_1045916
426 JGI25153J46596_10000110
427 JGI25153J46596_10076569
428 rootH1_10027768
429 rootH1_10098638
430 rootH1_10220872
431 rootH1_10243803
432 Ga0055542_1009632
433 Ga0055529_1031578
434 Ga0055526_1029488
435 Ga0055531_10004631
436 Ga0065165_1009267
437 Ga0065165_1018614
438 Ga0070682_100770181
439 Ga0070668_100964103
440 Ga0070671_101910628
441 Ga0070674_100265627
442 Ga0070714_100091805
443 Ga0070713_100133883
444 Ga0070713_101291697
445 Ga0070708_100659131
446 Ga0070663_100542818
447 Ga0070678_101328306
448 Ga0070662_101768016
449 Ga0070706_100237738
450 Ga0070707_100393928
451 Ga0070697_100037653
452 Ga0070697_100377884
453 Ga0068853_102284418
454 Ga0070686_100947291
455 Ga0070665_100249513
456 Ga0070665_100286270
457 Ga0070665_100699244
458 Ga0068852_100088716
459 Ga0068852_100248489
460 Ga0068858_100432815
461 Ga0081540_1027227
462 Ga0070717_10003024
463 Ga0075365_10300915
464 Ga0075363_100514512
465 Ga0075363_100966512
466 Ga0075364_10007739
467 Ga0075364_10393715
468 Ga0075364_11132411
469 Ga0070715_10914110
470 Ga0070716_100770713
471 Ga0070716_101365120
472 Ga0075362_10605918
473 Ga0075367_10206674
474 Ga0075367_10328104
475 Ga0075369_10067466
476 Ga0075366_10564871
477 Ga0075370_10021613
478 Ga0075370_10199885
479 Ga0075370_10586542
480 Ga0068871_102134271
481 Ga0099825_1047101
482 Ga0099824_1039708
483 Ga0099823_1022744
484 Ga0099794_10010689
485 Ga0099795_10015025
486 Ga0105240_10004412
487 Ga0105240_11657983
488 Ga0105245_10084344
489 Ga0105243_10506326
490 Ga0105243_12415088
491 Ga0105241_10002293
492 Ga0105241_10021664
493 Ga0105242_11805586
494 Ga0105248_10678225
495 Ga0105237_10000892
496 Ga0105238_10205869
497 Ga0105238_11639563
498 Ga0099796_10026991
499 Ga0105239_10013543
500 Ga0105239_10034168
501 Ga0105239_10622656
502 Ga0105246_11086951
503 Ga0157371_10098729
504 Ga0157378_10615405
505 Ga0163162_10835548
506 Ga0157380_11457156
507 Ga0214544_1000055
508 Ga0214542_1000196
509 Ga0214542_1045471
510 Ga0214545_1000028
511 Ga0214545_1046526
512 Ga0214543_1000044
513 Ga0214543_1046246
514 Ga0207425_1032230
515 Ga0209148_1000224
516 Ga0209148_1022080
517 Ga0209233_1062931
518 Ga0209455_1003552
519 Ga0209130_1034681
520 Ga0209564_1003463
521 Ga0209758_1000075
522 Ga0209758_1003246
523 Ga0209758_1011329
524 Ga0209758_1045580
525 Ga0209256_1003035
526 Ga0209256_1022524
527 Ga0207426_1000160
528 Ga0207426_1007290
529 Ga0207426_1016163
530 Ga0209051_1038997
531 Ga0209051_1126765
532 Ga0209257_1000795
533 Ga0209257_1030040
534 Ga0207680_10051077
535 Ga0207654_10016479
536 Ga0207654_10029119
537 Ga0207695_10000029
538 Ga0207671_10002337
539 Ga0207646_10169996
540 Ga0207659_11664784
541 Ga0207687_10266342
542 Ga0207700_10105515
543 Ga0207700_10213240
544 Ga0207700_10219012
545 Ga0207644_10344079
546 Ga0207706_11556224
547 Ga0207686_11286459
548 Ga0207686_11688026
549 Ga0207709_10183819
550 Ga0207709_10290367
551 Ga0207665_10487010
552 Ga0207665_10795793
553 Ga0207689_10025471
554 Ga0207703_10269341
555 Ga0207678_11324881
556 Ga0207678_11440095
557 Ga0207683_10213108
558 Ga0207698_10403206
559 Ga0207698_10470240
560 Ga0209389_1000137
561 Ga0209489_114122
562 Ga0209700_100046
563 Ga0209813_10382524
564 Ga0268266_11397456
565 Ga0307511_10048094
566 Ga0307511_10140842
567 Ga0265330_10002148
568 Ga0265340_10176262
569 Ga0265331_10168630
570 Ga0265316_10245184
571 Ga0307509_10312290
572 Ga0307508_10000058
573 Ga0307508_10130154
574 Ga0307508_10480306
575 Ga0307508_10721342
576 Ga0265314_10056897
577 Ga0265314_10075636
578 Ga0265342_10160629
579 Ga0307516_10006612
580 Ga0307516_10007049
581 Ga0307411_11731738
582 Ga0307507_10085574
583 Ga0307510_10261626
584 Ga0373926_0098278
585 Ga0373926_0171982
586 Ga0373945_0054051
587 Ga0373954_0017475
588 Ga0373957_0450955
589 Ga0373943_0006170
590 Ga0373943_0151563
591 Ga0373946_0617385
592 Ga0373955_0504271
593 Ga0373924_0078458
594 Ga0373935_0004983
595 Ga0373935_0071435
596 Ga0373927_0008479
597 Ga0373927_0063217
598 Ga0373927_0063358
599 Ga0373947_0096428
600 Ga0373947_0699003
601 Ga0373937_0272717
602 Ga0373925_0014554
603 Ga0373925_0105324
604 Ga0373925_0973230
605 Ga0373925_1531317
606 Ga0395900_1123602
607 Ga0395905_0521661
608 Ga0395905_1449238
609 Ga0436364_0809140
610 Ga0436365_0603126
611 Ga0436361_0421890
612 Ga0451833_0271476
613 Ga0451851_0449431
614 Ga0466965_0271907
615 Ga0466965_0296909
616 Ga0466959_1214020
617 Ga0495592_0073200
618 Ga0495603_0092137
619 Ga0495603_0488281
620 Ga0495629_0014747
621 Ga0495629_1019719
622 Ga0495651_0012637
623 Ga0495651_0027824
624 Ga0495653_0132701
625 Ga0495580_0025887
626 Ga0495582_0012538
627 Ga0495639_0002142
628 Ga0495664_0016165
629 Ga0495594_0002226
630 Ga0495606_0060985
631 Ga0495618_0094408
632 Ga0495618_0151332
633 Ga0495644_0397730
634 Ga0495648_0017669
635 Ga0495648_0068834
636 Ga0495666_0059799
637 Ga0495665_0002068
638 Ga0495640_0015696
639 Ga0495640_0268377
640 Ga0495622_0011687
641 Ga0495622_0014798
642 Ga0495622_0097267
643 Ga0495634_0010636
644 Ga0495634_0162605
645 Ga0495625_0172033
646 Ga0495635_0005726
647 Ga0495635_0089129
648 Ga0495588_0046958
649 Ga0495646_0020097
650 Ga0495647_0305967
651 Ga0495658_0003333
652 Ga0495613_0008228
653 Ga0495613_0068132
654 Ga0495624_0002520
655 Ga0495624_0823174
656 Ga0495600_0117171
657 Ga0495581_0025017
658 Ga0495581_0339811
659 Ga0495581_0911180
660 Ga0495604_0050351
661 Ga0495604_0400513
662 Ga0495674_0013608
663 Ga0495672_0424179
664 Ga0495676_0037682
665 Ga0495676_0180147
666 Ga0495680_0888527
667 Ga0495683_0229172
668 Ga0495675_0452064
669 Ga0495684_0603305
670 Ga0495686_0030776
671 Ga0495686_0040848
672 Ga0495593_0002908
673 Ga0495593_0185676
674 Ga0495593_0234909
675 Ga0495602_0078694
676 Ga0495602_0497941
677 Ga0495614_0156565
678 Ga0496101_0356291
679 Ga0496101_1018615
680 Ga0496102_0138532
681 Ga0496102_0267764
682 Ga0496103_0470023
683 Ga0496104_0022383
684 Ga0496104_0178111
685 Ga0496104_1043205
686 Ga0496104_1193163
687 Ga0496105_0018352
688 Ga0496105_0371982
689 Ga0496106_0417149
690 Ga0496107_0705580
691 Ga0496107_0956605
692 Ga0496108_0081583
693 Ga0496111_0933388
694 Ga0496111_1049630
695 Ga0496112_0000382
696 Ga0496112_0781980
697 Ga0496113_0125205
698 Ga0496113_0565709
699 Ga0496114_0186514
700 Ga0496114_0194204
701 Ga0496114_1388337
702 Ga0496115_0755425
703 Ga0496115_0760377
704 Ga0496117_0103044
705 Ga0496117_0157896
706 Ga0496118_0055750
707 Ga0496118_0398972
708 Ga0496118_0484396
709 Ga0496119_0020609
710 Ga0496119_0134093
711 Ga0496120_0434883
712 Ga0496121_0002396
713 Ga0496121_0176916
714 Ga0496121_0313978
715 Ga0496122_0181391
716 Ga0496123_0250617
717 Ga0496124_0349040
718 Ga0496124_0411811
719 Ga0496124_0940472
720 Ga0496125_0006206
721 Ga0496125_0018774
722 Ga0496126_0007810
723 Ga0496126_0053065
724 Ga0496126_0069990
725 Ga0496126_0114906
726 Ga0496126_0281961
727 Ga0496126_0684348
728 Ga0496126_0820597
729 Ga0496126_1270807
730 Ga0496126_1318288
731 Ga0501046_0042875
732 Ga0501071_0104583
733 Ga0501044_0054046
734 nmdc:mga03n38_738906_c1
735 nmdc:mga00v17_201457_c1
736 nmdc:mga00v17_359879_c1
737 nmdc:mga0yw44_234788_c1
738 nmdc:mga0yw44_23519_c1
739 nmdc:mga0yw44_280702_c1
740 nmdc:mga0yw44_311714_c1
741 nmdc:mga0k408_408882_c1
742 nmdc:mga06z11_25213_c1
743 nmdc:mga04h51_438259_c1
744 nmdc:mga04h51_442737_c1
745 nmdc:mga07m45_177742_c1
746 nmdc:mga07m45_34836_c1
747 nmdc:mga07m45_570625_c1
748 nmdc:mga07m45_609282_c1
749 nmdc:mga07m45_864297_c1
750 nmdc:mga0sz30_12419_c1
751 nmdc:mga0sz30_41912_c1
752 nmdc:mga0sz30_422566_c1
753 nmdc:mga0sz30_47959_c2
754 Ga0500635_0010324
755 Ga0500635_0166823
756 Ga0495595_0678587
757 Ga0495595_0690965
758 Ga0495619_0217630
759 Ga0500566_0004743
760 Ga0500566_0215238
761 Ga0500554_244215
762 Ga0500556_0022258
763 Ga0500558_100119
764 Ga0500569_306729
765 Ga0500595_000181
766 Ga0500595_006363
767 Ga0500595_012033
768 Ga0500595_027390
769 Ga0500597_172876
770 Ga0500559_0311640
771 Ga0500559_0471107
772 Ga0500568_0024110
773 Ga0500603_027024
774 Ga0500616_0082721
775 Ga0500638_051479
776 Ga0500638_066170
777 Ga0500639_081338
778 Ga0500636_0080342
779 Ga0500637_0000116
780 Ga0500637_0055030
781 Ga0500657_260577
782 Ga0500552_022113
783 Ga0500661_001097
784 Ga0501082_0214318
785 2507510584
786 2509148576
787 2513640223
788 2513679239
789 2514015068
790 2524463611
791 2617350002
792 2617378681
793 2793063349
794 2805917131
795 2824603897
796 2824612538
797 2824675879
798 2824692001
799 2824696603
800 2824733692
801 2824747950
802 2824776758
803 2838125415
804 2841941925
805 2841951359
806 2841968642
807 2841976157
808 2841987522
809 2842045106
810 2842049233
811 2844317342
812 2847934049
813 2849081066
814 2857516158
815 2874628465
816 2876769413
817 2879086862
818 2885367437
819 2885389474
820 2888388621
821 2888422646
822 2903733272
823 2903774723
824 2904667255
825 2906606238
826 2906634075
827 2906647555
828 2908778286
829 2935702743
830 2935914501
831 2935919051
832 2935932118
833 2935940716
834 2935948697
835 2935957196
836 2935973832
837 3005486340
838 3005597040
839 3005720471
840 8006943684
841 8006983935
842 8016590089
843 8019656024
844 8019688002
845 8056687705
846 8056971947

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map