F440363

General Info

Members Datasets Scaffolds Average Seq Length
422 262 422 141

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0407420|Ga0495648_0407420_32_559
Length 175
Sequence MAGIWSLQCDELIFQHYDSEEMAMRAIPALCLGVFMMAASGASIAVEPAGHITGVGGVFFKAKDTKALAAWYRDVLGMPLEVWGGAKLRYDAAEHPPALIWTAFPATSKYFAPSASEFMINYAVDDMDAMLARLAAKSVAVLKRTDDDPNGRFAWILDPEGNKVELWEPKRPPSP

Samples

Sample ID Description Type Environment
1 2884411467 Dyella sp. AD56 Isolate Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
83 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
99 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
108 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
109 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
190 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
191 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
192 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
193 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
194 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
195 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
196 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
197 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
226 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
227 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
228 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
229 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
259 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
260 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.74
Nodule 0
Rhizoplane 4.5
Rhizosphere 76.3
Stem 0
Stem Tuber 0
Unclassified 5.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10001077 3300002067 Bacteria 9786
2 JGI24735J21928_10007882 3300002067 Bacteria 3460
3 JGI24735J21928_10016330 3300002067 Bacteria 2306
4 JGI25156J39149_1010850 3300002705 Bacteria 2108
5 JGI25162J39368_1000028 3300002737 Bacteria 221876
6 JGI25162J39368_1000619 3300002737 Bacteria 25417
7 JGI25154J39366_1009736 3300002738 Bacteria 1169
8 JGI25157J39369_1000042 3300002741 Bacteria 123300
9 JGI25157J39369_1000364 3300002741 Bacteria 31214
10 JGI25163J39215_1000113 3300002771 Bacteria 33750
11 JGI25164J39214_1000012 3300002772 Bacteria 255140
12 JGI25164J39214_1006689 3300002772 Bacteria 1199
13 JGI25165J46597_1000048 3300003214 Bacteria 254392
14 rootH1_10023224 3300003316 Bacteria 6172
15 rootH1_10034412 3300003316 Bacteria 4969
16 rootH1_10034412 3300003323 Bacteria 3310
17 rootH2_10037622 3300003320 Bacteria 7770
18 rootH1_10055292 3300003323 Bacteria 12135
19 JGI26145J50221_1033562 3300003371 Bacteria 530
20 Ga0055538_1000299 3300003751 Bacteria 24852
21 Ga0055539_1000210 3300003752 Bacteria 44737
22 Ga0055539_1005884 3300003752 Unclassified 1581
23 Ga0055533_1000028 3300003756 Bacteria 311012
24 Ga0055533_1000057 3300003756 Bacteria 194035
25 Ga0055533_1008944 3300003756 Unclassified 1224
26 Ga0055525_1000851 3300003759 Bacteria 9039
27 Ga0055527_1000037 3300003760 Bacteria 124590
28 Ga0055535_1000027 3300003761 Bacteria 202056
29 Ga0055535_1000059 3300003761 Bacteria 124595
30 Ga0055542_1000034 3300003762 Bacteria 231972
31 Ga0055542_1000086 3300003762 Bacteria 124594
32 Ga0055542_1000223 3300003762 Bacteria 68138
33 Ga0055542_1000375 3300003762 Bacteria 45897
34 Ga0055529_1000056 3300003763 Bacteria 196316
35 Ga0055529_1000231 3300003763 Bacteria 70928
36 Ga0065715_10109276 3300005293 Bacteria 2675
37 Ga0070658_10321742 3300005327 Bacteria 1321
38 Ga0070676_10694900 3300005328 Bacteria 742
39 Ga0070683_100075203 3300005329 Bacteria 3156
40 Ga0070683_100433652 3300005329 Bacteria 1254
41 Ga0070683_100710602 3300005329 Bacteria 963
42 Ga0070690_100127722 3300005330 Bacteria 1714
43 Ga0070690_100157256 3300005330 Bacteria 1555
44 Ga0070677_10687555 3300005333 Bacteria 575
45 Ga0070680_100322697 3300005336 Bacteria 1311
46 Ga0068868_100138013 3300005338 Bacteria 2000
47 Ga0068868_100202305 3300005338 Bacteria 1656
48 Ga0070660_100204846 3300005339 Bacteria 1601
49 Ga0070660_101178811 3300005339 Bacteria 649
50 Ga0070689_100043125 3300005340 Bacteria 3466
51 Ga0070687_100087222 3300005343 Bacteria 1717
52 Ga0070661_100007232 3300005344 Bacteria 7655
53 Ga0070661_100484051 3300005344 Bacteria 989
54 Ga0070668_100685515 3300005347 Bacteria 903
55 Ga0070675_100015954 3300005354 Bacteria 5951
56 Ga0070675_100245009 3300005354 Bacteria 1567
57 Ga0070671_100022688 3300005355 Bacteria 5127
58 Ga0070671_100064695 3300005355 Bacteria 3045
59 Ga0070674_100104288 3300005356 Bacteria 2072
60 Ga0070673_100095399 3300005364 Bacteria 2440
61 Ga0070673_100113888 3300005364 Bacteria 2246
62 Ga0070673_100617843 3300005364 Bacteria 990
63 Ga0070688_100030651 3300005365 Bacteria 3229
64 Ga0070659_100332415 3300005366 Bacteria 1272
65 Ga0070659_100585424 3300005366 Bacteria 958
66 Ga0070659_100834972 3300005366 Unclassified 802
67 Ga0070667_100192984 3300005367 Bacteria 1805
68 Ga0070667_100295043 3300005367 Bacteria 1459
69 Ga0070667_100451546 3300005367 Bacteria 1175
70 Ga0070714_100285584 3300005435 Unclassified 1534
71 Ga0070701_10177234 3300005438 Bacteria 1245
72 Ga0070701_10648041 3300005438 Bacteria 705
73 Ga0070663_100260594 3300005455 Bacteria 1375
74 Ga0070678_100215647 3300005456 Bacteria 1593
75 Ga0070662_101997376 3300005457 Bacteria 501
76 Ga0070681_10030822 3300005458 Bacteria 5383
77 Ga0068867_100026308 3300005459 Bacteria 4177
78 Ga0070685_10039883 3300005466 Bacteria 2670
79 Ga0070685_10107274 3300005466 Bacteria 1715
80 Ga0070684_100091803 3300005535 Bacteria 2702
81 Ga0068853_100001206 3300005539 Bacteria 18434
82 Ga0068853_100393990 3300005539 Bacteria 1295
83 Ga0068853_100814644 3300005539 Bacteria 894
84 Ga0068853_101472219 3300005539 Bacteria 659
85 Ga0070672_100005493 3300005543 Bacteria 8405
86 Ga0070672_100072046 3300005543 Bacteria 2751
87 Ga0070672_100085754 3300005543 Bacteria 2531
88 Ga0070686_100110906 3300005544 Bacteria 1869
89 Ga0070686_101003793 3300005544 Bacteria 685
90 Ga0070665_100005179 3300005548 Bacteria 13491
91 Ga0068855_100009974 3300005563 Bacteria 11447
92 Ga0068855_101302840 3300005563 Bacteria 752
93 Ga0070664_100115545 3300005564 Bacteria 2346
94 Ga0070664_100638628 3300005564 Bacteria 989
95 Ga0070664_100669514 3300005564 Unclassified 965
96 Ga0068857_100117796 3300005577 Bacteria 2390
97 Ga0068857_100607124 3300005577 Bacteria 1034
98 Ga0068854_100263838 3300005578 Bacteria 1380
99 Ga0068856_100001530 3300005614 Bacteria 24235
100 Ga0070702_101146818 3300005615 Bacteria 624
101 Ga0068852_100049899 3300005616 Bacteria 3582
102 Ga0068852_100126958 3300005616 Bacteria 2344
103 Ga0068852_100451959 3300005616 Unclassified 1272
104 Ga0068852_100534886 3300005616 Bacteria 1171
105 Ga0068859_100013571 3300005617 Bacteria 8168
106 Ga0068859_101668996 3300005617 Bacteria 704
107 Ga0068864_100047076 3300005618 Bacteria 3702
108 Ga0068864_100881322 3300005618 Bacteria 883
109 Ga0068864_102339984 3300005618 Unclassified 541
110 Ga0068870_10356080 3300005840 Bacteria 940
111 Ga0068863_100016749 3300005841 Bacteria 7032
112 Ga0068863_100107217 3300005841 Bacteria 2658
113 Ga0070716_100926753 3300006173 Bacteria 684
114 Ga0075366_10144310 3300006195 Bacteria 1440
115 Ga0068871_100364627 3300006358 Bacteria 1280
116 Ga0068865_100068949 3300006881 Bacteria 2501
117 Ga0068865_100100162 3300006881 Bacteria 2120
118 Ga0097620_100013571 3300006931 Bacteria 8168
119 Ga0097620_101668841 3300006931 Bacteria 704
120 Ga0105240_10079395 3300009093 Bacteria 4037
121 Ga0105240_10542043 3300009093 Bacteria 1288
122 Ga0111539_10041440 3300009094 Bacteria 5536
123 Ga0105245_10943334 3300009098 Bacteria 906
124 Ga0105245_10987237 3300009098 Bacteria 886
125 Ga0105241_10200849 3300009174 Bacteria 1665
126 Ga0105241_11067032 3300009174 Bacteria 759
127 Ga0105242_11057959 3300009176 Unclassified 823
128 Ga0105248_11558179 3300009177 Bacteria 748
129 Ga0105237_10011240 3300009545 Bacteria 9477
130 Ga0105238_10003013 3300009551 Bacteria 16817
131 Ga0105238_10495077 3300009551 Bacteria 1222
132 Ga0105238_11485133 3300009551 Unclassified 706
133 Ga0105238_12149742 3300009551 Bacteria 593
134 Ga0105249_10141476 3300009553 Bacteria 2308
135 Ga0105239_10023801 3300010375 Bacteria 6744
136 Ga0105239_10024845 3300010375 Bacteria 6601
137 Ga0105239_10579978 3300010375 Bacteria 1278
138 Ga0105239_11914159 3300010375 Bacteria 688
139 Ga0105246_10757018 3300011119 Bacteria 857
140 Ga0157337_1003007 3300012483 Bacteria 994
141 Ga0157327_1000494 3300012512 Bacteria 2131
142 Ga0157371_10027818 3300013102 Bacteria 4098
143 Ga0157370_10102009 3300013104 Bacteria 2687
144 Ga0157369_10000514 3300013105 Bacteria 50871
145 Ga0157369_10264636 3300013105 Bacteria 1793
146 Ga0157369_10587321 3300013105 Bacteria 1150
147 Ga0157374_11329480 3300013296 Unclassified 741
148 Ga0163162_10030868 3300013306 Bacteria 5311
149 Ga0163162_10108506 3300013306 Bacteria 2872
150 Ga0163162_10393790 3300013306 Bacteria 1518
151 Ga0163162_10466678 3300013306 Bacteria 1394
152 Ga0157372_10000344 3300013307 Bacteria 51217
153 Ga0157372_10006720 3300013307 Bacteria 12232
154 Ga0157372_10212250 3300013307 Bacteria 2243
155 Ga0157375_10006592 3300013308 Bacteria 10103
156 Ga0157375_10081869 3300013308 Bacteria 3269
157 Ga0157375_10104813 3300013308 Bacteria 2917
158 Ga0157375_10185853 3300013308 Bacteria 2231
159 Ga0157375_10921335 3300013308 Unclassified 1017
160 Ga0163163_11807754 3300014325 Bacteria 671
161 Ga0163163_11893473 3300014325 Bacteria 656
162 Ga0182008_10319152 3300014497 Bacteria 817
163 Ga0157379_10825463 3300014968 Bacteria 876
164 Ga0157379_10986476 3300014968 Bacteria 803
165 Ga0182007_10140902 3300015262 Bacteria 816
166 Ga0183369_1009 3300015685 Bacteria 346348
167 Ga0163161_10013473 3300017792 Bacteria 5692
168 Ga0163161_10566798 3300017792 Unclassified 932
169 Ga0213872_10001230 3300021361 Bacteria 17309
170 Ga0213872_10004369 3300021361 Bacteria 7526
171 Ga0213872_10026328 3300021361 Bacteria 2671
172 Ga0213872_10034139 3300021361 Bacteria 2329
173 Ga0213872_10044347 3300021361 Bacteria 2024
174 Ga0213872_10108268 3300021361 Bacteria 1235
175 Ga0213872_10206835 3300021361 Bacteria 839
176 Ga0209435_102126 3300025206 Bacteria 2365
177 Ga0209760_100597 3300025207 Bacteria 6294
178 Ga0209784_100016 3300025224 Bacteria 481036
179 Ga0209674_100007 3300025226 Bacteria 1077082
180 Ga0209674_100062 3300025226 Bacteria 276316
181 Ga0209674_100816 3300025226 Bacteria 10389
182 Ga0209672_100074 3300025228 Bacteria 159792
183 Ga0209672_100434 3300025228 Bacteria 24040
184 Ga0209672_101257 3300025228 Bacteria 10098
185 Ga0209563_100033 3300025230 Bacteria 457883
186 Ga0207427_100019 3300025231 Bacteria 513977
187 Ga0207427_100539 3300025231 Bacteria 19697
188 Ga0209437_100054 3300025233 Bacteria 366715
189 Ga0209437_100228 3300025233 Bacteria 98265
190 Ga0209258_100004 3300025242 Bacteria 1376422
191 Ga0209258_100008 3300025242 Bacteria 1009355
192 Ga0209258_100039 3300025242 Bacteria 386366
193 Ga0209258_100444 3300025242 Bacteria 46475
194 Ga0209258_101605 3300025242 Bacteria 7404
195 Ga0209646_1000126 3300025246 Bacteria 132815
196 Ga0209646_1000217 3300025246 Bacteria 62494
197 Ga0209026_1000012 3300025250 Bacteria 480426
198 Ga0209026_1000074 3300025250 Bacteria 203820
199 Ga0209677_100082 3300025253 Bacteria 118875
200 Ga0209677_101073 3300025253 Bacteria 12920
201 Ga0209148_1000001 3300025254 Bacteria 2545271
202 Ga0209148_1000005 3300025254 Bacteria 1806504
203 Ga0209148_1000041 3300025254 Bacteria 469323
204 Ga0209148_1000087 3300025254 Bacteria 260905
205 Ga0209759_1000110 3300025256 Bacteria 144917
206 Ga0209759_1000446 3300025256 Bacteria 47871
207 Ga0209759_1001704 3300025256 Bacteria 11392
208 Ga0209233_1000002 3300025261 Bacteria 2501366
209 Ga0209233_1004545 3300025261 Bacteria 4702
210 Ga0209233_1011135 3300025261 Bacteria 2660
211 Ga0209455_1000007 3300025272 Bacteria 1157983
212 Ga0209455_1000039 3300025272 Bacteria 437734
213 Ga0209455_1005548 3300025272 Unclassified 3876
214 Ga0209673_1086933 3300025273 Bacteria 702
215 Ga0209051_1001604 3300025303 Bacteria 18452
216 Ga0207688_10233652 3300025901 Bacteria 1110
217 Ga0207680_10179505 3300025903 Bacteria 1431
218 Ga0207647_10032410 3300025904 Bacteria 3357
219 Ga0207647_10341726 3300025904 Bacteria 848
220 Ga0207643_10005894 3300025908 Bacteria 6545
221 Ga0207705_10130877 3300025909 Bacteria 1867
222 Ga0207705_10954919 3300025909 Unclassified 663
223 Ga0207707_10026137 3300025912 Bacteria 5105
224 Ga0207695_10001684 3300025913 Bacteria 35536
225 Ga0207671_10002181 3300025914 Bacteria 21248
226 Ga0207671_10017813 3300025914 Bacteria 5465
227 Ga0207671_10038790 3300025914 Bacteria 3530
228 Ga0207671_10522461 3300025914 Bacteria 946
229 Ga0207660_10239136 3300025917 Bacteria 1430
230 Ga0207660_10297731 3300025917 Bacteria 1284
231 Ga0207662_10005603 3300025918 Bacteria 6714
232 Ga0207657_10026496 3300025919 Bacteria 5326
233 Ga0207649_10005411 3300025920 Bacteria 6914
234 Ga0207649_10461678 3300025920 Bacteria 960
235 Ga0207649_10587498 3300025920 Bacteria 855
236 Ga0207681_10030030 3300025923 Bacteria 3539
237 Ga0207694_10006173 3300025924 Bacteria 9158
238 Ga0207650_10554599 3300025925 Bacteria 964
239 Ga0207650_10659611 3300025925 Bacteria 882
240 Ga0207659_10025394 3300025926 Bacteria 3980
241 Ga0207659_10416595 3300025926 Bacteria 1126
242 Ga0207659_10462044 3300025926 Unclassified 1070
243 Ga0207687_11061739 3300025927 Bacteria 695
244 Ga0207664_10430787 3300025929 Unclassified 1176
245 Ga0207644_10023052 3300025931 Bacteria 4259
246 Ga0207690_10290684 3300025932 Bacteria 1276
247 Ga0207706_10036941 3300025933 Bacteria 4338
248 Ga0207670_10128660 3300025936 Bacteria 1851
249 Ga0207670_11154000 3300025936 Bacteria 655
250 Ga0207669_10077833 3300025937 Bacteria 2111
251 Ga0207704_10076640 3300025938 Bacteria 2143
252 Ga0207665_10196749 3300025939 Bacteria 1467
253 Ga0207691_10000184 3300025940 Bacteria 59044
254 Ga0207691_10026643 3300025940 Bacteria 5423
255 Ga0207691_10035130 3300025940 Bacteria 4657
256 Ga0207711_10453834 3300025941 Bacteria 1193
257 Ga0207689_10840902 3300025942 Bacteria 775
258 Ga0207661_10010212 3300025944 Bacteria 6751
259 Ga0207661_10423861 3300025944 Bacteria 1209
260 Ga0207667_10056551 3300025949 Bacteria 4121
261 Ga0207667_10060570 3300025949 Bacteria 3962
262 Ga0207667_10708156 3300025949 Bacteria 1009
263 Ga0207651_10061221 3300025960 Bacteria 2617
264 Ga0207651_10613147 3300025960 Bacteria 952
265 Ga0207712_10104529 3300025961 Bacteria 2112
266 Ga0207712_10111834 3300025961 Bacteria 2050
267 Ga0207712_11307170 3300025961 Bacteria 648
268 Ga0207668_10357400 3300025972 Bacteria 1223
269 Ga0207640_10078894 3300025981 Bacteria 2242
270 Ga0207658_10078212 3300025986 Bacteria 2527
271 Ga0207658_10229347 3300025986 Bacteria 1567
272 Ga0207658_10425562 3300025986 Bacteria 1172
273 Ga0207677_10164321 3300026023 Bacteria 1728
274 Ga0207677_10252616 3300026023 Bacteria 1433
275 Ga0207703_10197249 3300026035 Bacteria 1787
276 Ga0207703_10703106 3300026035 Bacteria 961
277 Ga0207639_10000195 3300026041 Bacteria 46499
278 Ga0207639_10000643 3300026041 Bacteria 24069
279 Ga0207678_10267288 3300026067 Bacteria 1466
280 Ga0207702_10001070 3300026078 Bacteria 28050
281 Ga0207702_10022642 3300026078 Bacteria 5211
282 Ga0207641_10015458 3300026088 Bacteria 6253
283 Ga0207641_10223965 3300026088 Bacteria 1745
284 Ga0207641_10817313 3300026088 Bacteria 923
285 Ga0207648_10019716 3300026089 Bacteria 6086
286 Ga0207676_10206371 3300026095 Bacteria 1740
287 Ga0207676_12264875 3300026095 Unclassified 541
288 Ga0207674_10093623 3300026116 Bacteria 2993
289 Ga0207674_10630244 3300026116 Bacteria 1035
290 Ga0207675_100191010 3300026118 Bacteria 1964
291 Ga0207683_10338233 3300026121 Bacteria 1380
292 Ga0207698_10097180 3300026142 Bacteria 2430
293 Ga0207698_10292887 3300026142 Bacteria 1511
294 Ga0207698_10314457 3300026142 Bacteria 1464
295 Ga0207698_10402515 3300026142 Bacteria 1308
296 Ga0209973_1011891 3300027252 Bacteria 1051
297 Ga0209967_1068277 3300027364 Bacteria 554
298 Ga0209984_1041506 3300027424 Bacteria 663
299 Ga0210000_1006903 3300027462 Bacteria 1657
300 Ga0209995_1003393 3300027471 Bacteria 2538
301 Ga0209999_1002616 3300027543 Bacteria 3187
302 Ga0209982_1001184 3300027552 Bacteria 3512
303 Ga0209983_1002718 3300027665 Bacteria 3841
304 Ga0209971_1001510 3300027682 Bacteria 5767
305 Ga0209974_10003384 3300027876 Bacteria 5764
306 Ga0268266_10072496 3300028379 Bacteria 2987
307 Ga0268266_11206306 3300028379 Bacteria 732
308 Ga0268265_10809389 3300028380 Bacteria 914
309 Ga0268264_10625926 3300028381 Bacteria 1063
310 Ga0265324_10032753 3300029957 Bacteria 1815
311 Ga0265331_10022159 3300031250 Bacteria 3244
312 Ga0265314_10019866 3300031711 Bacteria 5195
313 Ga0307516_10106872 3300031730 Bacteria 2608
314 Ga0307405_11541298 3300031731 Bacteria 585
315 Ga0307405_11751587 3300031731 Bacteria 551
316 Ga0307413_10797769 3300031824 Bacteria 793
317 Ga0307409_100087296 3300031995 Bacteria 2542
318 Ga0373934_0039857 3300035086 Bacteria 1852
319 Ga0395899_0000309 3300037312 Bacteria 62448
320 Ga0395900_0000421 3300037418 Bacteria 61155
321 Ga0395898_0000305 3300037466 Bacteria 116565
322 Ga0436360_1082863 3300039438 Bacteria 1527
323 Ga0436361_0118686 3300039447 Bacteria 25986
324 Ga0436361_0314191 3300039447 Bacteria 9995
325 Ga0436361_0473037 3300039447 Bacteria 1023
326 Ga0436361_0525683 3300039447 Bacteria 3344
327 Ga0436361_0581378 3300039447 Bacteria 1837
328 Ga0436361_0667284 3300039447 Bacteria 765
329 Ga0436361_0865106 3300039447 Bacteria 2911
330 Ga0451787_399029 3300041441 Bacteria 1112
331 Ga0451791_1114079 3300041451 Bacteria 2251
332 Ga0451793_0224573 3300041452 Bacteria 4769
333 Ga0451802_0464216 3300041460 Bacteria 6240
334 Ga0451804_0716375 3300041463 Bacteria 788
335 Ga0451807_1810545 3300041486 Bacteria 3359
336 Ga0451833_0955805 3300041491 Bacteria 2235
337 Ga0451849_0738510 3300041505 Bacteria 2723
338 Ga0451851_0871764 3300041507 Bacteria 667
339 Ga0451853_0089750 3300041512 Unclassified 900
340 Ga0439431_0202589 3300041997 Bacteria 579
341 Ga0466966_0027099 3300044684 Unclassified 3737
342 Ga0466966_0097107 3300044684 Bacteria 1824
343 Ga0466966_0146215 3300044684 Unclassified 1443
344 Ga0466961_0002955 3300044693 Bacteria 10559
345 Ga0466961_0020820 3300044693 Bacteria 4221
346 Ga0466964_0797902 3300044706 Unclassified 533
347 Ga0466970_0002407 3300044765 Bacteria 9039
348 Ga0466970_0008580 3300044765 Bacteria 5146
349 Ga0466970_0619218 3300044765 Bacteria 629
350 Ga0466957_0000516 3300044842 Bacteria 19357
351 Ga0466957_0246704 3300044842 Bacteria 1186
352 Ga0466959_0007966 3300045049 Bacteria 7463
353 Ga0466959_0008082 3300045049 Bacteria 7418
354 Ga0466959_0028287 3300045049 Bacteria 4156
355 Ga0466958_0046059 3300045836 Bacteria 2632
356 Ga0466958_0905857 3300045836 Unclassified 575
357 Ga0495590_0000014 3300046457 Bacteria 258314
358 Ga0495638_0000133 3300046460 Bacteria 119393
359 Ga0495650_0000105 3300046471 Bacteria 205855
360 Ga0495650_0018860 3300046471 Bacteria 3416
361 Ga0495639_0014500 3300046475 Bacteria 3413
362 Ga0495607_0000360 3300046501 Bacteria 47044
363 Ga0495583_0000044 3300046506 Bacteria 226264
364 Ga0495606_0000476 3300046507 Bacteria 65896
365 Ga0495606_0002401 3300046507 Bacteria 21883
366 Ga0495643_0000139 3300046522 Bacteria 117261
367 Ga0495648_0000006 3300046524 Bacteria 361208
368 Ga0495648_0407420 3300046524 Bacteria 606
369 Ga0495663_0009089 3300046525 Bacteria 2753
370 Ga0495642_0002130 3300046528 Bacteria 8167
371 Ga0495609_0010179 3300046538 Bacteria 4521
372 Ga0495597_0000120 3300046542 Bacteria 70808
373 Ga0495622_0000032 3300046557 Bacteria 125538
374 Ga0495622_0000136 3300046557 Bacteria 62960
375 Ga0495633_0000509 3300046558 Bacteria 39153
376 Ga0495668_0000527 3300046616 Bacteria 47676
377 Ga0495625_0000220 3300046660 Bacteria 90406
378 Ga0495670_0081891 3300046691 Bacteria 1645
379 Ga0495660_0013539 3300046810 Bacteria 4726
380 Ga0495636_0025867 3300047318 Bacteria 2385
381 Ga0495687_000885 3300047443 Bacteria 31640
382 Ga0495687_000887 3300047443 Bacteria 31523
383 Ga0495677_0008514 3300047445 Bacteria 3808
384 Ga0495677_0297044 3300047445 Bacteria 635
385 Ga0495685_031377 3300047447 Bacteria 1827
386 Ga0495686_0000238 3300047472 Bacteria 99919
387 Ga0495602_0573835 3300048088 Unclassified 779
388 Ga0496101_0097859 3300048904 Bacteria 2192
389 Ga0496102_0129725 3300048905 Bacteria 2359
390 Ga0496106_1013690 3300048909 Bacteria 653
391 Ga0496107_0050164 3300048910 Bacteria 3008
392 Ga0496107_0656642 3300048910 Bacteria 773
393 Ga0496108_0105639 3300048911 Bacteria 2404
394 Ga0496109_0007886 3300048912 Bacteria 9023
395 Ga0496109_0119711 3300048912 Bacteria 2452
396 Ga0496110_0027068 3300048913 Bacteria 4912
397 Ga0496111_0008929 3300048914 Bacteria 6665
398 Ga0496112_0832317 3300048915 Bacteria 847
399 Ga0496113_0023312 3300048916 Bacteria 4389
400 Ga0496115_0000116 3300048918 Bacteria 73024
401 Ga0496124_0390402 3300048927 Bacteria 970
402 Ga0495678_007441 3300049459 Bacteria 5671
403 Ga0495678_016711 3300049459 Bacteria 3345
404 Ga0501031_0328214 3300049568 Bacteria 991
405 Ga0501034_0582999 3300049571 Bacteria 1025
406 Ga0501037_0167780 3300049573 Bacteria 1562
407 Ga0501043_1259721 3300049579 Bacteria 517
408 Ga0501046_0543108 3300049580 Bacteria 829
409 Ga0501069_0056765 3300049585 Bacteria 2182
410 Ga0501070_0042300 3300049586 Bacteria 3794
411 Ga0501073_0129474 3300049589 Bacteria 1749
412 Ga0501074_0016498 3300049590 Bacteria 5360
413 Ga0501080_0035846 3300049742 Bacteria 4630
414 Ga0501266_077273 3300049763 Bacteria 559
415 Ga0501035_0003620 3300049822 Bacteria 14737
416 Ga0501035_0061259 3300049822 Bacteria 3349
417 Ga0501044_0051377 3300049823 Bacteria 4250
418 Ga0500635_0000153 3300053080 Bacteria 38580
419 Ga0500604_0251191 3300053151 Bacteria 612
420 Ga0500616_0000138 3300053153 Bacteria 124476
421 Ga0501084_0617631 3300054114 Bacteria 916
422 Ga0466962_0052154 3300061719 Bacteria 1955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100204846 Ga0070660_1002048462 122
2 3300009551 Ga0105238_12149742 Ga0105238_121497422 122
3 3300013307 Ga0157372_10212250 Ga0157372_102122505 122
4 3300025909 Ga0207705_10130877 Ga0207705_101308771 122
5 3300025919 Ga0207657_10026496 Ga0207657_100264962 122
6 3300003371 JGI26145J50221_1033562 JGI26145J50221_10335621 123
7 3300005293 Ga0065715_10109276 Ga0065715_101092765 123
8 3300005329 Ga0070683_100075203 Ga0070683_1000752033 123
9 3300005329 Ga0070683_100433652 Ga0070683_1004336524 123
10 3300005329 Ga0070683_100710602 Ga0070683_1007106022 123
11 3300005330 Ga0070690_100157256 Ga0070690_1001572562 123
12 3300005333 Ga0070677_10687555 Ga0070677_106875551 123
13 3300005338 Ga0068868_100202305 Ga0068868_1002023052 123
14 3300005340 Ga0070689_100043125 Ga0070689_1000431255 123
15 3300005343 Ga0070687_100087222 Ga0070687_1000872222 123
16 3300005344 Ga0070661_100007232 Ga0070661_1000072322 123
17 3300005344 Ga0070661_100484051 Ga0070661_1004840512 123
18 3300005354 Ga0070675_100015954 Ga0070675_1000159546 123
19 3300005355 Ga0070671_100022688 Ga0070671_1000226883 123
20 3300005355 Ga0070671_100064695 Ga0070671_1000646951 123
21 3300005364 Ga0070673_100113888 Ga0070673_1001138882 123
22 3300005365 Ga0070688_100030651 Ga0070688_1000306512 123
23 3300005366 Ga0070659_100585424 Ga0070659_1005854241 123
24 3300005367 Ga0070667_100192984 Ga0070667_1001929842 123
25 3300005367 Ga0070667_100451546 Ga0070667_1004515462 123
26 3300005438 Ga0070701_10177234 Ga0070701_101772342 123
27 3300005438 Ga0070701_10648041 Ga0070701_106480411 123
28 3300005455 Ga0070663_100260594 Ga0070663_1002605941 123
29 3300005457 Ga0070662_101997376 Ga0070662_1019973761 123
30 3300005466 Ga0070685_10039883 Ga0070685_100398832 123
31 3300005535 Ga0070684_100091803 Ga0070684_1000918032 123
32 3300005539 Ga0068853_100001206 Ga0068853_1000012067 123
33 3300005539 Ga0068853_100814644 Ga0068853_1008146442 123
34 3300005543 Ga0070672_100005493 Ga0070672_1000054937 123
35 3300005543 Ga0070672_100072046 Ga0070672_1000720462 123
36 3300005544 Ga0070686_101003793 Ga0070686_1010037932 123
37 3300005548 Ga0070665_100005179 Ga0070665_1000051795 123
38 3300005563 Ga0068855_100009974 Ga0068855_1000099747 123
39 3300005564 Ga0070664_100115545 Ga0070664_1001155452 123
40 3300005564 Ga0070664_100669514 Ga0070664_1006695142 123
41 3300005577 Ga0068857_100117796 Ga0068857_1001177965 123
42 3300005577 Ga0068857_100607124 Ga0068857_1006071242 123
43 3300005578 Ga0068854_100263838 Ga0068854_1002638382 123
44 3300005615 Ga0070702_101146818 Ga0070702_1011468181 123
45 3300005616 Ga0068852_100049899 Ga0068852_1000498993 123
46 3300005616 Ga0068852_100451959 Ga0068852_1004519592 123
47 3300005616 Ga0068852_100534886 Ga0068852_1005348861 123
48 3300005617 Ga0068859_100013571 Ga0068859_1000135712 123
49 3300005618 Ga0068864_100881322 Ga0068864_1008813222 123
50 3300005840 Ga0068870_10356080 Ga0068870_103560802 123
51 3300005841 Ga0068863_100016749 Ga0068863_1000167496 123
52 3300006881 Ga0068865_100100162 Ga0068865_1001001621 123
53 3300006931 Ga0097620_100013571 Ga0097620_1000135717 123
54 3300009093 Ga0105240_10079395 Ga0105240_100793953 123
55 3300009094 Ga0111539_10041440 Ga0111539_100414404 123
56 3300009098 Ga0105245_10943334 Ga0105245_109433342 123
57 3300009174 Ga0105241_10200849 Ga0105241_102008492 123
58 3300009176 Ga0105242_11057959 Ga0105242_110579591 123
59 3300009545 Ga0105237_10011240 Ga0105237_100112408 123
60 3300009551 Ga0105238_10003013 Ga0105238_1000301318 123
61 3300009553 Ga0105249_10141476 Ga0105249_101414763 123
62 3300010375 Ga0105239_10024845 Ga0105239_100248455 123
63 3300011119 Ga0105246_10757018 Ga0105246_107570182 123
64 3300012483 Ga0157337_1003007 Ga0157337_10030073 123
65 3300012512 Ga0157327_1000494 Ga0157327_10004943 123
66 3300013102 Ga0157371_10027818 Ga0157371_100278188 123
67 3300013104 Ga0157370_10102009 Ga0157370_101020092 123
68 3300013105 Ga0157369_10000514 Ga0157369_100005145 123
69 3300013306 Ga0163162_10108506 Ga0163162_101085066 123
70 3300013307 Ga0157372_10006720 Ga0157372_1000672010 123
71 3300013308 Ga0157375_10006592 Ga0157375_100065922 123
72 3300013308 Ga0157375_10081869 Ga0157375_100818694 123
73 3300014325 Ga0163163_11893473 Ga0163163_118934731 123
74 3300025273 Ga0209673_1086933 Ga0209673_10869332 123
75 3300025901 Ga0207688_10233652 Ga0207688_102336522 123
76 3300025908 Ga0207643_10005894 Ga0207643_100058942 123
77 3300025913 Ga0207695_10001684 Ga0207695_1000168416 123
78 3300025914 Ga0207671_10002181 Ga0207671_1000218112 123
79 3300025914 Ga0207671_10017813 Ga0207671_100178137 123
80 3300025917 Ga0207660_10297731 Ga0207660_102977311 123
81 3300025918 Ga0207662_10005603 Ga0207662_100056037 123
82 3300025920 Ga0207649_10005411 Ga0207649_100054116 123
83 3300025920 Ga0207649_10461678 Ga0207649_104616782 123
84 3300025920 Ga0207649_10587498 Ga0207649_105874981 123
85 3300025923 Ga0207681_10030030 Ga0207681_100300301 123
86 3300025925 Ga0207650_10554599 Ga0207650_105545991 123
87 3300025925 Ga0207650_10659611 Ga0207650_106596112 123
88 3300025926 Ga0207659_10025394 Ga0207659_100253942 123
89 3300025927 Ga0207687_11061739 Ga0207687_110617392 123
90 3300025931 Ga0207644_10023052 Ga0207644_100230523 123
91 3300025933 Ga0207706_10036941 Ga0207706_100369414 123
92 3300025936 Ga0207670_10128660 Ga0207670_101286602 123
93 3300025940 Ga0207691_10000184 Ga0207691_1000018416 123
94 3300025940 Ga0207691_10026643 Ga0207691_100266432 123
95 3300025941 Ga0207711_10453834 Ga0207711_104538342 123
96 3300025944 Ga0207661_10010212 Ga0207661_100102124 123
97 3300025944 Ga0207661_10423861 Ga0207661_104238612 123
98 3300025949 Ga0207667_10056551 Ga0207667_100565515 123
99 3300025949 Ga0207667_10060570 Ga0207667_100605707 123
100 3300025960 Ga0207651_10613147 Ga0207651_106131472 123
101 3300025961 Ga0207712_10111834 Ga0207712_101118344 123
102 3300025981 Ga0207640_10078894 Ga0207640_100788942 123
103 3300025986 Ga0207658_10229347 Ga0207658_102293472 123
104 3300025986 Ga0207658_10425562 Ga0207658_104255622 123
105 3300026023 Ga0207677_10164321 Ga0207677_101643212 123
106 3300026035 Ga0207703_10703106 Ga0207703_107031061 123
107 3300026041 Ga0207639_10000195 Ga0207639_1000019537 123
108 3300026041 Ga0207639_10000643 Ga0207639_1000064326 123
109 3300026067 Ga0207678_10267288 Ga0207678_102672883 123
110 3300026078 Ga0207702_10022642 Ga0207702_100226428 123
111 3300026088 Ga0207641_10015458 Ga0207641_100154586 123
112 3300026088 Ga0207641_10817313 Ga0207641_108173132 123
113 3300026095 Ga0207676_10206371 Ga0207676_102063713 123
114 3300026116 Ga0207674_10093623 Ga0207674_100936233 123
115 3300026116 Ga0207674_10630244 Ga0207674_106302442 123
116 3300026118 Ga0207675_100191010 Ga0207675_1001910103 123
117 3300026142 Ga0207698_10292887 Ga0207698_102928872 123
118 3300026142 Ga0207698_10314457 Ga0207698_103144572 123
119 3300026142 Ga0207698_10402515 Ga0207698_104025151 123
120 3300027252 Ga0209973_1011891 Ga0209973_10118912 123
121 3300027364 Ga0209967_1068277 Ga0209967_10682771 123
122 3300027424 Ga0209984_1041506 Ga0209984_10415062 123
123 3300027462 Ga0210000_1006903 Ga0210000_10069033 123
124 3300027471 Ga0209995_1003393 Ga0209995_10033933 123
125 3300027543 Ga0209999_1002616 Ga0209999_10026164 123
126 3300027552 Ga0209982_1001184 Ga0209982_10011843 123
127 3300027665 Ga0209983_1002718 Ga0209983_10027181 123
128 3300027682 Ga0209971_1001510 Ga0209971_10015102 123
129 3300027876 Ga0209974_10003384 Ga0209974_100033845 123
130 3300028379 Ga0268266_10072496 Ga0268266_100724965 123
131 3300028380 Ga0268265_10809389 Ga0268265_108093892 123
132 3300031731 Ga0307405_11541298 Ga0307405_115412982 123
133 3300031731 Ga0307405_11751587 Ga0307405_117515871 123
134 3300031824 Ga0307413_10797769 Ga0307413_107977691 123
135 3300031995 Ga0307409_100087296 Ga0307409_1000872962 123
136 3300041441 Ga0451787_399029 Ga0451787_399029_139_519 123
137 3300041451 Ga0451791_1114079 Ga0451791_1114079_610_990 123
138 3300041452 Ga0451793_0224573 Ga0451793_0224573_4240_4620 123
139 3300041460 Ga0451802_0464216 Ga0451802_0464216_2173_2553 123
140 3300041463 Ga0451804_0716375 Ga0451804_0716375_348_728 123
141 3300041486 Ga0451807_1810545 Ga0451807_1810545_1935_2315 123
142 3300041491 Ga0451833_0955805 Ga0451833_0955805_40_420 123
143 3300041505 Ga0451849_0738510 Ga0451849_0738510_1912_2292 123
144 3300041512 Ga0451853_0089750 Ga0451853_0089750_495_875 123
145 3300041997 Ga0439431_0202589 Ga0439431_0202589_82_462 123
146 3300046525 Ga0495663_0009089 Ga0495663_0009089_270_650 123
147 3300047318 Ga0495636_0025867 Ga0495636_0025867_1567_1947 123
148 3300047445 Ga0495677_0297044 Ga0495677_0297044_118_498 123
149 3300047447 Ga0495685_031377 Ga0495685_031377_1344_1724 123
150 3300048904 Ga0496101_0097859 Ga0496101_0097859_1532_1912 123
151 3300048905 Ga0496102_0129725 Ga0496102_0129725_273_653 123
152 3300048909 Ga0496106_1013690 Ga0496106_1013690_52_432 123
153 3300048910 Ga0496107_0050164 Ga0496107_0050164_566_946 123
154 3300048911 Ga0496108_0105639 Ga0496108_0105639_37_417 123
155 3300048912 Ga0496109_0007886 Ga0496109_0007886_7627_8007 123
156 3300048913 Ga0496110_0027068 Ga0496110_0027068_4438_4818 123
157 3300048914 Ga0496111_0008929 Ga0496111_0008929_5800_6180 123
158 3300048915 Ga0496112_0832317 Ga0496112_0832317_179_559 123
159 3300048916 Ga0496113_0023312 Ga0496113_0023312_2661_3041 123
160 3300048927 Ga0496124_0390402 Ga0496124_0390402_393_773 123
161 3300049568 Ga0501031_0328214 Ga0501031_0328214_57_437 123
162 3300049571 Ga0501034_0582999 Ga0501034_0582999_360_740 123
163 3300049573 Ga0501037_0167780 Ga0501037_0167780_1159_1539 123
164 3300049579 Ga0501043_1259721 Ga0501043_1259721_42_422 123
165 3300049580 Ga0501046_0543108 Ga0501046_0543108_82_462 123
166 3300049585 Ga0501069_0056765 Ga0501069_0056765_769_1149 123
167 3300049586 Ga0501070_0042300 Ga0501070_0042300_1041_1421 123
168 3300049589 Ga0501073_0129474 Ga0501073_0129474_1332_1712 123
169 3300049590 Ga0501074_0016498 Ga0501074_0016498_1976_2356 123
170 3300049742 Ga0501080_0035846 Ga0501080_0035846_2031_2411 123
171 3300049763 Ga0501266_077273 Ga0501266_077273_109_489 123
172 3300049822 Ga0501035_0003620 Ga0501035_0003620_6346_6726 123
173 3300049822 Ga0501035_0061259 Ga0501035_0061259_434_814 123
174 3300049823 Ga0501044_0051377 Ga0501044_0051377_1229_1609 123
175 3300054114 Ga0501084_0617631 Ga0501084_0617631_332_712 123
176 3300010375 Ga0105239_10023801 Ga0105239_100238016 133
177 3300031250 Ga0265331_10022159 Ga0265331_100221592 136
178 3300041507 Ga0451851_0871764 Ga0451851_0871764_234_656 136
179 3300046522 Ga0495643_0000139 Ga0495643_0000139_92546_92971 137
180 3300046542 Ga0495597_0000120 Ga0495597_0000120_61950_62375 137
181 3300003316 rootH1_10034412 rootH1_100344128 140
182 3300003323 rootH1_10055292 rootH1_100552927 140
183 3300009551 Ga0105238_10495077 Ga0105238_104950772 141
184 3300047443 Ga0495687_000887 Ga0495687_000887_17061_17501 142
185 3300013306 Ga0163162_10393790 Ga0163162_103937902 143
186 3300014497 Ga0182008_10319152 Ga0182008_103191521 143
187 3300015262 Ga0182007_10140902 Ga0182007_101409022 143
188 3300046810 Ga0495660_0013539 Ga0495660_0013539_94_540 144
189 3300047445 Ga0495677_0008514 Ga0495677_0008514_2778_3224 144
190 3300046501 Ga0495607_0000360 Ga0495607_0000360_39081_39530 145
191 3300046507 Ga0495606_0000476 Ga0495606_0000476_19829_20278 145
192 3300002067 JGI24735J21928_10007882 JGI24735J21928_100078824 146
193 3300002067 JGI24735J21928_10016330 JGI24735J21928_100163303 146
194 3300005327 Ga0070658_10321742 Ga0070658_103217422 146
195 3300014968 Ga0157379_10825463 Ga0157379_108254632 146
196 3300025909 Ga0207705_10954919 Ga0207705_109549191 146
197 3300025924 Ga0207694_10006173 Ga0207694_100061737 146
198 3300048910 Ga0496107_0656642 Ga0496107_0656642_35_487 146
199 3300048912 Ga0496109_0119711 Ga0496109_0119711_958_1410 146
200 3300003320 rootH2_10037622 rootH2_100376227 147
201 3300047472 Ga0495686_0000238 Ga0495686_0000238_87739_88227 147
202 3300021361 Ga0213872_10001230 Ga0213872_1000123011 148
203 3300021361 Ga0213872_10004369 Ga0213872_100043691 148
204 3300021361 Ga0213872_10026328 Ga0213872_100263283 148
205 3300021361 Ga0213872_10034139 Ga0213872_100341394 148
206 3300021361 Ga0213872_10044347 Ga0213872_100443473 148
207 3300025246 Ga0209646_1000126 Ga0209646_100012633 148
208 3300025261 Ga0209233_1004545 Ga0209233_10045453 148
209 3300039438 Ga0436360_1082863 Ga0436360_1082863_1021_1485 148
210 3300039447 Ga0436361_0118686 Ga0436361_0118686_22293_22757 148
211 3300039447 Ga0436361_0314191 Ga0436361_0314191_397_861 148
212 3300039447 Ga0436361_0473037 Ga0436361_0473037_358_822 148
213 3300039447 Ga0436361_0525683 Ga0436361_0525683_2379_2843 148
214 3300039447 Ga0436361_0581378 Ga0436361_0581378_1008_1472 148
215 3300039447 Ga0436361_0667284 Ga0436361_0667284_287_751 148
216 3300039447 Ga0436361_0865106 Ga0436361_0865106_311_775 148
217 3300005339 Ga0070660_101178811 Ga0070660_1011788111 149
218 3300005366 Ga0070659_100332415 Ga0070659_1003324152 149
219 3300005539 Ga0068853_100393990 Ga0068853_1003939901 149
220 3300005563 Ga0068855_101302840 Ga0068855_1013028401 149
221 3300006195 Ga0075366_10144310 Ga0075366_101443101 149
222 3300009098 Ga0105245_10987237 Ga0105245_109872372 149
223 3300009177 Ga0105248_11558179 Ga0105248_115581791 149
224 3300013306 Ga0163162_10466678 Ga0163162_104666783 149
225 3300025926 Ga0207659_10416595 Ga0207659_104165952 149
226 3300025932 Ga0207690_10290684 Ga0207690_102906842 149
227 3300025936 Ga0207670_11154000 Ga0207670_111540001 149
228 3300025942 Ga0207689_10840902 Ga0207689_108409021 149
229 3300029957 Ga0265324_10032753 Ga0265324_100327532 149
230 3300031711 Ga0265314_10019866 Ga0265314_100198663 149
231 3300031730 Ga0307516_10106872 Ga0307516_101068722 149
232 3300046457 Ga0495590_0000014 Ga0495590_0000014_51777_52238 149
233 3300046460 Ga0495638_0000133 Ga0495638_0000133_92889_93350 149
234 3300046471 Ga0495650_0000105 Ga0495650_0000105_67162_67629 149
235 3300046471 Ga0495650_0018860 Ga0495650_0018860_2871_3332 149
236 3300046475 Ga0495639_0014500 Ga0495639_0014500_2226_2687 149
237 3300046506 Ga0495583_0000044 Ga0495583_0000044_90362_90823 149
238 3300046507 Ga0495606_0002401 Ga0495606_0002401_6489_6959 149
239 3300046524 Ga0495648_0000006 Ga0495648_0000006_159782_160243 149
240 3300046528 Ga0495642_0002130 Ga0495642_0002130_822_1283 149
241 3300046538 Ga0495609_0010179 Ga0495609_0010179_1935_2396 149
242 3300046557 Ga0495622_0000136 Ga0495622_0000136_42222_42683 149
243 3300046558 Ga0495633_0000509 Ga0495633_0000509_25553_26014 149
244 3300046616 Ga0495668_0000527 Ga0495668_0000527_43957_44418 149
245 3300046660 Ga0495625_0000220 Ga0495625_0000220_59952_60413 149
246 3300046691 Ga0495670_0081891 Ga0495670_0081891_718_1179 149
247 3300047443 Ga0495687_000885 Ga0495687_000885_14140_14601 149
248 3300049459 Ga0495678_007441 Ga0495678_007441_3451_3912 149
249 3300049459 Ga0495678_016711 Ga0495678_016711_2219_2680 149
250 3300002067 JGI24735J21928_10001077 JGI24735J21928_100010772 150
251 3300002705 JGI25156J39149_1010850 JGI25156J39149_10108503 150
252 3300002737 JGI25162J39368_1000028 JGI25162J39368_100002867 150
253 3300002737 JGI25162J39368_1000619 JGI25162J39368_10006194 150
254 3300002738 JGI25154J39366_1009736 JGI25154J39366_10097362 150
255 3300002741 JGI25157J39369_1000042 JGI25157J39369_100004268 150
256 3300002741 JGI25157J39369_1000364 JGI25157J39369_100036424 150
257 3300002771 JGI25163J39215_1000113 JGI25163J39215_100011331 150
258 3300002772 JGI25164J39214_1000012 JGI25164J39214_100001284 150
259 3300002772 JGI25164J39214_1006689 JGI25164J39214_10066892 150
260 3300003214 JGI25165J46597_1000048 JGI25165J46597_1000048165 150
261 3300003316 rootH1_10023224 rootH1_100232247 150
262 3300003751 Ga0055538_1000299 Ga0055538_100029921 150
263 3300003752 Ga0055539_1000210 Ga0055539_100021020 150
264 3300003752 Ga0055539_1005884 Ga0055539_10058841 150
265 3300003756 Ga0055533_1000028 Ga0055533_1000028165 150
266 3300003756 Ga0055533_1000057 Ga0055533_100005720 150
267 3300003756 Ga0055533_1008944 Ga0055533_10089442 150
268 3300003759 Ga0055525_1000851 Ga0055525_10008516 150
269 3300003760 Ga0055527_1000037 Ga0055527_100003715 150
270 3300003761 Ga0055535_1000027 Ga0055535_1000027153 150
271 3300003761 Ga0055535_1000059 Ga0055535_100005915 150
272 3300003762 Ga0055542_1000034 Ga0055542_100003467 150
273 3300003762 Ga0055542_1000086 Ga0055542_100008681 150
274 3300003762 Ga0055542_1000223 Ga0055542_100022355 150
275 3300003762 Ga0055542_1000375 Ga0055542_100037513 150
276 3300003763 Ga0055529_1000056 Ga0055529_100005632 150
277 3300003763 Ga0055529_1000231 Ga0055529_100023139 150
278 3300005328 Ga0070676_10694900 Ga0070676_106949001 150
279 3300005330 Ga0070690_100127722 Ga0070690_1001277222 150
280 3300005336 Ga0070680_100322697 Ga0070680_1003226972 150
281 3300005338 Ga0068868_100138013 Ga0068868_1001380132 150
282 3300005347 Ga0070668_100685515 Ga0070668_1006855151 150
283 3300005354 Ga0070675_100245009 Ga0070675_1002450092 150
284 3300005356 Ga0070674_100104288 Ga0070674_1001042883 150
285 3300005364 Ga0070673_100095399 Ga0070673_1000953994 150
286 3300005364 Ga0070673_100617843 Ga0070673_1006178432 150
287 3300005366 Ga0070659_100834972 Ga0070659_1008349722 150
288 3300005367 Ga0070667_100295043 Ga0070667_1002950432 150
289 3300005435 Ga0070714_100285584 Ga0070714_1002855842 150
290 3300005456 Ga0070678_100215647 Ga0070678_1002156472 150
291 3300005458 Ga0070681_10030822 Ga0070681_100308223 150
292 3300005459 Ga0068867_100026308 Ga0068867_1000263084 150
293 3300005466 Ga0070685_10107274 Ga0070685_101072742 150
294 3300005539 Ga0068853_101472219 Ga0068853_1014722191 150
295 3300005543 Ga0070672_100085754 Ga0070672_1000857544 150
296 3300005544 Ga0070686_100110906 Ga0070686_1001109062 150
297 3300005564 Ga0070664_100638628 Ga0070664_1006386281 150
298 3300005614 Ga0068856_100001530 Ga0068856_10000153018 150
299 3300005616 Ga0068852_100126958 Ga0068852_1001269582 150
300 3300005617 Ga0068859_101668996 Ga0068859_1016689962 150
301 3300005618 Ga0068864_100047076 Ga0068864_1000470762 150
302 3300005618 Ga0068864_102339984 Ga0068864_1023399841 150
303 3300005841 Ga0068863_100107217 Ga0068863_1001072174 150
304 3300006173 Ga0070716_100926753 Ga0070716_1009267531 150
305 3300006358 Ga0068871_100364627 Ga0068871_1003646271 150
306 3300006881 Ga0068865_100068949 Ga0068865_1000689493 150
307 3300006931 Ga0097620_101668841 Ga0097620_1016688412 150
308 3300009093 Ga0105240_10542043 Ga0105240_105420432 150
309 3300009174 Ga0105241_11067032 Ga0105241_110670321 150
310 3300009551 Ga0105238_11485133 Ga0105238_114851331 150
311 3300010375 Ga0105239_10579978 Ga0105239_105799781 150
312 3300010375 Ga0105239_11914159 Ga0105239_119141591 150
313 3300013105 Ga0157369_10264636 Ga0157369_102646362 150
314 3300013105 Ga0157369_10587321 Ga0157369_105873212 150
315 3300013296 Ga0157374_11329480 Ga0157374_113294801 150
316 3300013306 Ga0163162_10030868 Ga0163162_100308687 150
317 3300013307 Ga0157372_10000344 Ga0157372_100003448 150
318 3300013308 Ga0157375_10104813 Ga0157375_101048133 150
319 3300013308 Ga0157375_10185853 Ga0157375_101858532 150
320 3300013308 Ga0157375_10921335 Ga0157375_109213352 150
321 3300014325 Ga0163163_11807754 Ga0163163_118077541 150
322 3300014968 Ga0157379_10986476 Ga0157379_109864762 150
323 3300015685 Ga0183369_1009 Ga0183369_1009141 150
324 3300017792 Ga0163161_10013473 Ga0163161_100134733 150
325 3300017792 Ga0163161_10566798 Ga0163161_105667981 150
326 3300021361 Ga0213872_10108268 Ga0213872_101082682 150
327 3300021361 Ga0213872_10206835 Ga0213872_102068352 150
328 3300025206 Ga0209435_102126 Ga0209435_1021261 150
329 3300025207 Ga0209760_100597 Ga0209760_1005972 150
330 3300025224 Ga0209784_100016 Ga0209784_100016164 150
331 3300025226 Ga0209674_100007 Ga0209674_100007879 150
332 3300025226 Ga0209674_100062 Ga0209674_100062245 150
333 3300025226 Ga0209674_100816 Ga0209674_1008167 150
334 3300025228 Ga0209672_100074 Ga0209672_10007479 150
335 3300025228 Ga0209672_100434 Ga0209672_10043412 150
336 3300025228 Ga0209672_101257 Ga0209672_1012576 150
337 3300025230 Ga0209563_100033 Ga0209563_100033162 150
338 3300025231 Ga0207427_100019 Ga0207427_100019249 150
339 3300025231 Ga0207427_100539 Ga0207427_1005399 150
340 3300025233 Ga0209437_100054 Ga0209437_100054262 150
341 3300025233 Ga0209437_100228 Ga0209437_10022843 150
342 3300025242 Ga0209258_100004 Ga0209258_1000041219 150
343 3300025242 Ga0209258_100008 Ga0209258_100008844 150
344 3300025242 Ga0209258_100039 Ga0209258_100039167 150
345 3300025242 Ga0209258_100444 Ga0209258_10044427 150
346 3300025242 Ga0209258_101605 Ga0209258_1016057 150
347 3300025246 Ga0209646_1000217 Ga0209646_100021725 150
348 3300025250 Ga0209026_1000012 Ga0209026_1000012321 150
349 3300025250 Ga0209026_1000074 Ga0209026_1000074113 150
350 3300025253 Ga0209677_100082 Ga0209677_10008227 150
351 3300025253 Ga0209677_101073 Ga0209677_1010739 150
352 3300025254 Ga0209148_1000001 Ga0209148_10000011434 150
353 3300025254 Ga0209148_1000005 Ga0209148_1000005846 150
354 3300025254 Ga0209148_1000041 Ga0209148_1000041346 150
355 3300025254 Ga0209148_1000087 Ga0209148_100008714 150
356 3300025256 Ga0209759_1000110 Ga0209759_1000110113 150
357 3300025256 Ga0209759_1000446 Ga0209759_100044624 150
358 3300025256 Ga0209759_1001704 Ga0209759_100170410 150
359 3300025261 Ga0209233_1000002 Ga0209233_1000002796 150
360 3300025261 Ga0209233_1011135 Ga0209233_10111353 150
361 3300025272 Ga0209455_1000007 Ga0209455_1000007964 150
362 3300025272 Ga0209455_1000039 Ga0209455_1000039167 150
363 3300025272 Ga0209455_1005548 Ga0209455_10055482 150
364 3300025303 Ga0209051_1001604 Ga0209051_100160411 150
365 3300025903 Ga0207680_10179505 Ga0207680_101795052 150
366 3300025904 Ga0207647_10032410 Ga0207647_100324102 150
367 3300025904 Ga0207647_10341726 Ga0207647_103417261 150
368 3300025912 Ga0207707_10026137 Ga0207707_100261379 150
369 3300025914 Ga0207671_10038790 Ga0207671_100387904 150
370 3300025914 Ga0207671_10522461 Ga0207671_105224612 150
371 3300025917 Ga0207660_10239136 Ga0207660_102391362 150
372 3300025926 Ga0207659_10462044 Ga0207659_104620441 150
373 3300025929 Ga0207664_10430787 Ga0207664_104307872 150
374 3300025937 Ga0207669_10077833 Ga0207669_100778333 150
375 3300025938 Ga0207704_10076640 Ga0207704_100766402 150
376 3300025939 Ga0207665_10196749 Ga0207665_101967492 150
377 3300025940 Ga0207691_10035130 Ga0207691_100351305 150
378 3300025949 Ga0207667_10708156 Ga0207667_107081561 150
379 3300025960 Ga0207651_10061221 Ga0207651_100612212 150
380 3300025961 Ga0207712_10104529 Ga0207712_101045292 150
381 3300025961 Ga0207712_11307170 Ga0207712_113071701 150
382 3300025972 Ga0207668_10357400 Ga0207668_103574002 150
383 3300025986 Ga0207658_10078212 Ga0207658_100782122 150
384 3300026023 Ga0207677_10252616 Ga0207677_102526162 150
385 3300026035 Ga0207703_10197249 Ga0207703_101972492 150
386 3300026078 Ga0207702_10001070 Ga0207702_1000107017 150
387 3300026088 Ga0207641_10223965 Ga0207641_102239652 150
388 3300026089 Ga0207648_10019716 Ga0207648_100197165 150
389 3300026095 Ga0207676_12264875 Ga0207676_122648751 150
390 3300026121 Ga0207683_10338233 Ga0207683_103382331 150
391 3300026142 Ga0207698_10097180 Ga0207698_100971802 150
392 3300028379 Ga0268266_11206306 Ga0268266_112063061 150
393 3300028381 Ga0268264_10625926 Ga0268264_106259262 150
394 3300035086 Ga0373934_0039857 Ga0373934_0039857_235_699 150
395 3300037312 Ga0395899_0000309 Ga0395899_0000309_53108_53560 150
396 3300037418 Ga0395900_0000421 Ga0395900_0000421_4555_5007 150
397 3300037466 Ga0395898_0000305 Ga0395898_0000305_53108_53560 150
398 3300044684 Ga0466966_0027099 Ga0466966_0027099_1433_1885 150
399 3300044684 Ga0466966_0097107 Ga0466966_0097107_493_945 150
400 3300044684 Ga0466966_0146215 Ga0466966_0146215_367_825 150
401 3300044693 Ga0466961_0002955 Ga0466961_0002955_6036_6488 150
402 3300044693 Ga0466961_0020820 Ga0466961_0020820_373_825 150
403 3300044706 Ga0466964_0797902 Ga0466964_0797902_52_504 150
404 3300044765 Ga0466970_0002407 Ga0466970_0002407_7142_7594 150
405 3300044765 Ga0466970_0008580 Ga0466970_0008580_4306_4758 150
406 3300044765 Ga0466970_0619218 Ga0466970_0619218_47_499 150
407 3300044842 Ga0466957_0000516 Ga0466957_0000516_9643_10095 150
408 3300044842 Ga0466957_0246704 Ga0466957_0246704_103_561 150
409 3300045049 Ga0466959_0007966 Ga0466959_0007966_33_485 150
410 3300045049 Ga0466959_0008082 Ga0466959_0008082_486_938 150
411 3300045049 Ga0466959_0028287 Ga0466959_0028287_470_922 150
412 3300045836 Ga0466958_0046059 Ga0466958_0046059_1190_1642 150
413 3300045836 Ga0466958_0905857 Ga0466958_0905857_103_555 150
414 3300046524 Ga0495648_0407420 Ga0495648_0407420_32_559 150
415 3300046557 Ga0495622_0000032 Ga0495622_0000032_62433_62927 150
416 3300048088 Ga0495602_0573835 Ga0495602_0573835_64_528 150
417 3300048918 Ga0496115_0000116 Ga0496115_0000116_68067_68519 150
418 3300053080 Ga0500635_0000153 Ga0500635_0000153_6118_6588 150
419 3300053151 Ga0500604_0251191 Ga0500604_0251191_113_565 150
420 3300053153 Ga0500616_0000138 Ga0500616_0000138_98365_98823 150
421 3300061719 Ga0466962_0052154 Ga0466962_0052154_845_1297 150
422 iso_pu_bacteria 2884411467 2884414126 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

49

166

0.88

PF18029

Glyoxalase_6

Glyoxalase-like domain

57

167

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z47-assembly1.cif.gz_B-2 structure of the atpase subunit cysa of the putative sulfate atp-binding cassette (abc) transporter from alicyclobacillus acidocaldarius 0.7779 118 148
1b9m-assembly1.cif.gz_A regulator from escherichia coli 0.7697 118 148
3cxj-assembly1.cif.gz_A crystal structure of an uncharacterized protein from methanothermobacter thermautotrophicus 0.7555 107 148
2dch-assembly1.cif.gz_X crystal structure of archaeal intron-encoded homing endonuclease i-tsp061i 0.7521 106 139
1yfo-assembly2.cif.gz_B receptor protein tyrosine phosphatase alpha, domain 1 from mouse 0.7491 118 149
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8589 98 149 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8544 98 147 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8218 98 150 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8104 98 147 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8097 98 149 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A2S9GXT7-F1-model_v4 Glyoxalase-like domain 0.9864 98 150
AF-A0A1G6LED8-F1-model_v4 VOC domain-containing protein 0.9484 100 150
AF-A0A7Y2GMW0-F1-model_v4 VOC family protein 0.9424 80 148
AF-A0A136M9B9-F1-model_v4 Glyoxalase 0.9402 100 149
AF-A0A350JNC1-F1-model_v4 Glyoxalase 0.9314 80 150

Feature Viewer

pLDDT pTM Quality
83.92 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map