F440397

General Info

Members Datasets Scaffolds Average Seq Length
422 292 364 321

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0257648|Ga0501040_0257648_131_1204
Length 357
Sequence MDDDWRLGDEKDDQLQILAEQSSDQGGNGDPMTSFIETVMNPQFVATVLAAVCVFATVLTIALPMLQRDQMNRRMKEMAIERNQMRSARLAEMASKDRQSSKLRPTPKGFMQRIVDELRLRERFDNEEIRENLKRAGLRGQANIVTFLFFRVAAPIIMFFLALFYFFVLYDTGYPPIVNVGLALVVGFLGFYLPNVFISNRVQKRQMSIKQAFPDALDMLLICVQSGMSVEAGFAKVGKEIASQSLELAEEMTLTTAELSYLQDRRQAYENLAKRTGLPGVKGVTTALVQAERYGTPVGQALRTMAKENREIRQSEAERKAAALPPKLTVPMIVFFLPVLFIVILGPAGISYMQMPK

Samples

Sample ID Description Type Environment
1 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
2 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
3 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
4 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
5 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
6 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
7 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
8 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
9 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
10 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
11 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
12 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
13 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
14 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
15 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
16 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
17 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
18 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
19 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
20 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
21 2643221582 Rhizobium sp. Root651 Isolate Unclassified
22 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
23 2643221693 Rhizobium sp. Root491 Isolate Unclassified
24 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
25 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
26 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
27 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
28 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
29 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
30 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
31 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
32 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
33 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
34 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
35 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
36 2851153111 Caulobacter radicis 736 Isolate Unclassified
37 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
38 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
39 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
40 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
41 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
42 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
43 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
44 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
45 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
46 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
47 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
48 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
49 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
50 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
51 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
52 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
53 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
54 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
55 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
56 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
57 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
58 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
59 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
62 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
63 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
64 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
65 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
66 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
67 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
68 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
69 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
132 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
168 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
169 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
257 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
258 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
259 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
260 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
261 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
262 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
263 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
264 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
265 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
266 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
267 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
268 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
269 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
270 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
271 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
272 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
273 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
274 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
275 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
276 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
277 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
278 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
279 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
280 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
281 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
287 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
288 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
289 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
290 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
291 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
292 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.02
Metatranscriptomes 0.24
Isolates 13.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.69
Nodule 4.98
Rhizoplane 4.74
Rhizosphere 63.98
Stem 0
Stem Tuber 0
Unclassified 11.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000671 3300001979 Bacteria 14823
2 JGI25155J39150_1000110 3300002704 Bacteria 43893
3 JGI25162J39368_1000517 3300002737 Bacteria 28879
4 JGI25159J45721_1000516 3300002987 Bacteria 17666
5 JGI25165J46597_1000720 3300003214 Bacteria 25923
6 JGI25153J46596_10000309 3300003215 Bacteria 36023
7 JGI25153J46596_10013837 3300003215 Bacteria 3388
8 rootL2_10091076 3300003322 Bacteria 1230
9 Ga0055530_10016220 3300003791 Bacteria 2390
10 Ga0055540_1002210 3300003792 Bacteria 10562
11 Ga0055531_10012011 3300003794 Bacteria 4113
12 Ga0058692_1007531 3300003856 Bacteria 2880
13 Ga0070683_100009757 3300005329 Bacteria 8223
14 Ga0068869_100383701 3300005334 Bacteria 1152
15 Ga0070680_100011407 3300005336 Bacteria 6872
16 Ga0070682_100021945 3300005337 Bacteria 3774
17 Ga0070660_100100737 3300005339 Bacteria 2288
18 Ga0070661_100003626 3300005344 Bacteria 10626
19 Ga0070661_100007931 3300005344 Bacteria 7331
20 Ga0070668_100008828 3300005347 Bacteria 7486
21 Ga0070668_100132331 3300005347 Bacteria 2003
22 Ga0070669_100028220 3300005353 Bacteria 4041
23 Ga0070674_100003408 3300005356 Bacteria 8915
24 Ga0070674_100010242 3300005356 Bacteria 5658
25 Ga0070659_100019162 3300005366 Bacteria 5178
26 Ga0070694_100249934 3300005444 Bacteria 1341
27 Ga0070663_100026030 3300005455 Bacteria 3957
28 Ga0070663_100037287 3300005455 Bacteria 3383
29 Ga0070663_100148266 3300005455 Bacteria 1797
30 Ga0070681_10041089 3300005458 Bacteria 4633
31 Ga0068867_100194528 3300005459 Bacteria 1620
32 Ga0068867_100199218 3300005459 Bacteria 1602
33 Ga0068853_100001411 3300005539 Bacteria 17343
34 Ga0068853_100016745 3300005539 Bacteria 6038
35 Ga0070695_100020365 3300005545 Bacteria 4050
36 Ga0070696_100006841 3300005546 Bacteria 7612
37 Ga0070696_100027287 3300005546 Bacteria 3889
38 Ga0070693_100011509 3300005547 Bacteria 4457
39 Ga0070665_100008033 3300005548 Bacteria 10686
40 Ga0068855_100234646 3300005563 Bacteria 2052
41 Ga0068855_100504068 3300005563 Bacteria 1315
42 Ga0068857_100363857 3300005577 Bacteria 1341
43 Ga0068854_100002611 3300005578 Bacteria 11167
44 Ga0068856_100121723 3300005614 Bacteria 2611
45 Ga0068852_100007210 3300005616 Bacteria 8107
46 Ga0068852_100225104 3300005616 Bacteria 1785
47 Ga0068852_100393495 3300005616 Bacteria 1362
48 Ga0068859_100126674 3300005617 Bacteria 2623
49 Ga0068861_100035694 3300005719 Bacteria 3685
50 Ga0068851_10001278 3300005834 Bacteria 10974
51 Ga0068863_100156577 3300005841 Bacteria 2181
52 Ga0068858_100076921 3300005842 Bacteria 3100
53 Ga0068860_100022688 3300005843 Bacteria 6067
54 Ga0068860_100156849 3300005843 Bacteria 2194
55 Ga0068862_100001303 3300005844 Bacteria 23220
56 Ga0068862_100013195 3300005844 Bacteria 6834
57 Ga0068862_100020876 3300005844 Bacteria 5471
58 Ga0068862_100100547 3300005844 Bacteria 2529
59 Ga0068862_100235394 3300005844 Bacteria 1663
60 Ga0068862_100513962 3300005844 Bacteria 1139
61 Ga0081538_10001926 3300005981 Bacteria 20797
62 Ga0081540_1000606 3300005983 Bacteria 34167
63 Ga0081539_10044827 3300005985 Bacteria 2550
64 Ga0075368_10027045 3300006042 Bacteria 2210
65 Ga0075363_100042369 3300006048 Bacteria 2405
66 Ga0075364_10094058 3300006051 Bacteria 1991
67 Ga0075362_10059734 3300006177 Bacteria 1722
68 Ga0075362_10084345 3300006177 Bacteria 1468
69 Ga0075367_10067068 3300006178 Bacteria 2151
70 Ga0075367_10141778 3300006178 Bacteria 1489
71 Ga0075369_10074887 3300006186 Bacteria 1494
72 Ga0075366_10003803 3300006195 Bacteria 8029
73 Ga0075433_10121345 3300006852 Bacteria 2321
74 Ga0075433_10254064 3300006852 Bacteria 1559
75 Ga0075434_100146924 3300006871 Bacteria 2378
76 Ga0068865_100052901 3300006881 Bacteria 2816
77 Ga0097620_100126672 3300006931 Bacteria 2623
78 Ga0099826_10000075 3300006948 Bacteria 52009
79 Ga0099826_10032750 3300006948 Bacteria 3741
80 Ga0105240_10002991 3300009093 Bacteria 26588
81 Ga0105240_10254511 3300009093 Bacteria 2029
82 Ga0111539_10000283 3300009094 Bacteria 61000
83 Ga0111539_10400975 3300009094 Bacteria 1597
84 Ga0105243_10011465 3300009148 Bacteria 6706
85 Ga0105243_10022332 3300009148 Bacteria 4808
86 Ga0105241_10032004 3300009174 Bacteria 3939
87 Ga0105242_10210108 3300009176 Bacteria 1734
88 Ga0105237_10021152 3300009545 Bacteria 6693
89 Ga0105237_10033625 3300009545 Bacteria 5195
90 Ga0105237_10054437 3300009545 Bacteria 4009
91 Ga0105238_10012412 3300009551 Bacteria 8592
92 Ga0105238_10018218 3300009551 Bacteria 7142
93 Ga0105238_10198884 3300009551 Bacteria 1979
94 Ga0105249_10383272 3300009553 Bacteria 1432
95 Ga0105239_10011799 3300010375 Bacteria 9752
96 Ga0105246_10022386 3300011119 Bacteria 4076
97 Ga0157373_10001761 3300013100 Bacteria 16478
98 Ga0157371_10000004 3300013102 Bacteria 512593
99 Ga0157371_10006842 3300013102 Bacteria 9315
100 Ga0157370_10003055 3300013104 Bacteria 19850
101 Ga0157370_10013535 3300013104 Bacteria 8398
102 Ga0157369_10004610 3300013105 Bacteria 16200
103 Ga0157369_10078741 3300013105 Bacteria 3530
104 Ga0157378_10114499 3300013297 Bacteria 2477
105 Ga0157378_10290766 3300013297 Bacteria 1578
106 Ga0157375_10038877 3300013308 Bacteria 4573
107 Ga0157380_10011359 3300014326 Bacteria 6435
108 Ga0157379_10083649 3300014968 Bacteria 2860
109 Ga0157376_10094017 3300014969 Bacteria 2604
110 Ga0163161_10107104 3300017792 Bacteria 2086
111 Ga0213876_10000267 3300021384 Bacteria 48430
112 Ga0228711_1011824 3300022739 Bacteria 10924
113 Ga0209437_100205 3300025233 Bacteria 115669
114 Ga0209233_1000187 3300025261 Bacteria 133091
115 Ga0209758_1000005 3300025297 Bacteria 1368918
116 Ga0209050_1001984 3300025298 Bacteria 19184
117 Ga0209257_1000941 3300025304 Bacteria 40201
118 Ga0207656_10000789 3300025321 Bacteria 10360
119 Ga0207654_10015070 3300025911 Bacteria 4004
120 Ga0207695_10004934 3300025913 Bacteria 17978
121 Ga0207671_10020736 3300025914 Bacteria 4998
122 Ga0207671_10022692 3300025914 Bacteria 4741
123 Ga0207649_10001603 3300025920 Bacteria 13151
124 Ga0207649_10024382 3300025920 Bacteria 3516
125 Ga0207681_10019264 3300025923 Bacteria 4310
126 Ga0207694_10007562 3300025924 Bacteria 8238
127 Ga0207650_10031822 3300025925 Bacteria 3812
128 Ga0207690_10166153 3300025932 Bacteria 1649
129 Ga0207686_10322426 3300025934 Bacteria 1155
130 Ga0207669_10014395 3300025937 Bacteria 3963
131 Ga0207704_10135769 3300025938 Bacteria 1712
132 Ga0207679_10385973 3300025945 Bacteria 1229
133 Ga0207667_10228531 3300025949 Bacteria 1905
134 Ga0207640_10014466 3300025981 Bacteria 4545
135 Ga0207703_10066715 3300026035 Bacteria 2961
136 Ga0207639_10001962 3300026041 Bacteria 13823
137 Ga0207639_10103329 3300026041 Bacteria 2308
138 Ga0207678_10074929 3300026067 Bacteria 2899
139 Ga0207702_10102899 3300026078 Bacteria 2525
140 Ga0207648_10164793 3300026089 Bacteria 1958
141 Ga0207674_10026622 3300026116 Bacteria 6135
142 Ga0207683_10149983 3300026121 Bacteria 2104
143 Ga0207698_10023425 3300026142 Bacteria 4313
144 Ga0207698_10257975 3300026142 Bacteria 1600
145 Ga0209371_1000306 3300027312 Bacteria 54622
146 Ga0209282_1000145 3300027666 Bacteria 41539
147 Ga0209282_1025289 3300027666 Bacteria 3714
148 Ga0207428_10001439 3300027907 Bacteria 25009
149 Ga0268266_10006467 3300028379 Bacteria 10725
150 Ga0268265_10001714 3300028380 Bacteria 17774
151 Ga0268265_10009742 3300028380 Bacteria 6485
152 Ga0268264_10147366 3300028381 Bacteria 2106
153 Ga0268264_10460731 3300028381 Bacteria 1233
154 Ga0265338_10086259 3300028800 Bacteria 2614
155 Ga0265338_10123068 3300028800 Bacteria 2063
156 Ga0265324_10072360 3300029957 Bacteria 1174
157 Ga0268256_1000751 3300030500 Bacteria 23733
158 Ga0307512_10109049 3300030522 Bacteria 1834
159 Ga0265330_10001891 3300031235 Bacteria 11651
160 Ga0265327_10000481 3300031251 Bacteria 70259
161 Ga0265316_10055611 3300031344 Bacteria 3094
162 Ga0307513_10016195 3300031456 Bacteria 9005
163 Ga0307513_10038220 3300031456 Bacteria 5331
164 Ga0265313_10000668 3300031595 Bacteria 35331
165 Ga0265314_10000439 3300031711 Bacteria 55613
166 Ga0265314_10011240 3300031711 Bacteria 7408
167 Ga0307406_10070845 3300031901 Bacteria 2284
168 Ga0307407_10015585 3300031903 Bacteria 3764
169 Ga0307414_10024613 3300032004 Bacteria 3842
170 Ga0307414_10042920 3300032004 Bacteria 3076
171 Ga0316583_10040039 3300032133 Bacteria 1660
172 Ga0307510_10123572 3300033180 Bacteria 2285
173 Ga0373960_0041786 3300035121 Bacteria 1329
174 Ga0373962_0008011 3300035242 Bacteria 2595
175 Ga0316582_0106771 3300036647 Bacteria 1860
176 Ga0373925_0094129 3300037068 Bacteria 2294
177 Ga0436364_0923182 3300037853 Bacteria 1785
178 Ga0400489_13985 3300039093 Bacteria 1503
179 Ga0436365_0830248 3300039437 Bacteria 48518
180 Ga0466970_0008537 3300044765 Bacteria 5158
181 Ga0451576_0335817 3300045051 Bacteria 1582
182 Ga0495643_0022797 3300046522 Bacteria 3566
183 Ga0495633_0074536 3300046558 Bacteria 1581
184 Ga0495635_0189012 3300046663 Bacteria 1399
185 Ga0495588_0001058 3300046674 Bacteria 11943
186 Ga0495672_0035726 3300047320 Bacteria 3059
187 Ga0495686_0075917 3300047472 Bacteria 2060
188 Ga0496101_0003486 3300048904 Bacteria 9812
189 Ga0496103_0010085 3300048906 Bacteria 5586
190 Ga0496104_0028950 3300048907 Bacteria 5137
191 Ga0496104_0046858 3300048907 Bacteria 4073
192 Ga0496104_0167678 3300048907 Bacteria 2105
193 Ga0496105_0017759 3300048908 Bacteria 5707
194 Ga0496105_0024103 3300048908 Bacteria 4942
195 Ga0496105_0334272 3300048908 Bacteria 1212
196 Ga0496106_0057689 3300048909 Bacteria 2936
197 Ga0496106_0100692 3300048909 Bacteria 2241
198 Ga0496106_0177789 3300048909 Bacteria 1689
199 Ga0496107_0019843 3300048910 Bacteria 4746
200 Ga0496107_0035585 3300048910 Bacteria 3570
201 Ga0496112_0359952 3300048915 Bacteria 1397
202 Ga0496113_0149119 3300048916 Bacteria 1844
203 Ga0496114_0168987 3300048917 Bacteria 1905
204 Ga0496115_0124887 3300048918 Bacteria 2119
205 Ga0496116_0025952 3300048919 Bacteria 4295
206 Ga0496117_0000002 3300048920 Bacteria 2483758
207 Ga0496117_0054871 3300048920 Bacteria 2788
208 Ga0496117_0153401 3300048920 Bacteria 1360
209 Ga0496117_0270263 3300048920 Bacteria 916
210 Ga0496118_0001046 3300048921 Bacteria 43179
211 Ga0496118_0079626 3300048921 Bacteria 2311
212 Ga0496119_0041793 3300048922 Bacteria 2914
213 Ga0496120_0001226 3300048923 Bacteria 32437
214 Ga0496120_0008096 3300048923 Bacteria 7725
215 Ga0496121_0000001 3300048924 Bacteria 1830318
216 Ga0496121_0001687 3300048924 Bacteria 36333
217 Ga0496122_0000001 3300048925 Bacteria 1827766
218 Ga0496123_0000001 3300048926 Bacteria 1831497
219 Ga0496124_0006082 3300048927 Bacteria 13272
220 Ga0496125_0000001 3300048928 Bacteria 1766138
221 Ga0496125_0099183 3300048928 Bacteria 2152
222 Ga0496126_0027557 3300048929 Bacteria 5425
223 Ga0496126_0066213 3300048929 Bacteria 3230
224 Ga0496126_0091498 3300048929 Bacteria 2674
225 Ga0501032_0003759 3300049569 Bacteria 11517
226 Ga0501032_0006388 3300049569 Bacteria 8681
227 Ga0501032_0141214 3300049569 Bacteria 1586
228 Ga0501033_0006267 3300049570 Bacteria 9324
229 Ga0501033_0098322 3300049570 Bacteria 2137
230 Ga0501034_0000068 3300049571 Bacteria 182904
231 Ga0501034_0008529 3300049571 Bacteria 10816
232 Ga0501034_0452861 3300049571 Bacteria 1201
233 Ga0501036_0029308 3300049572 Bacteria 4652
234 Ga0501036_0133597 3300049572 Bacteria 2094
235 Ga0501037_0007030 3300049573 Bacteria 8219
236 Ga0501037_0019577 3300049573 Bacteria 4994
237 Ga0501037_0159423 3300049573 Bacteria 1609
238 Ga0501038_0000855 3300049574 Bacteria 27001
239 Ga0501038_0031098 3300049574 Bacteria 4720
240 Ga0501038_0124105 3300049574 Bacteria 2126
241 Ga0501039_0001098 3300049575 Bacteria 19845
242 Ga0501039_0005419 3300049575 Bacteria 9647
243 Ga0501039_0182959 3300049575 Bacteria 1648
244 Ga0501040_0257648 3300049576 Bacteria 1245
245 Ga0501041_0099327 3300049577 Bacteria 1801
246 Ga0501042_0059787 3300049578 Bacteria 2722
247 Ga0501043_0093486 3300049579 Bacteria 2364
248 Ga0501043_0109291 3300049579 Bacteria 2171
249 Ga0501043_0157662 3300049579 Bacteria 1775
250 Ga0501046_0000119 3300049580 Bacteria 83589
251 Ga0501046_0001693 3300049580 Bacteria 21063
252 Ga0501046_0013086 3300049580 Bacteria 7043
253 Ga0501046_0056399 3300049580 Bacteria 3084
254 Ga0501047_0013748 3300049581 Bacteria 7686
255 Ga0501047_0015835 3300049581 Bacteria 7184
256 Ga0501047_0040890 3300049581 Bacteria 4482
257 Ga0501047_0197067 3300049581 Bacteria 1876
258 Ga0501048_0012718 3300049582 Bacteria 6258
259 Ga0501067_0001101 3300049583 Bacteria 14581
260 Ga0501067_0068860 3300049583 Bacteria 1960
261 Ga0501068_0018303 3300049584 Bacteria 4058
262 Ga0501068_0186512 3300049584 Bacteria 1313
263 Ga0501069_0000530 3300049585 Bacteria 17469
264 Ga0501069_0013116 3300049585 Bacteria 4419
265 Ga0501070_0002757 3300049586 Bacteria 15330
266 Ga0501070_0121504 3300049586 Bacteria 2159
267 Ga0501072_0032007 3300049588 Bacteria 4117
268 Ga0501072_0132160 3300049588 Bacteria 1990
269 Ga0501072_0365534 3300049588 Bacteria 1145
270 Ga0501073_0007511 3300049589 Bacteria 8096
271 Ga0501073_0037268 3300049589 Bacteria 3453
272 Ga0501073_0038556 3300049589 Bacteria 3388
273 Ga0501073_0046825 3300049589 Bacteria 3041
274 Ga0501074_0002512 3300049590 Bacteria 12790
275 Ga0501074_0019375 3300049590 Bacteria 4943
276 Ga0501076_0073916 3300049592 Bacteria 2730
277 Ga0501077_0139640 3300049593 Bacteria 1537
278 Ga0501079_0055746 3300049741 Bacteria 3050
279 Ga0501080_0000001 3300049742 Bacteria 241365
280 Ga0501080_0003197 3300049742 Bacteria 14444
281 Ga0501080_0003470 3300049742 Bacteria 13901
282 Ga0501080_0037944 3300049742 Bacteria 4499
283 Ga0501080_0059013 3300049742 Bacteria 3571
284 Ga0501080_0089751 3300049742 Bacteria 2855
285 Ga0501080_0371428 3300049742 Bacteria 1289
286 Ga0501081_0100574 3300049743 Bacteria 2044
287 Ga0501081_0224583 3300049743 Bacteria 1366
288 Ga0501083_0004741 3300049744 Bacteria 9605
289 Ga0501083_0005266 3300049744 Bacteria 9152
290 Ga0501083_0012163 3300049744 Bacteria 6025
291 Ga0501083_0019525 3300049744 Bacteria 4720
292 Ga0501083_0089069 3300049744 Bacteria 2039
293 Ga0501083_0151823 3300049744 Bacteria 1516
294 Ga0501035_0000015 3300049822 Bacteria 246493
295 Ga0501035_0009712 3300049822 Bacteria 8950
296 Ga0501035_0056270 3300049822 Bacteria 3510
297 Ga0501035_0419321 3300049822 Bacteria 1111
298 Ga0501044_0000026 3300049823 Bacteria 183624
299 Ga0501044_0001924 3300049823 Bacteria 24036
300 Ga0501044_0004620 3300049823 Bacteria 15407
301 Ga0501044_0009653 3300049823 Bacteria 10498
302 Ga0501044_0018182 3300049823 Bacteria 7540
303 Ga0501044_0047717 3300049823 Bacteria 4429
304 Ga0501044_0082053 3300049823 Bacteria 3263
305 Ga0501045_0123337 3300049824 Bacteria 1924
306 nmdc:mga03683_8026_c1 3300050489 Bacteria 3694
307 nmdc:mga00v17_47_c1 3300050491 Bacteria 77934
308 nmdc:mga0yw44_141195_c1 3300050492 Bacteria 1566
309 nmdc:mga06z11_99482_c1 3300050494 Bacteria 1593
310 nmdc:mga04h51_3208_c1 3300050495 Bacteria 3950
311 nmdc:mga05p37_237131_c1 3300050507 Bacteria 2195
312 nmdc:mga08y16_16_c1 3300050511 Bacteria 386948
313 nmdc:mga08y16_422387_c1 3300050511 Bacteria 1362
314 nmdc:mga08y16_62701_c2 3300050511 Bacteria 2159
315 nmdc:mga0n895_86869_c1 3300050512 Bacteria 3124
316 nmdc:mga0a205_220290_c1 3300050515 Bacteria 1783
317 nmdc:mga0sz30_1214_c1 3300050516 Bacteria 9237
318 nmdc:mga0sz30_98919_c1 3300050516 Bacteria 1273
319 Ga0500578_0028572 3300053086 Bacteria 3582
320 Ga0500578_0114086 3300053086 Bacteria 1702
321 Ga0500643_000027 3300053087 Bacteria 251062
322 Ga0500644_0009549 3300053088 Bacteria 2599
323 Ga0500646_0007447 3300053090 Bacteria 2798
324 Ga0500583_0052735 3300053092 Bacteria 1894
325 Ga0500651_0004646 3300053093 Bacteria 7728
326 Ga0500641_0001432 3300053096 Bacteria 8511
327 Ga0500555_002365 3300053103 Bacteria 5491
328 Ga0500556_0007531 3300053104 Bacteria 3114
329 Ga0500560_029387 3300053107 Bacteria 1648
330 Ga0500593_013345 3300053117 Bacteria 3507
331 Ga0500594_0059504 3300053118 Bacteria 1098
332 Ga0500595_000264 3300053119 Bacteria 34740
333 Ga0500595_001670 3300053119 Bacteria 11671
334 Ga0500595_024470 3300053119 Bacteria 2107
335 Ga0500608_000034 3300053122 Bacteria 63144
336 Ga0500658_0005262 3300053134 Bacteria 4813
337 Ga0500658_0025620 3300053134 Bacteria 2267
338 Ga0500561_0000525 3300053137 Bacteria 6198
339 Ga0500568_0013446 3300053139 Bacteria 3730
340 Ga0500588_0002521 3300053146 Bacteria 3740
341 Ga0500604_0011531 3300053151 Bacteria 2374
342 Ga0500616_0000815 3300053153 Bacteria 35444
343 Ga0500616_0011222 3300053153 Bacteria 5311
344 Ga0500616_0013101 3300053153 Bacteria 4829
345 Ga0500616_0020773 3300053153 Bacteria 3687
346 Ga0500624_000680 3300053157 Bacteria 8644
347 Ga0500634_0009664 3300053161 Bacteria 4897
348 Ga0500636_0000036 3300053177 Bacteria 71714
349 Ga0500636_0000887 3300053177 Bacteria 16055
350 Ga0500611_011994 3300053727 Bacteria 1450
351 Ga0500609_001525 3300053731 Bacteria 3382
352 Ga0501084_0022355 3300054114 Bacteria 5278
353 Ga0501084_0052872 3300054114 Bacteria 3398
354 Ga0590077_016956 3300059426 Bacteria 1530
355 Ga0587111_0007457 3300060346 Bacteria 1778
356 Ga0501082_0002987 3300060353 Bacteria 14768
357 Ga0501082_0015446 3300060353 Bacteria 6571
358 Ga0501082_0033089 3300060353 Bacteria 4459
359 Ga0501082_0034983 3300060353 Bacteria 4330
360 Ga0501082_0042974 3300060353 Bacteria 3895
361 Ga0501082_0110438 3300060353 Bacteria 2380
362 Ga0501082_0135188 3300060353 Bacteria 2139
363 Ga0501082_0182650 3300060353 Bacteria 1824
364 Ga0530510_0141315 3300061734 Bacteria 1774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049578 Ga0501042_0059787 Ga0501042_0059787_1883_2704 269
2 3300049571 Ga0501034_0452861 Ga0501034_0452861_338_1186 270
3 3300029957 Ga0265324_10072360 Ga0265324_100723601 284
4 3300031235 Ga0265330_10001891 Ga0265330_1000189110 284
5 3300031344 Ga0265316_10055611 Ga0265316_100556113 284
6 3300031595 Ga0265313_10000668 Ga0265313_1000066835 284
7 3300031711 Ga0265314_10011240 Ga0265314_100112404 284
8 3300048920 Ga0496117_0270263 Ga0496117_0270263_13_903 284
9 3300050507 nmdc:mga05p37_237131_c1 nmdc:mga05p37_237131_c1_610_1593 290
10 3300006852 Ga0075433_10121345 Ga0075433_101213452 291
11 3300048907 Ga0496104_0028950 Ga0496104_0028950_2004_2987 292
12 3300048907 Ga0496104_0046858 Ga0496104_0046858_1123_2106 292
13 3300048908 Ga0496105_0024103 Ga0496105_0024103_3820_4803 292
14 3300048909 Ga0496106_0177789 Ga0496106_0177789_288_1271 292
15 3300048915 Ga0496112_0359952 Ga0496112_0359952_399_1373 293
16 3300053092 Ga0500583_0052735 Ga0500583_0052735_983_1873 293
17 3300022739 Ga0228711_1011824 Ga0228711_10118242 294
18 3300006871 Ga0075434_100146924 Ga0075434_1001469242 297
19 3300050512 nmdc:mga0n895_86869_c1 nmdc:mga0n895_86869_c1_891_1874 297
20 3300046522 Ga0495643_0022797 Ga0495643_0022797_2008_2991 299
21 3300006186 Ga0075369_10074887 Ga0075369_100748872 300
22 3300050516 nmdc:mga0sz30_98919_c1 nmdc:mga0sz30_98919_c1_239_1225 300
23 3300003322 rootL2_10091076 rootL2_100910762 301
24 3300053153 Ga0500616_0020773 Ga0500616_0020773_1380_2345 301
25 3300005983 Ga0081540_1000606 Ga0081540_100060612 302
26 3300053122 Ga0500608_000034 Ga0500608_000034_25568_26590 302
27 3300005347 Ga0070668_100132331 Ga0070668_1001323312 303
28 3300005353 Ga0070669_100028220 Ga0070669_1000282205 303
29 3300005356 Ga0070674_100010242 Ga0070674_1000102424 303
30 3300005459 Ga0068867_100194528 Ga0068867_1001945282 303
31 3300005546 Ga0070696_100027287 Ga0070696_1000272872 303
32 3300005844 Ga0068862_100020876 Ga0068862_1000208765 303
33 3300005981 Ga0081538_10001926 Ga0081538_100019263 303
34 3300006852 Ga0075433_10254064 Ga0075433_102540641 303
35 3300006881 Ga0068865_100052901 Ga0068865_1000529011 303
36 3300009094 Ga0111539_10000283 Ga0111539_1000028332 303
37 3300014326 Ga0157380_10011359 Ga0157380_100113594 303
38 3300025923 Ga0207681_10019264 Ga0207681_100192642 303
39 3300025937 Ga0207669_10014395 Ga0207669_100143953 303
40 3300025938 Ga0207704_10135769 Ga0207704_101357692 303
41 3300026089 Ga0207648_10164793 Ga0207648_101647932 303
42 3300027907 Ga0207428_10001439 Ga0207428_1000143911 303
43 3300031901 Ga0307406_10070845 Ga0307406_100708452 303
44 3300031903 Ga0307407_10015585 Ga0307407_100155854 303
45 3300045051 Ga0451576_0335817 Ga0451576_0335817_373_1359 303
46 3300050511 nmdc:mga08y16_16_c1 nmdc:mga08y16_16_c1_240446_241432 303
47 3300050511 nmdc:mga08y16_62701_c2 nmdc:mga08y16_62701_c2_1068_2051 303
48 3300050515 nmdc:mga0a205_220290_c1 nmdc:mga0a205_220290_c1_44_1030 303
49 3300053103 Ga0500555_002365 Ga0500555_002365_10_927 303
50 3300059426 Ga0590077_016956 Ga0590077_016956_496_1476 303
51 3300005344 Ga0070661_100007931 Ga0070661_1000079313 305
52 3300005616 Ga0068852_100393495 Ga0068852_1003934952 305
53 3300025920 Ga0207649_10024382 Ga0207649_100243823 305
54 3300026142 Ga0207698_10257975 Ga0207698_102579752 305
55 3300005344 Ga0070661_100003626 Ga0070661_1000036265 306
56 3300005539 Ga0068853_100001411 Ga0068853_10000141113 306
57 3300005578 Ga0068854_100002611 Ga0068854_1000026116 306
58 3300005614 Ga0068856_100121723 Ga0068856_1001217233 306
59 3300005616 Ga0068852_100007210 Ga0068852_1000072103 306
60 3300005616 Ga0068852_100225104 Ga0068852_1002251042 306
61 3300005834 Ga0068851_10001278 Ga0068851_100012785 306
62 3300009093 Ga0105240_10254511 Ga0105240_102545112 306
63 3300009174 Ga0105241_10032004 Ga0105241_100320044 306
64 3300009545 Ga0105237_10021152 Ga0105237_100211524 306
65 3300009551 Ga0105238_10018218 Ga0105238_100182185 306
66 3300010375 Ga0105239_10011799 Ga0105239_100117998 306
67 3300025321 Ga0207656_10000789 Ga0207656_100007897 306
68 3300025911 Ga0207654_10015070 Ga0207654_100150702 306
69 3300025914 Ga0207671_10020736 Ga0207671_100207361 306
70 3300025920 Ga0207649_10001603 Ga0207649_100016038 306
71 3300025924 Ga0207694_10007562 Ga0207694_100075623 306
72 3300025981 Ga0207640_10014466 Ga0207640_100144663 306
73 3300026041 Ga0207639_10001962 Ga0207639_100019629 306
74 3300026078 Ga0207702_10102899 Ga0207702_101028993 306
75 3300026142 Ga0207698_10023425 Ga0207698_100234253 306
76 3300031456 Ga0307513_10016195 Ga0307513_100161954 306
77 3300031711 Ga0265314_10000439 Ga0265314_1000043918 306
78 3300032133 Ga0316583_10040039 Ga0316583_100400392 306
79 3300049589 Ga0501073_0046825 Ga0501073_0046825_445_1371 306
80 3300013297 Ga0157378_10114499 Ga0157378_101144992 307
81 3300048910 Ga0496107_0035585 Ga0496107_0035585_925_1968 307
82 3300048924 Ga0496121_0001687 Ga0496121_0001687_29248_30225 307
83 3300048929 Ga0496126_0027557 Ga0496126_0027557_620_1708 307
84 3300049569 Ga0501032_0006388 Ga0501032_0006388_1159_2130 307
85 3300049570 Ga0501033_0006267 Ga0501033_0006267_2514_3485 307
86 3300049571 Ga0501034_0008529 Ga0501034_0008529_8828_9799 307
87 3300049572 Ga0501036_0029308 Ga0501036_0029308_2403_3374 307
88 3300049573 Ga0501037_0019577 Ga0501037_0019577_2296_3267 307
89 3300049574 Ga0501038_0000855 Ga0501038_0000855_9061_10032 307
90 3300049575 Ga0501039_0001098 Ga0501039_0001098_4978_5949 307
91 3300049579 Ga0501043_0109291 Ga0501043_0109291_29_1000 307
92 3300049580 Ga0501046_0001693 Ga0501046_0001693_12885_13856 307
93 3300049581 Ga0501047_0040890 Ga0501047_0040890_3260_4231 307
94 3300049582 Ga0501048_0012718 Ga0501048_0012718_3259_4230 307
95 3300049584 Ga0501068_0018303 Ga0501068_0018303_633_1604 307
96 3300049585 Ga0501069_0000530 Ga0501069_0000530_6456_7427 307
97 3300049586 Ga0501070_0002757 Ga0501070_0002757_6949_7920 307
98 3300049589 Ga0501073_0007511 Ga0501073_0007511_2514_3485 307
99 3300049590 Ga0501074_0002512 Ga0501074_0002512_10667_11638 307
100 3300049741 Ga0501079_0055746 Ga0501079_0055746_1058_2029 307
101 3300049742 Ga0501080_0003197 Ga0501080_0003197_13445_14416 307
102 3300049744 Ga0501083_0089069 Ga0501083_0089069_1031_2002 307
103 3300049822 Ga0501035_0009712 Ga0501035_0009712_6949_7920 307
104 3300049823 Ga0501044_0009653 Ga0501044_0009653_6949_7920 307
105 3300053117 Ga0500593_013345 Ga0500593_013345_128_1102 307
106 3300054114 Ga0501084_0022355 Ga0501084_0022355_973_1944 307
107 3300060353 Ga0501082_0002987 Ga0501082_0002987_785_1756 307
108 3300048909 Ga0496106_0100692 Ga0496106_0100692_325_1335 309
109 3300049569 Ga0501032_0141214 Ga0501032_0141214_324_1304 309
110 3300049822 Ga0501035_0056270 Ga0501035_0056270_789_1769 309
111 3300037068 Ga0373925_0094129 Ga0373925_0094129_1120_2058 310
112 3300053086 Ga0500578_0028572 Ga0500578_0028572_1727_2695 310
113 3300005347 Ga0070668_100008828 Ga0070668_1000088283 311
114 3300005719 Ga0068861_100035694 Ga0068861_1000356943 311
115 3300005841 Ga0068863_100156577 Ga0068863_1001565772 311
116 3300005843 Ga0068860_100022688 Ga0068860_1000226883 311
117 3300005844 Ga0068862_100100547 Ga0068862_1001005473 311
118 3300009553 Ga0105249_10383272 Ga0105249_103832722 311
119 3300025925 Ga0207650_10031822 Ga0207650_100318223 311
120 3300060346 Ga0587111_0007457 Ga0587111_0007457_168_1142 311
121 3300053119 Ga0500595_001670 Ga0500595_001670_4522_5505 312
122 iso_pu_bacteria 2775506901 2776266069 314
123 3300003856 Ga0058692_1007531 Ga0058692_10075314 315
124 3300027312 Ga0209371_1000306 Ga0209371_100030637 315
125 3300030500 Ga0268256_1000751 Ga0268256_100075110 315
126 3300050495 nmdc:mga04h51_3208_c1 nmdc:mga04h51_3208_c1_522_1586 315
127 iso_pu_bacteria 2643221663 2644353489 315
128 3300025932 Ga0207690_10166153 Ga0207690_101661532 316
129 3300049583 Ga0501067_0001101 Ga0501067_0001101_5470_6429 316
130 iso_pu_bacteria 2510065057 2510304703 316
131 iso_pu_bacteria 2512875026 2512974839 316
132 iso_pu_bacteria 2513237156 2513988508 316
133 iso_pu_bacteria 2515154107 2515609960 316
134 iso_pu_bacteria 2524023207 2524452313 316
135 iso_pu_bacteria 2671180139 2671693713 316
136 iso_pu_bacteria 2791355048 2792461718 316
137 iso_pu_bacteria 2851153111 2851156699 316
138 3300005356 Ga0070674_100003408 Ga0070674_1000034083 317
139 3300005455 Ga0070663_100148266 Ga0070663_1001482662 317
140 3300006948 Ga0099826_10032750 Ga0099826_100327502 317
141 3300027666 Ga0209282_1025289 Ga0209282_10252893 317
142 iso_pu_bacteria 2838074704 2838075701 317
143 iso_pu_bacteria 2896384573 2896386210 317
144 iso_pu_bacteria 2928972540 2928974261 317
145 iso_pu_bacteria 2977240413 2977243193 317
146 3300060353 Ga0501082_0182650 Ga0501082_0182650_175_1131 318
147 iso_pu_bacteria 2889914905 2889918772 318
148 iso_pu_bacteria 2917554339 2917554525 318
149 3300003215 JGI25153J46596_10000309 JGI25153J46596_100003099 319
150 3300003794 Ga0055531_10012011 Ga0055531_100120113 319
151 3300005844 Ga0068862_100013195 Ga0068862_1000131954 319
152 3300005985 Ga0081539_10044827 Ga0081539_100448272 319
153 3300006177 Ga0075362_10084345 Ga0075362_100843452 319
154 3300025297 Ga0209758_1000005 Ga0209758_1000005740 319
155 3300025298 Ga0209050_1001984 Ga0209050_100198410 319
156 3300025304 Ga0209257_1000941 Ga0209257_100094117 319
157 3300028380 Ga0268265_10001714 Ga0268265_100017146 319
158 3300028800 Ga0265338_10123068 Ga0265338_101230682 319
159 3300030522 Ga0307512_10109049 Ga0307512_101090492 319
160 3300031456 Ga0307513_10038220 Ga0307513_100382205 319
161 3300033180 Ga0307510_10123572 Ga0307510_101235722 319
162 3300035121 Ga0373960_0041786 Ga0373960_0041786_156_1130 319
163 3300035242 Ga0373962_0008011 Ga0373962_0008011_342_1316 319
164 3300046663 Ga0495635_0189012 Ga0495635_0189012_43_1002 319
165 3300047320 Ga0495672_0035726 Ga0495672_0035726_228_1196 319
166 3300047472 Ga0495686_0075917 Ga0495686_0075917_935_1909 319
167 3300048919 Ga0496116_0025952 Ga0496116_0025952_695_1678 319
168 3300048920 Ga0496117_0054871 Ga0496117_0054871_1202_2185 319
169 3300048922 Ga0496119_0041793 Ga0496119_0041793_1805_2788 319
170 3300048923 Ga0496120_0008096 Ga0496120_0008096_294_1277 319
171 3300048924 Ga0496121_0000001 Ga0496121_0000001_98105_99088 319
172 3300048928 Ga0496125_0000001 Ga0496125_0000001_211560_212543 319
173 3300048929 Ga0496126_0066213 Ga0496126_0066213_1124_2107 319
174 3300049572 Ga0501036_0133597 Ga0501036_0133597_1015_1989 319
175 3300049574 Ga0501038_0031098 Ga0501038_0031098_92_1060 319
176 3300049579 Ga0501043_0157662 Ga0501043_0157662_339_1307 319
177 3300049581 Ga0501047_0015835 Ga0501047_0015835_3838_4812 319
178 3300049581 Ga0501047_0197067 Ga0501047_0197067_254_1222 319
179 3300049585 Ga0501069_0013116 Ga0501069_0013116_2295_3269 319
180 3300049589 Ga0501073_0037268 Ga0501073_0037268_680_1648 319
181 3300049589 Ga0501073_0038556 Ga0501073_0038556_1542_2516 319
182 3300049593 Ga0501077_0139640 Ga0501077_0139640_410_1390 319
183 3300049742 Ga0501080_0037944 Ga0501080_0037944_2219_3193 319
184 3300049742 Ga0501080_0089751 Ga0501080_0089751_433_1401 319
185 3300049742 Ga0501080_0371428 Ga0501080_0371428_88_1056 319
186 3300049744 Ga0501083_0012163 Ga0501083_0012163_3240_4208 319
187 3300049744 Ga0501083_0019525 Ga0501083_0019525_2798_3772 319
188 3300049822 Ga0501035_0419321 Ga0501035_0419321_20_988 319
189 3300049823 Ga0501044_0004620 Ga0501044_0004620_3357_4325 319
190 3300049823 Ga0501044_0018182 Ga0501044_0018182_4317_5291 319
191 3300049823 Ga0501044_0047717 Ga0501044_0047717_1644_2612 319
192 3300053086 Ga0500578_0114086 Ga0500578_0114086_16_984 319
193 3300053088 Ga0500644_0009549 Ga0500644_0009549_214_1191 319
194 3300053090 Ga0500646_0007447 Ga0500646_0007447_16_993 319
195 3300053093 Ga0500651_0004646 Ga0500651_0004646_5096_6070 319
196 3300053096 Ga0500641_0001432 Ga0500641_0001432_31_1005 319
197 3300053104 Ga0500556_0007531 Ga0500556_0007531_33_1007 319
198 3300053118 Ga0500594_0059504 Ga0500594_0059504_37_1014 319
199 3300053119 Ga0500595_000264 Ga0500595_000264_22432_23409 319
200 3300053134 Ga0500658_0025620 Ga0500658_0025620_240_1217 319
201 3300053146 Ga0500588_0002521 Ga0500588_0002521_2594_3562 319
202 3300053151 Ga0500604_0011531 Ga0500604_0011531_48_1022 319
203 3300053153 Ga0500616_0000815 Ga0500616_0000815_12243_13211 319
204 3300053731 Ga0500609_001525 Ga0500609_001525_1991_2968 319
205 3300060353 Ga0501082_0042974 Ga0501082_0042974_2812_3786 319
206 3300060353 Ga0501082_0110438 Ga0501082_0110438_517_1485 319
207 3300005444 Ga0070694_100249934 Ga0070694_1002499341 320
208 3300005617 Ga0068859_100126674 Ga0068859_1001266743 320
209 3300005843 Ga0068860_100156849 Ga0068860_1001568492 320
210 3300005844 Ga0068862_100001303 Ga0068862_10000130321 320
211 3300006051 Ga0075364_10094058 Ga0075364_100940582 320
212 3300006931 Ga0097620_100126672 Ga0097620_1001266723 320
213 3300009093 Ga0105240_10002991 Ga0105240_1000299133 320
214 3300009094 Ga0111539_10400975 Ga0111539_104009752 320
215 3300009176 Ga0105242_10210108 Ga0105242_102101082 320
216 3300009551 Ga0105238_10198884 Ga0105238_101988843 320
217 3300021384 Ga0213876_10000267 Ga0213876_1000026755 320
218 3300025913 Ga0207695_10004934 Ga0207695_1000493423 320
219 3300025934 Ga0207686_10322426 Ga0207686_103224261 320
220 3300028380 Ga0268265_10009742 Ga0268265_100097423 320
221 3300028381 Ga0268264_10147366 Ga0268264_101473662 320
222 3300037853 Ga0436364_0923182 Ga0436364_0923182_631_1605 320
223 3300039437 Ga0436365_0830248 Ga0436365_0830248_46914_47888 320
224 3300049588 Ga0501072_0132160 Ga0501072_0132160_276_1250 320
225 3300049742 Ga0501080_0003470 Ga0501080_0003470_4370_5344 320
226 3300049744 Ga0501083_0004741 Ga0501083_0004741_420_1394 320
227 3300050511 nmdc:mga08y16_422387_c1 nmdc:mga08y16_422387_c1_282_1259 320
228 3300053134 Ga0500658_0005262 Ga0500658_0005262_1745_2716 320
229 3300060353 Ga0501082_0135188 Ga0501082_0135188_24_998 320
230 3300005563 Ga0068855_100504068 Ga0068855_1005040681 321
231 3300005844 Ga0068862_100235394 Ga0068862_1002353941 321
232 3300013102 Ga0157371_10006842 Ga0157371_100068425 321
233 3300013104 Ga0157370_10013535 Ga0157370_100135353 321
234 3300013105 Ga0157369_10004610 Ga0157369_100046104 321
235 3300017792 Ga0163161_10107104 Ga0163161_101071042 321
236 3300049573 Ga0501037_0159423 Ga0501037_0159423_100_1125 321
237 iso_pu_bacteria 2510917022 2511136839 321
238 iso_pu_bacteria 2582581307 2585273476 321
239 iso_pu_bacteria 2582581315 2585328183 321
240 iso_pu_bacteria 2582581316 2585330594 321
241 iso_pu_bacteria 2585427531 2585563995 321
242 iso_pu_bacteria 2585427608 2585900336 321
243 iso_pu_bacteria 2585427609 2585909297 321
244 iso_pu_bacteria 2585428125 2587984601 321
245 iso_pu_bacteria 2617270742 2617380704 321
246 iso_pu_bacteria 2775507266 2778179525 321
247 iso_pu_bacteria 2842482326 2842487237 321
248 iso_pu_bacteria 2929138655 2929138665 321
249 3300005329 Ga0070683_100009757 Ga0070683_1000097571 322
250 3300005334 Ga0068869_100383701 Ga0068869_1003837011 322
251 3300005455 Ga0070663_100026030 Ga0070663_1000260302 322
252 3300005844 Ga0068862_100513962 Ga0068862_1005139621 322
253 3300009545 Ga0105237_10054437 Ga0105237_100544372 322
254 3300026067 Ga0207678_10074929 Ga0207678_100749292 322
255 3300028800 Ga0265338_10086259 Ga0265338_100862592 322
256 3300031251 Ga0265327_10000481 Ga0265327_1000048114 322
257 3300039093 Ga0400489_13985 Ga0400489_13985_142_1110 322
258 3300048908 Ga0496105_0017759 Ga0496105_0017759_4683_5657 322
259 3300049570 Ga0501033_0098322 Ga0501033_0098322_49_1032 322
260 3300049573 Ga0501037_0007030 Ga0501037_0007030_4030_5013 322
261 3300049575 Ga0501039_0182959 Ga0501039_0182959_347_1327 322
262 3300049577 Ga0501041_0099327 Ga0501041_0099327_130_1110 322
263 3300049579 Ga0501043_0093486 Ga0501043_0093486_335_1375 322
264 3300049588 Ga0501072_0032007 Ga0501072_0032007_1174_2148 322
265 3300049588 Ga0501072_0365534 Ga0501072_0365534_48_1028 322
266 3300049590 Ga0501074_0019375 Ga0501074_0019375_892_1866 322
267 3300049592 Ga0501076_0073916 Ga0501076_0073916_484_1464 322
268 3300049742 Ga0501080_0059013 Ga0501080_0059013_1625_2599 322
269 3300049743 Ga0501081_0224583 Ga0501081_0224583_305_1285 322
270 3300049744 Ga0501083_0005266 Ga0501083_0005266_4341_5309 322
271 3300049744 Ga0501083_0151823 Ga0501083_0151823_34_1008 322
272 3300049823 Ga0501044_0001924 Ga0501044_0001924_16921_17904 322
273 3300053087 Ga0500643_000027 Ga0500643_000027_188439_189407 322
274 3300053139 Ga0500568_0013446 Ga0500568_0013446_1709_2677 322
275 3300053153 Ga0500616_0013101 Ga0500616_0013101_1346_2353 322
276 3300053727 Ga0500611_011994 Ga0500611_011994_166_1140 322
277 3300054114 Ga0501084_0052872 Ga0501084_0052872_1194_2174 322
278 3300060353 Ga0501082_0015446 Ga0501082_0015446_3241_4215 322
279 3300060353 Ga0501082_0033089 Ga0501082_0033089_2858_3838 322
280 3300061734 Ga0530510_0141315 Ga0530510_0141315_12_992 322
281 iso_pu_bacteria 2537561587 2537877353 322
282 iso_pu_bacteria 2554235003 2554246250 322
283 iso_pu_bacteria 2558860242 2559293472 322
284 iso_pu_bacteria 2599185210 2599604354 322
285 iso_pu_bacteria 2600255279 2601609509 322
286 iso_pu_bacteria 2600255308 2601746284 322
287 iso_pu_bacteria 2643221582 2643920630 322
288 iso_pu_bacteria 2643221693 2644519561 322
289 iso_pu_bacteria 2808606387 2808986757 322
290 iso_pu_bacteria 2838675328 2838677566 322
291 iso_pu_bacteria 2841859092 2841860794 322
292 iso_pu_bacteria 2842152218 2842152372 322
293 iso_pu_bacteria 2842509118 2842514511 322
294 iso_pu_bacteria 2842515876 2842517579 322
295 iso_pu_bacteria 2899792073 2899794378 322
296 iso_pu_bacteria 2899845264 2899845761 322
297 iso_pu_bacteria 2919114240 2919116672 322
298 iso_pu_bacteria 2926754445 2926754681 322
299 iso_pu_bacteria 2926760298 2926761849 322
300 iso_pu_bacteria 2933006813 2933007019 322
301 iso_pu_bacteria 2933011516 2933015390 322
302 iso_pu_bacteria 2933594066 2933594221 322
303 iso_pu_bacteria 2979089926 2979092885 322
304 iso_pu_bacteria 2979095461 2979099726 322
305 iso_pu_bacteria 650716007 650738709 322
306 iso_pu_bacteria 8003570095 8003572256 322
307 iso_pu_bacteria 8046767195 8046768662 322
308 iso_pu_bacteria 8054460903 8054461028 322
309 iso_pu_bacteria 8055431914 8055433846 322
310 iso_pu_bacteria 8057575449 8057582438 322
311 3300005336 Ga0070680_100011407 Ga0070680_1000114074 323
312 3300005337 Ga0070682_100021945 Ga0070682_1000219453 323
313 3300005339 Ga0070660_100100737 Ga0070660_1001007371 323
314 3300005366 Ga0070659_100019162 Ga0070659_1000191623 323
315 3300005455 Ga0070663_100037287 Ga0070663_1000372872 323
316 3300005458 Ga0070681_10041089 Ga0070681_100410893 323
317 3300005459 Ga0068867_100199218 Ga0068867_1001992181 323
318 3300005539 Ga0068853_100016745 Ga0068853_1000167454 323
319 3300005545 Ga0070695_100020365 Ga0070695_1000203653 323
320 3300005546 Ga0070696_100006841 Ga0070696_1000068412 323
321 3300005547 Ga0070693_100011509 Ga0070693_1000115093 323
322 3300005563 Ga0068855_100234646 Ga0068855_1002346461 323
323 3300005577 Ga0068857_100363857 Ga0068857_1003638572 323
324 3300005842 Ga0068858_100076921 Ga0068858_1000769212 323
325 3300009148 Ga0105243_10011465 Ga0105243_100114653 323
326 3300009545 Ga0105237_10033625 Ga0105237_100336253 323
327 3300009551 Ga0105238_10012412 Ga0105238_100124127 323
328 3300011119 Ga0105246_10022386 Ga0105246_100223863 323
329 3300013105 Ga0157369_10078741 Ga0157369_100787413 323
330 3300013297 Ga0157378_10290766 Ga0157378_102907661 323
331 3300013308 Ga0157375_10038877 Ga0157375_100388772 323
332 3300014968 Ga0157379_10083649 Ga0157379_100836493 323
333 3300014969 Ga0157376_10094017 Ga0157376_100940172 323
334 3300025914 Ga0207671_10022692 Ga0207671_100226923 323
335 3300025945 Ga0207679_10385973 Ga0207679_103859731 323
336 3300025949 Ga0207667_10228531 Ga0207667_102285312 323
337 3300026035 Ga0207703_10066715 Ga0207703_100667153 323
338 3300026041 Ga0207639_10103329 Ga0207639_101033292 323
339 3300026116 Ga0207674_10026622 Ga0207674_100266223 323
340 3300026121 Ga0207683_10149983 Ga0207683_101499832 323
341 3300028381 Ga0268264_10460731 Ga0268264_104607311 323
342 3300032004 Ga0307414_10024613 Ga0307414_100246133 323
343 3300032004 Ga0307414_10042920 Ga0307414_100429203 323
344 3300036647 Ga0316582_0106771 Ga0316582_0106771_654_1637 323
345 3300048904 Ga0496101_0003486 Ga0496101_0003486_8821_9801 323
346 3300048906 Ga0496103_0010085 Ga0496103_0010085_16_996 323
347 3300048907 Ga0496104_0167678 Ga0496104_0167678_140_1120 323
348 3300048908 Ga0496105_0334272 Ga0496105_0334272_174_1154 323
349 3300048909 Ga0496106_0057689 Ga0496106_0057689_288_1268 323
350 3300048910 Ga0496107_0019843 Ga0496107_0019843_2416_3396 323
351 3300048917 Ga0496114_0168987 Ga0496114_0168987_409_1389 323
352 3300048918 Ga0496115_0124887 Ga0496115_0124887_51_1031 323
353 3300049576 Ga0501040_0257648 Ga0501040_0257648_131_1204 323
354 3300049580 Ga0501046_0000119 Ga0501046_0000119_27114_28091 323
355 3300049580 Ga0501046_0013086 Ga0501046_0013086_4329_5402 323
356 3300049583 Ga0501067_0068860 Ga0501067_0068860_572_1546 323
357 3300049584 Ga0501068_0186512 Ga0501068_0186512_133_1113 323
358 3300049586 Ga0501070_0121504 Ga0501070_0121504_600_1580 323
359 3300049823 Ga0501044_0082053 Ga0501044_0082053_983_1963 323
360 3300060353 Ga0501082_0034983 Ga0501082_0034983_3196_4176 323
361 3300003215 JGI25153J46596_10013837 JGI25153J46596_100138373 324
362 3300003791 Ga0055530_10016220 Ga0055530_100162201 324
363 3300003792 Ga0055540_1002210 Ga0055540_10022108 324
364 3300049569 Ga0501032_0003759 Ga0501032_0003759_10_993 324
365 3300049571 Ga0501034_0000068 Ga0501034_0000068_43164_44147 324
366 3300049574 Ga0501038_0124105 Ga0501038_0124105_67_1050 324
367 3300049575 Ga0501039_0005419 Ga0501039_0005419_8574_9557 324
368 3300049580 Ga0501046_0056399 Ga0501046_0056399_2035_3018 324
369 3300049581 Ga0501047_0013748 Ga0501047_0013748_4932_5915 324
370 3300049742 Ga0501080_0000001 Ga0501080_0000001_141934_142917 324
371 3300049743 Ga0501081_0100574 Ga0501081_0100574_861_1838 324
372 3300049822 Ga0501035_0000015 Ga0501035_0000015_149025_150008 324
373 3300049823 Ga0501044_0000026 Ga0501044_0000026_11211_12194 324
374 3300049824 Ga0501045_0123337 Ga0501045_0123337_892_1875 324
375 3300053119 Ga0500595_024470 Ga0500595_024470_71_1054 324
376 3300053153 Ga0500616_0011222 Ga0500616_0011222_3247_4227 324
377 3300001979 JGI24740J21852_10000671 JGI24740J21852_1000067110 325
378 3300002704 JGI25155J39150_1000110 JGI25155J39150_100011016 325
379 3300002737 JGI25162J39368_1000517 JGI25162J39368_100051713 325
380 3300002987 JGI25159J45721_1000516 JGI25159J45721_100051618 325
381 3300003214 JGI25165J46597_1000720 JGI25165J46597_10007208 325
382 3300005548 Ga0070665_100008033 Ga0070665_1000080336 325
383 3300006042 Ga0075368_10027045 Ga0075368_100270452 325
384 3300006048 Ga0075363_100042369 Ga0075363_1000423692 325
385 3300006177 Ga0075362_10059734 Ga0075362_100597341 325
386 3300006178 Ga0075367_10067068 Ga0075367_100670682 325
387 3300006178 Ga0075367_10141778 Ga0075367_101417781 325
388 3300006195 Ga0075366_10003803 Ga0075366_100038032 325
389 3300006948 Ga0099826_10000075 Ga0099826_1000007519 325
390 3300009148 Ga0105243_10022332 Ga0105243_100223321 325
391 3300013100 Ga0157373_10001761 Ga0157373_1000176113 325
392 3300013102 Ga0157371_10000004 Ga0157371_10000004151 325
393 3300013104 Ga0157370_10003055 Ga0157370_1000305517 325
394 3300025233 Ga0209437_100205 Ga0209437_10020598 325
395 3300025261 Ga0209233_1000187 Ga0209233_1000187118 325
396 3300027666 Ga0209282_1000145 Ga0209282_100014536 325
397 3300028379 Ga0268266_10006467 Ga0268266_100064674 325
398 3300044765 Ga0466970_0008537 Ga0466970_0008537_1962_2939 325
399 3300046558 Ga0495633_0074536 Ga0495633_0074536_48_1034 325
400 3300046674 Ga0495588_0001058 Ga0495588_0001058_9607_10593 325
401 3300048916 Ga0496113_0149119 Ga0496113_0149119_821_1807 325
402 3300048920 Ga0496117_0000002 Ga0496117_0000002_2327946_2328932 325
403 3300048920 Ga0496117_0153401 Ga0496117_0153401_108_1094 325
404 3300048921 Ga0496118_0001046 Ga0496118_0001046_2647_3633 325
405 3300048921 Ga0496118_0079626 Ga0496118_0079626_69_1055 325
406 3300048923 Ga0496120_0001226 Ga0496120_0001226_18156_19142 325
407 3300048925 Ga0496122_0000001 Ga0496122_0000001_1671953_1672939 325
408 3300048926 Ga0496123_0000001 Ga0496123_0000001_1675684_1676670 325
409 3300048927 Ga0496124_0006082 Ga0496124_0006082_10232_11218 325
410 3300048928 Ga0496125_0099183 Ga0496125_0099183_768_1754 325
411 3300048929 Ga0496126_0091498 Ga0496126_0091498_69_1055 325
412 3300050489 nmdc:mga03683_8026_c1 nmdc:mga03683_8026_c1_1631_2617 325
413 3300050491 nmdc:mga00v17_47_c1 nmdc:mga00v17_47_c1_48069_49055 325
414 3300050492 nmdc:mga0yw44_141195_c1 nmdc:mga0yw44_141195_c1_512_1498 325
415 3300050494 nmdc:mga06z11_99482_c1 nmdc:mga06z11_99482_c1_147_1133 325
416 3300050516 nmdc:mga0sz30_1214_c1 nmdc:mga0sz30_1214_c1_4640_5626 325
417 3300053107 Ga0500560_029387 Ga0500560_029387_608_1594 325
418 3300053137 Ga0500561_0000525 Ga0500561_0000525_4608_5594 325
419 3300053157 Ga0500624_000680 Ga0500624_000680_3239_4225 325
420 3300053161 Ga0500634_0009664 Ga0500634_0009664_3276_4262 325
421 3300053177 Ga0500636_0000036 Ga0500636_0000036_42717_43703 325
422 3300053177 Ga0500636_0000887 Ga0500636_0000887_6100_7086 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

216

346

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.8294 179 289
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8283 179 292
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8266 179 292
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8257 179 292
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.8026 179 289
ID Description Score Start End Superfamily
af_O69625_45_175_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7182 186 312 1.20.81.30
af_O69625_45_175_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.6956 186 312 1.20.81.30
af_K7K4N6_264_386_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3877 185 278 1.25.40.10
af_I1K2A6_267_392_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3848 185 279 1.25.40.10
2c2lD01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3813 183 283 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A5R2N1Y6-F1-model_v4 Type II secretion system F family protein 0.9263 165 305 GO:0005886
AF-A0A5R2N1Y6-F1-model_v4 Type II secretion system F family protein 0.9136 165 305 GO:0005886
AF-A0A529Q458-F1-model_v4 Type II secretion system F family protein 0.8882 138 278 GO:0005886
AF-A0A529HLZ7-F1-model_v4 Type II secretion system F family protein 0.8846 135 263 GO:0005886
AF-A0A4S0V8E1-F1-model_v4 Type II secretion system F family protein 0.8759 161 300 GO:0005886

Feature Viewer

pLDDT pTM Quality
79.56 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map