F440418

General Info

Members Datasets Scaffolds Average Seq Length
422 289 844 85

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2880495981|2880502672
Length 87
Sequence AAAQFNIHDAKTNLSRIIERVEHGEEIVISRAGNPVAKVIPLRRTTRTGRGSLRGALDLTGDWDSDEVNDEVARDFGLPGRPRRTAP

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
181 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
196 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
210 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
211 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
221 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
273 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
274 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
275 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
276 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
277 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
278 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
279 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
280 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
281 2643221692 Nocardia sp. Root136 Isolate Unclassified
282 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
283 2858868258 Micromonospora sp. MH33 Isolate Unclassified
284 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
285 2902582711 Micromonospora sp. AP08 Isolate Unclassified
286 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
287 8002784119 Frankia sp. AgB1.9 Isolate Nodule
288 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
289 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.97
Metatranscriptomes 1.66
Isolates 2.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.42
Nodule 0.47
Rhizoplane 5.92
Rhizosphere 85.07
Stem 0
Stem Tuber 0
Unclassified 5.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1015282 3300001976 Bacteria 1000
2 JGI24740J21852_10019322 3300001979 Bacteria 2402
3 JGI24739J22299_10013058 3300001989 Bacteria 3038
4 JGI24737J22298_10035580 3300001990 Bacteria 1540
5 JGI24735J21928_10021305 3300002067 Bacteria 1980
6 JGI24033J26618_1047429 3300002155 Unclassified 611
7 JGI24751J29686_10039112 3300002459 Bacteria 982
8 JGI25406J46586_10005257 3300003203 Bacteria 6007
9 Ga0070658_10075952 3300005327 Bacteria 2756
10 Ga0070676_10035026 3300005328 Bacteria 2885
11 Ga0070676_10472678 3300005328 Bacteria 885
12 Ga0070683_100854382 3300005329 Unclassified 873
13 Ga0070690_100064092 3300005330 Bacteria 2373
14 Ga0070670_100291382 3300005331 Bacteria 1426
15 Ga0068869_100011554 3300005334 Bacteria 5796
16 Ga0070666_10143128 3300005335 Bacteria 1666
17 Ga0070680_100016675 3300005336 Bacteria 5784
18 Ga0070682_100035063 3300005337 Bacteria 3060
19 Ga0070682_100563857 3300005337 Bacteria 893
20 Ga0070682_100844047 3300005337 Bacteria 748
21 Ga0068868_100018832 3300005338 Bacteria 5166
22 Ga0070660_100025891 3300005339 Bacteria 4363
23 Ga0070689_100222513 3300005340 Bacteria 1549
24 Ga0070691_10003850 3300005341 Bacteria 6780
25 Ga0070661_100021412 3300005344 Bacteria 4617
26 Ga0070692_10089308 3300005345 Bacteria 1672
27 Ga0070668_100411289 3300005347 Bacteria 1157
28 Ga0070668_100659400 3300005347 Bacteria 920
29 Ga0070668_101333899 3300005347 Unclassified 653
30 Ga0070675_100011986 3300005354 Bacteria 6793
31 Ga0070675_101405734 3300005354 Bacteria 643
32 Ga0070671_100020030 3300005355 Bacteria 5450
33 Ga0070674_100637229 3300005356 Bacteria 905
34 Ga0070673_100735473 3300005364 Bacteria 908
35 Ga0070688_100033735 3300005365 Bacteria 3096
36 Ga0070688_100909179 3300005365 Bacteria 695
37 Ga0070659_100071821 3300005366 Bacteria 2753
38 Ga0070659_100729866 3300005366 Bacteria 858
39 Ga0070667_100038287 3300005367 Bacteria 4020
40 Ga0070667_100283149 3300005367 Bacteria 1489
41 Ga0070709_10002777 3300005434 Bacteria 9461
42 Ga0070714_100047495 3300005435 Bacteria 3647
43 Ga0070714_100503354 3300005435 Bacteria 1155
44 Ga0070714_102124198 3300005435 Bacteria 547
45 Ga0070713_100009971 3300005436 Bacteria 6843
46 Ga0070713_100112125 3300005436 Bacteria 2379
47 Ga0070713_102356835 3300005436 Unclassified 515
48 Ga0070710_10039837 3300005437 Bacteria 2587
49 Ga0070710_10321710 3300005437 Bacteria 1016
50 Ga0070701_10057017 3300005438 Bacteria 2046
51 Ga0070711_100173615 3300005439 Bacteria 1645
52 Ga0070711_101506618 3300005439 Bacteria 587
53 Ga0070700_100102914 3300005441 Bacteria 1885
54 Ga0070694_100443896 3300005444 Bacteria 1023
55 Ga0070663_100007414 3300005455 Bacteria 6675
56 Ga0070663_100774182 3300005455 Bacteria 821
57 Ga0070678_100915044 3300005456 Unclassified 802
58 Ga0070681_10032736 3300005458 Bacteria 5219
59 Ga0070681_10204941 3300005458 Bacteria 1890
60 Ga0068867_101196018 3300005459 Unclassified 698
61 Ga0070706_100000524 3300005467 Bacteria 44840
62 Ga0070706_100117065 3300005467 Bacteria 2482
63 Ga0070707_100481341 3300005468 Bacteria 1203
64 Ga0070698_100008362 3300005471 Bacteria 11184
65 Ga0070698_100067913 3300005471 Bacteria 3584
66 Ga0070698_100705397 3300005471 Bacteria 951
67 Ga0070679_100020226 3300005530 Bacteria 6488
68 Ga0070679_100656186 3300005530 Unclassified 992
69 Ga0070684_101468093 3300005535 Unclassified 642
70 Ga0070697_100000122 3300005536 Bacteria 61581
71 Ga0068853_100418219 3300005539 Bacteria 1257
72 Ga0070672_100450923 3300005543 Bacteria 1108
73 Ga0070686_101758862 3300005544 Unclassified 527
74 Ga0070695_100261808 3300005545 Bacteria 1263
75 Ga0070696_100212019 3300005546 Bacteria 1450
76 Ga0070693_100000998 3300005547 Bacteria 12613
77 Ga0070665_100020276 3300005548 Bacteria 6675
78 Ga0068855_100086918 3300005563 Bacteria 3614
79 Ga0070664_100612221 3300005564 Bacteria 1010
80 Ga0070664_101809009 3300005564 Bacteria 579
81 Ga0068857_101440390 3300005577 Bacteria 670
82 Ga0068854_100101973 3300005578 Bacteria 2153
83 Ga0070702_100003496 3300005615 Bacteria 7033
84 Ga0068852_100025246 3300005616 Bacteria 4812
85 Ga0068859_100639831 3300005617 Bacteria 1156
86 Ga0068859_101333241 3300005617 Bacteria 791
87 Ga0068864_100329325 3300005618 Bacteria 1436
88 Ga0068864_101589255 3300005618 Bacteria 658
89 Ga0068864_101918458 3300005618 Bacteria 598
90 Ga0068851_10385799 3300005834 Bacteria 821
91 Ga0068870_10000205 3300005840 Bacteria 21167
92 Ga0068870_10251281 3300005840 Bacteria 1096
93 Ga0068863_100000643 3300005841 Bacteria 35383
94 Ga0068863_100000995 3300005841 Bacteria 28447
95 Ga0068863_102285472 3300005841 Bacteria 551
96 Ga0068858_100000032 3300005842 Bacteria 142794
97 Ga0068858_100009187 3300005842 Bacteria 9446
98 Ga0068858_100595521 3300005842 Bacteria 1072
99 Ga0068860_100042537 3300005843 Bacteria 4337
100 Ga0068862_100636343 3300005844 Bacteria 1027
101 Ga0081455_10025613 3300005937 Bacteria 5440
102 Ga0081539_10000370 3300005985 Bacteria 98520
103 Ga0070717_10005733 3300006028 Bacteria 9088
104 Ga0070717_10014856 3300006028 Bacteria 5993
105 Ga0070717_10016421 3300006028 Bacteria 5739
106 Ga0070717_10225706 3300006028 Bacteria 1648
107 Ga0070717_10330535 3300006028 Bacteria 1359
108 Ga0070717_11115181 3300006028 Bacteria 718
109 Ga0075432_10019628 3300006058 Bacteria 2311
110 Ga0070716_100196139 3300006173 Bacteria 1338
111 Ga0070716_100680368 3300006173 Bacteria 784
112 Ga0070712_100004932 3300006175 Bacteria 8255
113 Ga0070712_101762743 3300006175 Bacteria 542
114 Ga0097621_100020038 3300006237 Bacteria 5149
115 Ga0068871_100002715 3300006358 Bacteria 12079
116 Ga0068871_101372371 3300006358 Bacteria 666
117 Ga0068871_101844489 3300006358 Bacteria 574
118 Ga0075428_100003697 3300006844 Bacteria 16769
119 Ga0075428_100390262 3300006844 Unclassified 1492
120 Ga0075428_100752683 3300006844 Bacteria 1037
121 Ga0075430_100008888 3300006846 Bacteria 8478
122 Ga0075430_100281202 3300006846 Bacteria 1377
123 Ga0075430_100597965 3300006846 Bacteria 910
124 Ga0075431_100000653 3300006847 Bacteria 29443
125 Ga0075431_100020264 3300006847 Bacteria 6792
126 Ga0075431_100175399 3300006847 Bacteria 2202
127 Ga0075431_100293852 3300006847 Bacteria 1643
128 Ga0075431_101344970 3300006847 Bacteria 675
129 Ga0075433_11710950 3300006852 Unclassified 541
130 Ga0075434_101809182 3300006871 Bacteria 617
131 Ga0075429_100002232 3300006880 Bacteria 16193
132 Ga0075429_100621704 3300006880 Unclassified 946
133 Ga0075429_100698468 3300006880 Unclassified 889
134 Ga0068865_101647876 3300006881 Bacteria 577
135 Ga0097620_100639818 3300006931 Bacteria 1156
136 Ga0097620_101333536 3300006931 Bacteria 791
137 Ga0075435_100001141 3300007076 Bacteria 16946
138 Ga0099794_10341864 3300007265 Bacteria 778
139 Ga0099795_10460499 3300007788 Bacteria 587
140 Ga0105251_10021893 3300009011 Bacteria 3329
141 Ga0111539_10055874 3300009094 Bacteria 4693
142 Ga0105245_10070716 3300009098 Bacteria 3167
143 Ga0105245_10186002 3300009098 Bacteria 1987
144 Ga0105245_11032419 3300009098 Bacteria 867
145 Ga0105247_10029920 3300009101 Bacteria 3302
146 Ga0105247_10040403 3300009101 Bacteria 2851
147 Ga0105247_11308097 3300009101 Bacteria 582
148 Ga0114129_10015538 3300009147 Bacteria 10824
149 Ga0114129_10015818 3300009147 Bacteria 10727
150 Ga0105241_10001623 3300009174 Bacteria 17142
151 Ga0105248_10513269 3300009177 Bacteria 1351
152 Ga0105237_10142168 3300009545 Bacteria 2394
153 Ga0105238_10104504 3300009551 Bacteria 2813
154 Ga0105249_13491024 3300009553 Unclassified 506
155 Ga0105239_10388684 3300010375 Bacteria 1578
156 Ga0105239_10990987 3300010375 Bacteria 966
157 Ga0105246_10013045 3300011119 Bacteria 5200
158 Ga0105246_11826102 3300011119 Bacteria 581
159 Ga0157371_10013698 3300013102 Bacteria 6151
160 Ga0157371_10099359 3300013102 Bacteria 2064
161 Ga0157370_10061161 3300013104 Bacteria 3574
162 Ga0157369_10031349 3300013105 Bacteria 5854
163 Ga0157374_10002672 3300013296 Bacteria 14999
164 Ga0157374_10193300 3300013296 Unclassified 1990
165 Ga0157378_10721178 3300013297 Bacteria 1018
166 Ga0157372_10180716 3300013307 Bacteria 2442
167 Ga0157372_10487575 3300013307 Bacteria 1437
168 Ga0157372_11851518 3300013307 Bacteria 694
169 Ga0157375_10093050 3300013308 Bacteria 3080
170 Ga0157375_10911794 3300013308 Bacteria 1022
171 Ga0157375_11137848 3300013308 Bacteria 914
172 Ga0157375_11972526 3300013308 Bacteria 694
173 Ga0157375_12371029 3300013308 Bacteria 633
174 Ga0163163_10111651 3300014325 Bacteria 2763
175 Ga0163163_10125727 3300014325 Bacteria 2602
176 Ga0163163_10349073 3300014325 Bacteria 1535
177 Ga0157380_10210075 3300014326 Bacteria 1734
178 Ga0157377_10005207 3300014745 Bacteria 6087
179 Ga0157377_11021217 3300014745 Bacteria 628
180 Ga0157379_10004976 3300014968 Bacteria 11406
181 Ga0157379_10110363 3300014968 Bacteria 2470
182 Ga0157379_10667261 3300014968 Bacteria 974
183 Ga0157376_10107276 3300014969 Bacteria 2451
184 Ga0197907_11035920 3300020069 Bacteria 1990
185 Ga0206356_10644548 3300020070 Bacteria 3061
186 Ga0206349_1447515 3300020075 Bacteria 884
187 Ga0206354_10538699 3300020081 Bacteria 2690
188 Ga0154015_1262237 3300020610 Unclassified 656
189 Ga0213876_10263270 3300021384 Bacteria 916
190 Ga0224712_10019704 3300022467 Bacteria 2280
191 Ga0224712_10056513 3300022467 Bacteria 1548
192 Ga0207656_10042141 3300025321 Bacteria 1941
193 Ga0207692_10046826 3300025898 Bacteria 2169
194 Ga0207692_10220101 3300025898 Bacteria 1125
195 Ga0207710_10279737 3300025900 Bacteria 840
196 Ga0207688_10009057 3300025901 Bacteria 5419
197 Ga0207688_10408781 3300025901 Bacteria 842
198 Ga0207688_10802974 3300025901 Unclassified 596
199 Ga0207680_10185233 3300025903 Bacteria 1410
200 Ga0207647_10024706 3300025904 Bacteria 3959
201 Ga0207647_10566647 3300025904 Unclassified 629
202 Ga0207699_10014385 3300025906 Bacteria 4077
203 Ga0207645_10072945 3300025907 Bacteria 2198
204 Ga0207643_10000027 3300025908 Bacteria 99423
205 Ga0207643_10306623 3300025908 Bacteria 989
206 Ga0207705_10179519 3300025909 Bacteria 1597
207 Ga0207684_10000775 3300025910 Bacteria 37093
208 Ga0207684_10227666 3300025910 Bacteria 1609
209 Ga0207654_10006227 3300025911 Bacteria 5996
210 Ga0207671_10088564 3300025914 Bacteria 2329
211 Ga0207693_10056795 3300025915 Bacteria 3068
212 Ga0207693_11112753 3300025915 Bacteria 599
213 Ga0207663_10017026 3300025916 Bacteria 4042
214 Ga0207663_11404819 3300025916 Bacteria 562
215 Ga0207660_10404812 3300025917 Bacteria 1099
216 Ga0207657_10022302 3300025919 Bacteria 5930
217 Ga0207649_10027820 3300025920 Bacteria 3323
218 Ga0207652_10053936 3300025921 Bacteria 3454
219 Ga0207652_11528858 3300025921 Bacteria 571
220 Ga0207694_10025160 3300025924 Bacteria 4523
221 Ga0207650_10006536 3300025925 Bacteria 7949
222 Ga0207659_10017279 3300025926 Bacteria 4710
223 Ga0207659_11162102 3300025926 Bacteria 664
224 Ga0207687_10026200 3300025927 Bacteria 3903
225 Ga0207687_10224314 3300025927 Bacteria 1481
226 Ga0207700_10007170 3300025928 Bacteria 6796
227 Ga0207700_10812652 3300025928 Bacteria 836
228 Ga0207664_10006992 3300025929 Bacteria 7809
229 Ga0207664_10542987 3300025929 Bacteria 1043
230 Ga0207664_11490136 3300025929 Bacteria 598
231 Ga0207664_11681284 3300025929 Bacteria 557
232 Ga0207644_11497074 3300025931 Unclassified 566
233 Ga0207690_10018617 3300025932 Bacteria 4260
234 Ga0207706_10097600 3300025933 Bacteria 2584
235 Ga0207665_10074431 3300025939 Bacteria 2324
236 Ga0207665_10157765 3300025939 Bacteria 1630
237 Ga0207665_10281333 3300025939 Bacteria 1238
238 Ga0207691_10049666 3300025940 Bacteria 3844
239 Ga0207711_10697099 3300025941 Bacteria 947
240 Ga0207689_10002095 3300025942 Bacteria 18817
241 Ga0207661_10002523 3300025944 Bacteria 12595
242 Ga0207661_11185172 3300025944 Unclassified 703
243 Ga0207679_10219743 3300025945 Bacteria 1598
244 Ga0207667_10856925 3300025949 Bacteria 902
245 Ga0207651_10208880 3300025960 Bacteria 1570
246 Ga0207668_12000370 3300025972 Unclassified 522
247 Ga0207640_10045821 3300025981 Bacteria 2810
248 Ga0207658_10299010 3300025986 Bacteria 1386
249 Ga0207677_10281572 3300026023 Bacteria 1365
250 Ga0207677_10559585 3300026023 Bacteria 998
251 Ga0207677_11783022 3300026023 Bacteria 571
252 Ga0207703_10000015 3300026035 Bacteria 287079
253 Ga0207703_10578880 3300026035 Bacteria 1061
254 Ga0207703_11476042 3300026035 Unclassified 654
255 Ga0207703_11895317 3300026035 Bacteria 572
256 Ga0207639_11620113 3300026041 Bacteria 607
257 Ga0207678_10004646 3300026067 Bacteria 12331
258 Ga0207708_10117074 3300026075 Bacteria 2073
259 Ga0207702_10016981 3300026078 Bacteria 6022
260 Ga0207641_10010806 3300026088 Bacteria 7483
261 Ga0207676_10002272 3300026095 Bacteria 13787
262 Ga0207674_10160985 3300026116 Bacteria 2199
263 Ga0207674_10257447 3300026116 Bacteria 1692
264 Ga0207683_10005627 3300026121 Bacteria 10746
265 Ga0207698_10007399 3300026142 Bacteria 6878
266 Ga0207428_10031094 3300027907 Bacteria 4411
267 Ga0268266_10043971 3300028379 Bacteria 3818
268 Ga0268266_10650652 3300028379 Bacteria 1014
269 Ga0268265_10457673 3300028380 Bacteria 1193
270 Ga0268264_10045938 3300028381 Bacteria 3627
271 Ga0307515_10051539 3300028794 Bacteria 6133
272 Ga0307512_10020980 3300030522 Bacteria 5899
273 Ga0265340_10002273 3300031247 Bacteria 10970
274 Ga0307513_10056799 3300031456 Bacteria 4176
275 Ga0307513_10074720 3300031456 Bacteria 3523
276 Ga0307408_100432017 3300031548 Bacteria 1138
277 Ga0307508_10010138 3300031616 Bacteria 8626
278 Ga0307508_10010665 3300031616 Bacteria 8403
279 Ga0307508_10251586 3300031616 Bacteria 1363
280 Ga0307514_10392926 3300031649 Bacteria 713
281 Ga0307516_10331047 3300031730 Bacteria 1192
282 Ga0307405_10869583 3300031731 Bacteria 760
283 Ga0307413_10273689 3300031824 Bacteria 1266
284 Ga0307406_10276106 3300031901 Bacteria 1279
285 Ga0307412_10604525 3300031911 Bacteria 929
286 Ga0307409_101703807 3300031995 Bacteria 659
287 Ga0307416_100012628 3300032002 Bacteria 5701
288 Ga0307416_100482578 3300032002 Bacteria 1300
289 Ga0307411_10583250 3300032005 Bacteria 959
290 Ga0307411_11722848 3300032005 Unclassified 580
291 Ga0307415_100105060 3300032126 Bacteria 2082
292 Ga0307415_100871639 3300032126 Bacteria 828
293 Ga0307415_101323820 3300032126 Bacteria 683
294 Ga0307510_10239315 3300033180 Bacteria 1311
295 Ga0373926_0335927 3300035083 Bacteria 592
296 Ga0373923_0264639 3300035111 Bacteria 807
297 Ga0373953_0006250 3300035117 Bacteria 3914
298 Ga0373953_0030985 3300035117 Bacteria 2078
299 Ga0373954_0217489 3300035118 Bacteria 940
300 Ga0373956_0006876 3300035119 Bacteria 4569
301 Ga0373956_0370154 3300035119 Bacteria 683
302 Ga0373943_0602640 3300035170 Bacteria 647
303 Ga0373955_0036345 3300035172 Bacteria 2613
304 Ga0373924_0069695 3300035410 Bacteria 1482
305 Ga0373924_0555785 3300035410 Bacteria 517
306 Ga0373935_0114423 3300035692 Bacteria 1794
307 Ga0373927_0530585 3300035695 Bacteria 778
308 Ga0373933_0306546 3300035724 Bacteria 1028
309 Ga0373947_0325969 3300035725 Bacteria 1028
310 Ga0373937_0113558 3300036401 Bacteria 2520
311 Ga0373937_0256588 3300036401 Bacteria 1648
312 Ga0373937_0811771 3300036401 Bacteria 883
313 Ga0373925_0000010 3300037068 Bacteria 229059
314 Ga0373925_0007758 3300037068 Bacteria 7811
315 Ga0373925_0026523 3300037068 Bacteria 4239
316 Ga0373925_0111393 3300037068 Bacteria 2115
317 Ga0373925_1028120 3300037068 Bacteria 678
318 Ga0436364_1245836 3300037853 Bacteria 2030
319 Ga0436365_0654088 3300039437 Bacteria 5098
320 Ga0436363_1057218 3300039450 Unclassified 591
321 Ga0451791_1801034 3300041451 Bacteria 579
322 Ga0451807_0585128 3300041486 Bacteria 846
323 Ga0451849_1066852 3300041505 Bacteria 699
324 Ga0451853_0391935 3300041512 Bacteria 12182
325 Ga0466957_0433335 3300044842 Bacteria 904
326 Ga0466967_2036202 3300045976 Bacteria 571
327 Ga0495592_0016185 3300046454 Bacteria 5658
328 Ga0495638_0299937 3300046460 Bacteria 866
329 Ga0495651_0438937 3300046462 Bacteria 845
330 Ga0495653_0215655 3300046463 Bacteria 1293
331 Ga0495580_0025147 3300046472 Bacteria 4351
332 Ga0495662_0321041 3300046476 Bacteria 762
333 Ga0495664_0044082 3300046477 Bacteria 2643
334 Ga0495594_0578397 3300046499 Bacteria 637
335 Ga0495618_0253436 3300046514 Bacteria 1103
336 Ga0495628_0331063 3300046516 Bacteria 1122
337 Ga0495652_0354357 3300046529 Bacteria 1050
338 Ga0495640_0052929 3300046533 Bacteria 2785
339 Ga0495586_0448195 3300046535 Bacteria 744
340 Ga0495587_0166850 3300046536 Bacteria 1251
341 Ga0495645_0158012 3300046543 Bacteria 1569
342 Ga0495667_0055668 3300046559 Bacteria 2601
343 Ga0495667_0551762 3300046559 Bacteria 720
344 Ga0495634_0802696 3300046642 Bacteria 536
345 Ga0495635_0003596 3300046663 Bacteria 10733
346 Ga0495599_0103593 3300046678 Bacteria 1773
347 Ga0495646_0356664 3300046680 Bacteria 765
348 Ga0495613_0430673 3300046689 Bacteria 896
349 Ga0495624_0240867 3300046690 Bacteria 1095
350 Ga0495600_0021767 3300046809 Bacteria 4110
351 Ga0495604_0115695 3300047317 Bacteria 1948
352 Ga0495674_0088831 3300047319 Bacteria 2642
353 Ga0495674_0140401 3300047319 Bacteria 2031
354 Ga0495680_0236915 3300047322 Bacteria 1297
355 Ga0495593_0521996 3300047673 Bacteria 595
356 Ga0496100_0774176 3300048903 Unclassified 751
357 Ga0496101_0924007 3300048904 Bacteria 687
358 Ga0496101_1027435 3300048904 Bacteria 648
359 Ga0496102_0044919 3300048905 Bacteria 4010
360 Ga0496103_0243141 3300048906 Bacteria 1158
361 Ga0496104_0001624 3300048907 Bacteria 19409
362 Ga0496104_0018219 3300048907 Bacteria 6405
363 Ga0496105_0013602 3300048908 Bacteria 6462
364 Ga0496105_0073300 3300048908 Bacteria 2829
365 Ga0496106_0004722 3300048909 Bacteria 10088
366 Ga0496107_0363088 3300048910 Bacteria 1077
367 Ga0496107_0732464 3300048910 Bacteria 726
368 Ga0496108_0000117 3300048911 Bacteria 78204
369 Ga0496108_0027215 3300048911 Bacteria 4719
370 Ga0496109_0031996 3300048912 Bacteria 4725
371 Ga0496110_0035738 3300048913 Bacteria 4312
372 Ga0496110_0332689 3300048913 Bacteria 1384
373 Ga0496111_0220410 3300048914 Bacteria 1409
374 Ga0496112_0060379 3300048915 Bacteria 3736
375 Ga0496112_0238255 3300048915 Bacteria 1773
376 Ga0496112_0965806 3300048915 Bacteria 773
377 Ga0496113_0020783 3300048916 Bacteria 4622
378 Ga0496114_0581144 3300048917 Bacteria 989
379 Ga0496116_0000190 3300048919 Bacteria 122544
380 Ga0496117_0004705 3300048920 Bacteria 14819
381 Ga0496118_0000734 3300048921 Bacteria 52990
382 Ga0496119_0003301 3300048922 Bacteria 16857
383 Ga0496119_0011019 3300048922 Bacteria 7538
384 Ga0496121_0006244 3300048924 Bacteria 14925
385 Ga0496126_1366415 3300048929 Bacteria 513
386 nmdc:mga05p37_196149_c1 3300050507 Bacteria 2448
387 nmdc:mga05p37_206194_c1 3300050507 Bacteria 2378
388 nmdc:mga05p37_26915_c1 3300050507 Bacteria 6998
389 nmdc:mga05p37_4687_c1 3300050507 Bacteria 15974
390 nmdc:mga09592_123223_c1 3300050508 Bacteria 2227
391 nmdc:mga09592_3_c1 3300050508 Bacteria 144376
392 nmdc:mga0qj67_144046_c1 3300050509 Bacteria 1932
393 nmdc:mga0qj67_267883_c1 3300050509 Bacteria 1385
394 nmdc:mga0qj67_286_c1 3300050509 Bacteria 35189
395 nmdc:mga0qj67_32371_c1 3300050509 Bacteria 4077
396 nmdc:mga0qj67_367050_c1 3300050509 Bacteria 1163
397 nmdc:mga06r32_460_c1 3300050510 Bacteria 34832
398 nmdc:mga06r32_552744_c1 3300050510 Bacteria 1125
399 nmdc:mga06r32_656368_c1 3300050510 Bacteria 1017
400 nmdc:mga08y16_15196_c1 3300050511 Bacteria 8097
401 nmdc:mga0n895_102070_c1 3300050512 Bacteria 2879
402 nmdc:mga0rr50_10260_c1 3300050513 Bacteria 5936
403 nmdc:mga0a205_31640_c1 3300050515 Bacteria 5071
404 Ga0495601_0110215 3300053077 Bacteria 1782
405 Ga0495612_0081400 3300053078 Bacteria 1361
406 Ga0495595_0619234 3300053084 Bacteria 554
407 Ga0500644_0005855 3300053088 Bacteria 3121
408 Ga0500651_0040255 3300053093 Bacteria 2944
409 Ga0500569_048572 3300053109 Bacteria 1271
410 Ga0500588_0293426 3300053146 Bacteria 615
411 Ga0500630_217750 3300053159 Bacteria 720
412 Ga0500633_0088414 3300053160 Bacteria 1129
413 2880502672 2880495981 Bacteria 7340502
414 2644517206 2643221692 Bacteria 7282860
415 2772646950 2772190715 Bacteria 6959372
416 2858871166 2858868258 Bacteria 7683772
417 2867511308 2867507094 Bacteria 6506033
418 2902585833 2902582711 Bacteria 6187705
419 2929231092 2929226422 Bacteria 7248583
420 8002790574 8002784119 Bacteria 9788632
421 8003875796 8003870546 Bacteria 7396674
422 8054736621 8054734606 Bacteria 6947278
423 JGI24752J21851_1015282
424 JGI24740J21852_10019322
425 JGI24739J22299_10013058
426 JGI24737J22298_10035580
427 JGI24735J21928_10021305
428 JGI24033J26618_1047429
429 JGI24751J29686_10039112
430 JGI25406J46586_10005257
431 Ga0070658_10075952
432 Ga0070676_10035026
433 Ga0070676_10472678
434 Ga0070683_100854382
435 Ga0070690_100064092
436 Ga0070670_100291382
437 Ga0068869_100011554
438 Ga0070666_10143128
439 Ga0070680_100016675
440 Ga0070682_100035063
441 Ga0070682_100563857
442 Ga0070682_100844047
443 Ga0068868_100018832
444 Ga0070660_100025891
445 Ga0070689_100222513
446 Ga0070691_10003850
447 Ga0070661_100021412
448 Ga0070692_10089308
449 Ga0070668_100411289
450 Ga0070668_100659400
451 Ga0070668_101333899
452 Ga0070675_100011986
453 Ga0070675_101405734
454 Ga0070671_100020030
455 Ga0070674_100637229
456 Ga0070673_100735473
457 Ga0070688_100033735
458 Ga0070688_100909179
459 Ga0070659_100071821
460 Ga0070659_100729866
461 Ga0070667_100038287
462 Ga0070667_100283149
463 Ga0070709_10002777
464 Ga0070714_100047495
465 Ga0070714_100503354
466 Ga0070714_102124198
467 Ga0070713_100009971
468 Ga0070713_100112125
469 Ga0070713_102356835
470 Ga0070710_10039837
471 Ga0070710_10321710
472 Ga0070701_10057017
473 Ga0070711_100173615
474 Ga0070711_101506618
475 Ga0070700_100102914
476 Ga0070694_100443896
477 Ga0070663_100007414
478 Ga0070663_100774182
479 Ga0070678_100915044
480 Ga0070681_10032736
481 Ga0070681_10204941
482 Ga0068867_101196018
483 Ga0070706_100000524
484 Ga0070706_100117065
485 Ga0070707_100481341
486 Ga0070698_100008362
487 Ga0070698_100067913
488 Ga0070698_100705397
489 Ga0070679_100020226
490 Ga0070679_100656186
491 Ga0070684_101468093
492 Ga0070697_100000122
493 Ga0068853_100418219
494 Ga0070672_100450923
495 Ga0070686_101758862
496 Ga0070695_100261808
497 Ga0070696_100212019
498 Ga0070693_100000998
499 Ga0070665_100020276
500 Ga0068855_100086918
501 Ga0070664_100612221
502 Ga0070664_101809009
503 Ga0068857_101440390
504 Ga0068854_100101973
505 Ga0070702_100003496
506 Ga0068852_100025246
507 Ga0068859_100639831
508 Ga0068859_101333241
509 Ga0068864_100329325
510 Ga0068864_101589255
511 Ga0068864_101918458
512 Ga0068851_10385799
513 Ga0068870_10000205
514 Ga0068870_10251281
515 Ga0068863_100000643
516 Ga0068863_100000995
517 Ga0068863_102285472
518 Ga0068858_100000032
519 Ga0068858_100009187
520 Ga0068858_100595521
521 Ga0068860_100042537
522 Ga0068862_100636343
523 Ga0081455_10025613
524 Ga0081539_10000370
525 Ga0070717_10005733
526 Ga0070717_10014856
527 Ga0070717_10016421
528 Ga0070717_10225706
529 Ga0070717_10330535
530 Ga0070717_11115181
531 Ga0075432_10019628
532 Ga0070716_100196139
533 Ga0070716_100680368
534 Ga0070712_100004932
535 Ga0070712_101762743
536 Ga0097621_100020038
537 Ga0068871_100002715
538 Ga0068871_101372371
539 Ga0068871_101844489
540 Ga0075428_100003697
541 Ga0075428_100390262
542 Ga0075428_100752683
543 Ga0075430_100008888
544 Ga0075430_100281202
545 Ga0075430_100597965
546 Ga0075431_100000653
547 Ga0075431_100020264
548 Ga0075431_100175399
549 Ga0075431_100293852
550 Ga0075431_101344970
551 Ga0075433_11710950
552 Ga0075434_101809182
553 Ga0075429_100002232
554 Ga0075429_100621704
555 Ga0075429_100698468
556 Ga0068865_101647876
557 Ga0097620_100639818
558 Ga0097620_101333536
559 Ga0075435_100001141
560 Ga0099794_10341864
561 Ga0099795_10460499
562 Ga0105251_10021893
563 Ga0111539_10055874
564 Ga0105245_10070716
565 Ga0105245_10186002
566 Ga0105245_11032419
567 Ga0105247_10029920
568 Ga0105247_10040403
569 Ga0105247_11308097
570 Ga0114129_10015538
571 Ga0114129_10015818
572 Ga0105241_10001623
573 Ga0105248_10513269
574 Ga0105237_10142168
575 Ga0105238_10104504
576 Ga0105249_13491024
577 Ga0105239_10388684
578 Ga0105239_10990987
579 Ga0105246_10013045
580 Ga0105246_11826102
581 Ga0157371_10013698
582 Ga0157371_10099359
583 Ga0157370_10061161
584 Ga0157369_10031349
585 Ga0157374_10002672
586 Ga0157374_10193300
587 Ga0157378_10721178
588 Ga0157372_10180716
589 Ga0157372_10487575
590 Ga0157372_11851518
591 Ga0157375_10093050
592 Ga0157375_10911794
593 Ga0157375_11137848
594 Ga0157375_11972526
595 Ga0157375_12371029
596 Ga0163163_10111651
597 Ga0163163_10125727
598 Ga0163163_10349073
599 Ga0157380_10210075
600 Ga0157377_10005207
601 Ga0157377_11021217
602 Ga0157379_10004976
603 Ga0157379_10110363
604 Ga0157379_10667261
605 Ga0157376_10107276
606 Ga0197907_11035920
607 Ga0206356_10644548
608 Ga0206349_1447515
609 Ga0206354_10538699
610 Ga0154015_1262237
611 Ga0213876_10263270
612 Ga0224712_10019704
613 Ga0224712_10056513
614 Ga0207656_10042141
615 Ga0207692_10046826
616 Ga0207692_10220101
617 Ga0207710_10279737
618 Ga0207688_10009057
619 Ga0207688_10408781
620 Ga0207688_10802974
621 Ga0207680_10185233
622 Ga0207647_10024706
623 Ga0207647_10566647
624 Ga0207699_10014385
625 Ga0207645_10072945
626 Ga0207643_10000027
627 Ga0207643_10306623
628 Ga0207705_10179519
629 Ga0207684_10000775
630 Ga0207684_10227666
631 Ga0207654_10006227
632 Ga0207671_10088564
633 Ga0207693_10056795
634 Ga0207693_11112753
635 Ga0207663_10017026
636 Ga0207663_11404819
637 Ga0207660_10404812
638 Ga0207657_10022302
639 Ga0207649_10027820
640 Ga0207652_10053936
641 Ga0207652_11528858
642 Ga0207694_10025160
643 Ga0207650_10006536
644 Ga0207659_10017279
645 Ga0207659_11162102
646 Ga0207687_10026200
647 Ga0207687_10224314
648 Ga0207700_10007170
649 Ga0207700_10812652
650 Ga0207664_10006992
651 Ga0207664_10542987
652 Ga0207664_11490136
653 Ga0207664_11681284
654 Ga0207644_11497074
655 Ga0207690_10018617
656 Ga0207706_10097600
657 Ga0207665_10074431
658 Ga0207665_10157765
659 Ga0207665_10281333
660 Ga0207691_10049666
661 Ga0207711_10697099
662 Ga0207689_10002095
663 Ga0207661_10002523
664 Ga0207661_11185172
665 Ga0207679_10219743
666 Ga0207667_10856925
667 Ga0207651_10208880
668 Ga0207668_12000370
669 Ga0207640_10045821
670 Ga0207658_10299010
671 Ga0207677_10281572
672 Ga0207677_10559585
673 Ga0207677_11783022
674 Ga0207703_10000015
675 Ga0207703_10578880
676 Ga0207703_11476042
677 Ga0207703_11895317
678 Ga0207639_11620113
679 Ga0207678_10004646
680 Ga0207708_10117074
681 Ga0207702_10016981
682 Ga0207641_10010806
683 Ga0207676_10002272
684 Ga0207674_10160985
685 Ga0207674_10257447
686 Ga0207683_10005627
687 Ga0207698_10007399
688 Ga0207428_10031094
689 Ga0268266_10043971
690 Ga0268266_10650652
691 Ga0268265_10457673
692 Ga0268264_10045938
693 Ga0307515_10051539
694 Ga0307512_10020980
695 Ga0265340_10002273
696 Ga0307513_10056799
697 Ga0307513_10074720
698 Ga0307408_100432017
699 Ga0307508_10010138
700 Ga0307508_10010665
701 Ga0307508_10251586
702 Ga0307514_10392926
703 Ga0307516_10331047
704 Ga0307405_10869583
705 Ga0307413_10273689
706 Ga0307406_10276106
707 Ga0307412_10604525
708 Ga0307409_101703807
709 Ga0307416_100012628
710 Ga0307416_100482578
711 Ga0307411_10583250
712 Ga0307411_11722848
713 Ga0307415_100105060
714 Ga0307415_100871639
715 Ga0307415_101323820
716 Ga0307510_10239315
717 Ga0373926_0335927
718 Ga0373923_0264639
719 Ga0373953_0006250
720 Ga0373953_0030985
721 Ga0373954_0217489
722 Ga0373956_0006876
723 Ga0373956_0370154
724 Ga0373943_0602640
725 Ga0373955_0036345
726 Ga0373924_0069695
727 Ga0373924_0555785
728 Ga0373935_0114423
729 Ga0373927_0530585
730 Ga0373933_0306546
731 Ga0373947_0325969
732 Ga0373937_0113558
733 Ga0373937_0256588
734 Ga0373937_0811771
735 Ga0373925_0000010
736 Ga0373925_0007758
737 Ga0373925_0026523
738 Ga0373925_0111393
739 Ga0373925_1028120
740 Ga0436364_1245836
741 Ga0436365_0654088
742 Ga0436363_1057218
743 Ga0451791_1801034
744 Ga0451807_0585128
745 Ga0451849_1066852
746 Ga0451853_0391935
747 Ga0466957_0433335
748 Ga0466967_2036202
749 Ga0495592_0016185
750 Ga0495638_0299937
751 Ga0495651_0438937
752 Ga0495653_0215655
753 Ga0495580_0025147
754 Ga0495662_0321041
755 Ga0495664_0044082
756 Ga0495594_0578397
757 Ga0495618_0253436
758 Ga0495628_0331063
759 Ga0495652_0354357
760 Ga0495640_0052929
761 Ga0495586_0448195
762 Ga0495587_0166850
763 Ga0495645_0158012
764 Ga0495667_0055668
765 Ga0495667_0551762
766 Ga0495634_0802696
767 Ga0495635_0003596
768 Ga0495599_0103593
769 Ga0495646_0356664
770 Ga0495613_0430673
771 Ga0495624_0240867
772 Ga0495600_0021767
773 Ga0495604_0115695
774 Ga0495674_0088831
775 Ga0495674_0140401
776 Ga0495680_0236915
777 Ga0495593_0521996
778 Ga0496100_0774176
779 Ga0496101_0924007
780 Ga0496101_1027435
781 Ga0496102_0044919
782 Ga0496103_0243141
783 Ga0496104_0001624
784 Ga0496104_0018219
785 Ga0496105_0013602
786 Ga0496105_0073300
787 Ga0496106_0004722
788 Ga0496107_0363088
789 Ga0496107_0732464
790 Ga0496108_0000117
791 Ga0496108_0027215
792 Ga0496109_0031996
793 Ga0496110_0035738
794 Ga0496110_0332689
795 Ga0496111_0220410
796 Ga0496112_0060379
797 Ga0496112_0238255
798 Ga0496112_0965806
799 Ga0496113_0020783
800 Ga0496114_0581144
801 Ga0496116_0000190
802 Ga0496117_0004705
803 Ga0496118_0000734
804 Ga0496119_0003301
805 Ga0496119_0011019
806 Ga0496121_0006244
807 Ga0496126_1366415
808 nmdc:mga05p37_196149_c1
809 nmdc:mga05p37_206194_c1
810 nmdc:mga05p37_26915_c1
811 nmdc:mga05p37_4687_c1
812 nmdc:mga09592_123223_c1
813 nmdc:mga09592_3_c1
814 nmdc:mga0qj67_144046_c1
815 nmdc:mga0qj67_267883_c1
816 nmdc:mga0qj67_286_c1
817 nmdc:mga0qj67_32371_c1
818 nmdc:mga0qj67_367050_c1
819 nmdc:mga06r32_460_c1
820 nmdc:mga06r32_552744_c1
821 nmdc:mga06r32_656368_c1
822 nmdc:mga08y16_15196_c1
823 nmdc:mga0n895_102070_c1
824 nmdc:mga0rr50_10260_c1
825 nmdc:mga0a205_31640_c1
826 Ga0495601_0110215
827 Ga0495612_0081400
828 Ga0495595_0619234
829 Ga0500644_0005855
830 Ga0500651_0040255
831 Ga0500569_048572
832 Ga0500588_0293426
833 Ga0500630_217750
834 Ga0500633_0088414
835 2880502672
836 2644517206
837 2772646950
838 2858871166
839 2867511308
840 2902585833
841 2929231092
842 8002790574
843 8003875796
844 8054736621

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02604

PhdYeFM_antitox

Antitoxin Phd_YefM, type II toxin-antitoxin system

3

55

0.92

Map