F440207

General Info

Members Datasets Scaffolds Average Seq Length
422 200 844 102

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100000310|Ga0070698_10000031044
Length 116
Sequence MSASKQQTSKHGSGHQHPAELRERAVRVVQETMKETGERHGVVTRIAVQLGLGSETLRHWVKQAEIDNGQRPGVTTKDQQRIAELEKEVRELRRANEILKAASAFFARELDPRLPK

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
58 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
59 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
71 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
72 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
73 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
83 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
84 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
85 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
86 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
87 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
88 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
89 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
90 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
91 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
92 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
93 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
94 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
95 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
96 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
97 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
98 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
99 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
100 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
101 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
102 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
103 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
104 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
105 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
108 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
112 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
147 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
199 2773857933 Frankia sp. BMG5.30 Isolate Nodule
200 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 0.71
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0.24
Rhizoplane 1.42
Rhizosphere 97.16
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100000310 3300005471 Bacteria 49450
2 JGI25407J50210_10020505 3300003373 Bacteria 1719
3 JGI25407J50210_10033254 3300003373 Bacteria 1332
4 Ga0070658_10433501 3300005327 Bacteria 1131
5 Ga0070668_100068229 3300005347 Bacteria 2764
6 Ga0070668_102286114 3300005347 Bacteria 500
7 Ga0070709_10230987 3300005434 Bacteria 1324
8 Ga0070714_101983384 3300005435 Bacteria 568
9 Ga0070713_100291660 3300005436 Bacteria 1499
10 Ga0070713_100320438 3300005436 Bacteria 1431
11 Ga0070710_10735670 3300005437 Bacteria 699
12 Ga0070711_101500680 3300005439 Unclassified 588
13 Ga0070663_100087240 3300005455 Bacteria 2306
14 Ga0070662_100103018 3300005457 Bacteria 2163
15 Ga0070662_101775238 3300005457 Bacteria 533
16 Ga0070706_100787068 3300005467 Bacteria 881
17 Ga0070684_100383928 3300005535 Bacteria 1294
18 Ga0070704_101009726 3300005549 Bacteria 753
19 Ga0068855_100636572 3300005563 Bacteria 1147
20 Ga0068855_101098363 3300005563 Bacteria 831
21 Ga0068855_101528251 3300005563 Bacteria 685
22 Ga0068855_101693959 3300005563 Bacteria 645
23 Ga0068856_100346383 3300005614 Bacteria 1504
24 Ga0068861_100229385 3300005719 Bacteria 1574
25 Ga0068861_100729731 3300005719 Bacteria 923
26 Ga0068861_101410666 3300005719 Bacteria 681
27 Ga0081455_10313328 3300005937 Bacteria 1121
28 Ga0081538_10003239 3300005981 Bacteria 15473
29 Ga0081538_10003468 3300005981 Bacteria 14898
30 Ga0081538_10013035 3300005981 Bacteria 6615
31 Ga0081538_10013258 3300005981 Bacteria 6537
32 Ga0081538_10017475 3300005981 Bacteria 5442
33 Ga0081538_10039062 3300005981 Bacteria 3050
34 Ga0081538_10094380 3300005981 Bacteria 1532
35 Ga0081539_10042318 3300005985 Bacteria 2655
36 Ga0070717_10444927 3300006028 Bacteria 1167
37 Ga0075428_100321948 3300006844 Bacteria 1661
38 Ga0075429_100501457 3300006880 Bacteria 1064
39 Ga0111539_10076578 3300009094 Bacteria 3939
40 Ga0111539_10633595 3300009094 Bacteria 1245
41 Ga0105245_12581398 3300009098 Bacteria 561
42 Ga0114129_10117729 3300009147 Bacteria 3660
43 Ga0114129_10606313 3300009147 Bacteria 1418
44 Ga0114129_12368884 3300009147 Bacteria 636
45 Ga0105242_11419839 3300009176 Bacteria 722
46 Ga0105238_10070878 3300009551 Bacteria 3484
47 Ga0105249_10233740 3300009553 Bacteria 1814
48 Ga0105030_122649 3300009987 Bacteria 573
49 Ga0157370_10010361 3300013104 Bacteria 9830
50 Ga0157370_10195303 3300013104 Bacteria 1878
51 Ga0157369_10067081 3300013105 Bacteria 3859
52 Ga0157369_10355787 3300013105 Bacteria 1520
53 Ga0163162_10451196 3300013306 Bacteria 1418
54 Ga0157372_10366413 3300013307 Bacteria 1679
55 Ga0157380_12567954 3300014326 Bacteria 575
56 Ga0182008_10068565 3300014497 Bacteria 1745
57 Ga0157379_12401691 3300014968 Bacteria 526
58 Ga0163161_10274206 3300017792 Bacteria 1321
59 Ga0163161_10694736 3300017792 Bacteria 846
60 Ga0206355_1529605 3300020076 Bacteria 636
61 Ga0206353_10435858 3300020082 Bacteria 691
62 Ga0154015_1007075 3300020610 Bacteria 551
63 Ga0207705_10397308 3300025909 Bacteria 1066
64 Ga0207684_10635183 3300025910 Bacteria 910
65 Ga0207707_11444674 3300025912 Bacteria 547
66 Ga0207652_10337888 3300025921 Bacteria 1360
67 Ga0207694_10056630 3300025924 Bacteria 3045
68 Ga0207700_10552915 3300025928 Bacteria 1022
69 Ga0207700_10891192 3300025928 Bacteria 796
70 Ga0207664_10058271 3300025929 Bacteria 3072
71 Ga0207706_10035090 3300025933 Bacteria 4461
72 Ga0207667_11278327 3300025949 Bacteria 711
73 Ga0207712_10279145 3300025961 Bacteria 1363
74 Ga0207712_11729326 3300025961 Bacteria 561
75 Ga0207668_10050638 3300025972 Bacteria 2864
76 Ga0207668_10304672 3300025972 Bacteria 1316
77 Ga0207678_10191881 3300026067 Bacteria 1746
78 Ga0207702_10343061 3300026078 Bacteria 1427
79 Ga0207675_100173638 3300026118 Bacteria 2061
80 Ga0207675_100268872 3300026118 Bacteria 1654
81 Ga0268264_11368586 3300028381 Bacteria 718
82 Ga0316182_1055609 3300030745 Bacteria 636
83 Ga0307408_100094652 3300031548 Bacteria 2262
84 Ga0307408_100117222 3300031548 Bacteria 2056
85 Ga0307405_10046029 3300031731 Bacteria 2677
86 Ga0307405_10111038 3300031731 Bacteria 1857
87 Ga0307405_10386622 3300031731 Bacteria 1091
88 Ga0307405_10585013 3300031731 Bacteria 908
89 Ga0307405_10835478 3300031731 Bacteria 774
90 Ga0307405_11192282 3300031731 Bacteria 658
91 Ga0307405_11723024 3300031731 Bacteria 556
92 Ga0307405_11783775 3300031731 Bacteria 547
93 Ga0307413_10112651 3300031824 Bacteria 1824
94 Ga0307413_10120248 3300031824 Bacteria 1778
95 Ga0307413_10261400 3300031824 Bacteria 1290
96 Ga0307413_10672999 3300031824 Bacteria 856
97 Ga0307413_10730628 3300031824 Bacteria 825
98 Ga0307413_10735691 3300031824 Bacteria 823
99 Ga0307410_10006440 3300031852 Bacteria 6337
100 Ga0307410_10043619 3300031852 Bacteria 2973
101 Ga0307410_10136067 3300031852 Bacteria 1811
102 Ga0307410_10158035 3300031852 Bacteria 1695
103 Ga0307410_10166132 3300031852 Bacteria 1658
104 Ga0307410_10174142 3300031852 Bacteria 1624
105 Ga0307410_10207768 3300031852 Bacteria 1498
106 Ga0307410_10261196 3300031852 Bacteria 1350
107 Ga0307410_11676180 3300031852 Bacteria 563
108 Ga0307410_12102468 3300031852 Bacteria 505
109 Ga0307406_10003184 3300031901 Bacteria 8934
110 Ga0307406_10085073 3300031901 Bacteria 2113
111 Ga0307406_10135981 3300031901 Bacteria 1732
112 Ga0307406_10322581 3300031901 Bacteria 1195
113 Ga0307406_10329382 3300031901 Bacteria 1185
114 Ga0307406_10638187 3300031901 Bacteria 882
115 Ga0307406_10662856 3300031901 Bacteria 867
116 Ga0307406_10786980 3300031901 Bacteria 801
117 Ga0307407_10094260 3300031903 Bacteria 1842
118 Ga0307407_10122256 3300031903 Bacteria 1652
119 Ga0307407_10165324 3300031903 Bacteria 1452
120 Ga0307407_10184387 3300031903 Bacteria 1385
121 Ga0307407_10258772 3300031903 Bacteria 1196
122 Ga0307407_10295421 3300031903 Bacteria 1127
123 Ga0307407_10391679 3300031903 Bacteria 994
124 Ga0307407_10546611 3300031903 Bacteria 855
125 Ga0307407_10654079 3300031903 Bacteria 787
126 Ga0307407_11067981 3300031903 Bacteria 626
127 Ga0307407_11401104 3300031903 Bacteria 551
128 Ga0307412_10069181 3300031911 Bacteria 2402
129 Ga0307412_10084965 3300031911 Bacteria 2198
130 Ga0307412_10238378 3300031911 Bacteria 1405
131 Ga0307412_10297755 3300031911 Bacteria 1273
132 Ga0307412_11088681 3300031911 Bacteria 710
133 Ga0307412_11563048 3300031911 Bacteria 601
134 Ga0307412_11586563 3300031911 Bacteria 597
135 Ga0307412_12236043 3300031911 Bacteria 509
136 Ga0307409_100006732 3300031995 Bacteria 6796
137 Ga0307409_100037650 3300031995 Bacteria 3568
138 Ga0307409_100080142 3300031995 Bacteria 2633
139 Ga0307409_100084126 3300031995 Bacteria 2582
140 Ga0307409_100192767 3300031995 Bacteria 1815
141 Ga0307409_100302075 3300031995 Bacteria 1489
142 Ga0307409_100466978 3300031995 Bacteria 1221
143 Ga0307409_100833647 3300031995 Bacteria 932
144 Ga0307409_100909037 3300031995 Bacteria 894
145 Ga0307409_100980135 3300031995 Bacteria 862
146 Ga0307409_101444937 3300031995 Bacteria 714
147 Ga0307409_101859855 3300031995 Bacteria 631
148 Ga0307409_102024047 3300031995 Bacteria 605
149 Ga0307409_102217072 3300031995 Bacteria 579
150 Ga0307416_100080688 3300032002 Bacteria 2747
151 Ga0307416_100104273 3300032002 Bacteria 2478
152 Ga0307416_100119020 3300032002 Bacteria 2348
153 Ga0307416_100124345 3300032002 Bacteria 2307
154 Ga0307416_100262422 3300032002 Bacteria 1689
155 Ga0307416_100276164 3300032002 Bacteria 1653
156 Ga0307416_100385384 3300032002 Bacteria 1433
157 Ga0307416_100420619 3300032002 Bacteria 1380
158 Ga0307416_100455828 3300032002 Bacteria 1332
159 Ga0307416_100638190 3300032002 Bacteria 1148
160 Ga0307416_101545404 3300032002 Bacteria 769
161 Ga0307416_101602062 3300032002 Bacteria 756
162 Ga0307416_101666782 3300032002 Bacteria 742
163 Ga0307416_101873075 3300032002 Bacteria 703
164 Ga0307416_103629190 3300032002 Bacteria 517
165 Ga0307414_10194743 3300032004 Bacteria 1643
166 Ga0307414_10280371 3300032004 Bacteria 1400
167 Ga0307414_10343085 3300032004 Bacteria 1279
168 Ga0307414_10406784 3300032004 Bacteria 1183
169 Ga0307414_10409725 3300032004 Bacteria 1179
170 Ga0307414_10585959 3300032004 Bacteria 998
171 Ga0307411_10041228 3300032005 Bacteria 2935
172 Ga0307411_10220688 3300032005 Bacteria 1470
173 Ga0307411_10252016 3300032005 Bacteria 1388
174 Ga0307411_10260843 3300032005 Bacteria 1368
175 Ga0307411_10462665 3300032005 Bacteria 1064
176 Ga0307411_10799386 3300032005 Bacteria 830
177 Ga0307411_11643486 3300032005 Bacteria 593
178 Ga0307415_100018434 3300032126 Bacteria 4215
179 Ga0307415_100027530 3300032126 Bacteria 3602
180 Ga0307415_100051533 3300032126 Bacteria 2793
181 Ga0307415_100162703 3300032126 Bacteria 1731
182 Ga0307415_100190603 3300032126 Bacteria 1617
183 Ga0307415_100246673 3300032126 Bacteria 1448
184 Ga0307415_100285443 3300032126 Bacteria 1359
185 Ga0307415_100493402 3300032126 Bacteria 1069
186 Ga0307415_100551305 3300032126 Bacteria 1017
187 Ga0307415_100756715 3300032126 Bacteria 882
188 Ga0307415_100912807 3300032126 Bacteria 810
189 Ga0307415_101722733 3300032126 Bacteria 605
190 Ga0307415_102403446 3300032126 Bacteria 518
191 Ga0373930_0060396 3300034816 Bacteria 844
192 Ga0373950_0088069 3300034818 Bacteria 656
193 Ga0373940_0127918 3300035088 Bacteria 793
194 Ga0373924_0346042 3300035410 Bacteria 662
195 Ga0373927_0401665 3300035695 Bacteria 904
196 Ga0373947_0146087 3300035725 Bacteria 1520
197 Ga0373947_0167269 3300035725 Bacteria 1425
198 Ga0373937_0419973 3300036401 Bacteria 1269
199 Ga0373937_0463243 3300036401 Bacteria 1204
200 Ga0395899_0003739 3300037312 Bacteria 12020
201 Ga0395899_0332044 3300037312 Bacteria 1021
202 Ga0395900_0039604 3300037418 Bacteria 4855
203 Ga0395900_0228751 3300037418 Bacteria 1871
204 Ga0395900_0291246 3300037418 Bacteria 1621
205 Ga0395900_0360873 3300037418 Bacteria 1424
206 Ga0395900_0379627 3300037418 Bacteria 1381
207 Ga0395900_0479591 3300037418 Bacteria 1196
208 Ga0395900_0808077 3300037418 Bacteria 865
209 Ga0395898_0262558 3300037466 Bacteria 1647
210 Ga0395898_0265064 3300037466 Bacteria 1638
211 Ga0395898_0318169 3300037466 Bacteria 1484
212 Ga0395898_0354768 3300037466 Bacteria 1398
213 Ga0395898_0397830 3300037466 Bacteria 1313
214 Ga0395898_0527459 3300037466 Bacteria 1122
215 Ga0395905_0341988 3300037471 Bacteria 1387
216 Ga0395905_0726295 3300037471 Bacteria 895
217 Ga0395905_1106967 3300037471 Unclassified 695
218 Ga0395905_1178874 3300037471 Bacteria 669
219 Ga0395901_0030569 3300038443 Bacteria 5549
220 Ga0395901_0124097 3300038443 Bacteria 2713
221 Ga0395901_0431180 3300038443 Bacteria 1350
222 Ga0395901_0441211 3300038443 Bacteria 1332
223 Ga0395901_0618079 3300038443 Bacteria 1091
224 Ga0395901_0707507 3300038443 Bacteria 1004
225 Ga0395901_0980152 3300038443 Bacteria 822
226 Ga0395901_1448202 3300038443 Bacteria 644
227 Ga0436363_1199049 3300039450 Bacteria 2635
228 Ga0451802_1177276 3300041460 Bacteria 755
229 Ga0451849_0108419 3300041505 Bacteria 1130
230 Ga0451843_0009608 3300041509 Bacteria 726
231 Ga0439443_030984 3300042003 Bacteria 882
232 Ga0439448_0047775 3300042005 Bacteria 1396
233 Ga0439448_0060507 3300042005 Bacteria 1251
234 Ga0439448_0217970 3300042005 Bacteria 671
235 Ga0439450_065490 3300042008 Bacteria 884
236 Ga0439451_084352 3300042009 Bacteria 639
237 Ga0439454_005152 3300042011 Bacteria 1547
238 Ga0439455_0012764 3300042012 Bacteria 1892
239 Ga0439455_0045101 3300042012 Bacteria 1139
240 Ga0439456_036145 3300042013 Bacteria 1065
241 Ga0439463_062708 3300042016 Bacteria 950
242 Ga0439463_069628 3300042016 Bacteria 901
243 Ga0439463_130944 3300042016 Bacteria 649
244 Ga0439463_161931 3300042016 Bacteria 580
245 Ga0450914_011420 3300042118 Bacteria 874
246 Ga0450914_019841 3300042118 Bacteria 741
247 Ga0450915_001961 3300042119 Bacteria 1029
248 Ga0450888_012719 3300042126 Bacteria 1000
249 Ga0450888_017734 3300042126 Bacteria 886
250 Ga0450902_034079 3300042137 Bacteria 861
251 Ga0450904_003971 3300042139 Bacteria 1562
252 Ga0439458_0029250 3300042157 Bacteria 1306
253 Ga0439458_0137545 3300042157 Bacteria 650
254 Ga0439435_0134160 3300042436 Bacteria 784
255 Ga0439444_0006227 3300042437 Bacteria 1797
256 Ga0439444_0009786 3300042437 Bacteria 1518
257 Ga0439444_0038131 3300042437 Bacteria 932
258 Ga0439444_0078939 3300042437 Bacteria 717
259 Ga0439459_0026459 3300042438 Bacteria 1152
260 Ga0439459_0119628 3300042438 Bacteria 663
261 Ga0439464_0004883 3300042439 Bacteria 3441
262 Ga0439464_0273577 3300042439 Bacteria 548
263 Ga0439464_0327084 3300042439 Bacteria 503
264 Ga0439460_0129062 3300042461 Bacteria 832
265 Ga0439460_0142282 3300042461 Bacteria 796
266 Ga0439460_0166334 3300042461 Bacteria 741
267 Ga0450893_0028719 3300042532 Bacteria 985
268 Ga0451577_0250421 3300042876 Bacteria 1603
269 Ga0439440_0001059 3300042993 Bacteria 4898
270 Ga0439440_0024480 3300042993 Bacteria 1384
271 Ga0439440_0113708 3300042993 Bacteria 747
272 Ga0439440_0222704 3300042993 Bacteria 566
273 Ga0466969_0098478 3300044656 Bacteria 1379
274 Ga0466969_0117234 3300044656 Bacteria 1242
275 Ga0466961_0174412 3300044693 Bacteria 1336
276 Ga0466963_1190600 3300044694 Bacteria 535
277 Ga0466964_0337507 3300044706 Bacteria 770
278 Ga0466968_0445960 3300044735 Bacteria 639
279 Ga0466959_0152583 3300045049 Bacteria 1627
280 Ga0466967_0595394 3300045976 Bacteria 1091
281 Ga0466967_0713053 3300045976 Bacteria 994
282 Ga0495590_0287393 3300046457 Bacteria 617
283 Ga0495641_0223618 3300046461 Bacteria 844
284 Ga0495653_0701771 3300046463 Bacteria 614
285 Ga0495582_0412135 3300046473 Bacteria 779
286 Ga0495639_0622895 3300046475 Bacteria 555
287 Ga0495664_0231270 3300046477 Bacteria 1119
288 Ga0495594_0000012 3300046499 Bacteria 105133
289 Ga0495607_0068045 3300046501 Bacteria 1999
290 Ga0495608_0341166 3300046511 Bacteria 923
291 Ga0495618_0127029 3300046514 Bacteria 1632
292 Ga0495618_0712730 3300046514 Bacteria 589
293 Ga0495628_0572022 3300046516 Bacteria 809
294 Ga0495631_0177174 3300046518 Bacteria 914
295 Ga0495644_0176129 3300046523 Bacteria 822
296 Ga0495663_0036196 3300046525 Bacteria 1485
297 Ga0495663_0329293 3300046525 Bacteria 554
298 Ga0495665_0350389 3300046531 Bacteria 752
299 Ga0495598_0108774 3300046537 Bacteria 927
300 Ga0495645_0235963 3300046543 Bacteria 1223
301 Ga0495667_0708945 3300046559 Bacteria 623
302 Ga0495656_0043946 3300046615 Bacteria 1879
303 Ga0495656_0053925 3300046615 Bacteria 1729
304 Ga0495656_0277000 3300046615 Bacteria 854
305 Ga0495635_0058153 3300046663 Bacteria 2660
306 Ga0495635_0069497 3300046663 Bacteria 2414
307 Ga0495623_0169739 3300046679 Bacteria 1275
308 Ga0495646_0269359 3300046680 Bacteria 908
309 Ga0495647_0395713 3300046681 Bacteria 634
310 Ga0495658_0461799 3300046683 Bacteria 811
311 Ga0495658_0656414 3300046683 Bacteria 672
312 Ga0495658_0707531 3300046683 Bacteria 645
313 Ga0495613_0152335 3300046689 Bacteria 1648
314 Ga0495613_0227162 3300046689 Bacteria 1309
315 Ga0495624_0035134 3300046690 Bacteria 3237
316 Ga0495670_0531247 3300046691 Bacteria 640
317 Ga0495600_0117153 3300046809 Bacteria 1733
318 Ga0495581_0155209 3300047315 Bacteria 1338
319 Ga0495581_0265173 3300047315 Bacteria 1004
320 Ga0495676_0012445 3300047321 Bacteria 7665
321 Ga0495675_0516806 3300047444 Bacteria 684
322 Ga0495677_0434569 3300047445 Bacteria 520
323 Ga0495685_103386 3300047447 Bacteria 940
324 Ga0495593_0105478 3300047673 Bacteria 1442
325 Ga0495615_0069201 3300048090 Bacteria 948
326 Ga0496104_0315228 3300048907 Bacteria 1477
327 Ga0496108_0265925 3300048911 Bacteria 1492
328 Ga0496112_0272165 3300048915 Bacteria 1642
329 Ga0496114_1267656 3300048917 Bacteria 624
330 Ga0496115_1144757 3300048918 Bacteria 587
331 Ga0501031_0085421 3300049568 Bacteria 2057
332 Ga0501031_0370745 3300049568 Bacteria 926
333 Ga0501032_0151783 3300049569 Bacteria 1523
334 Ga0501033_0033937 3300049570 Bacteria 3830
335 Ga0501033_0099124 3300049570 Bacteria 2127
336 Ga0501033_0488911 3300049570 Bacteria 852
337 Ga0501034_1478925 3300049571 Bacteria 553
338 Ga0501036_0042950 3300049572 Bacteria 3827
339 Ga0501036_0086443 3300049572 Bacteria 2650
340 Ga0501036_0108185 3300049572 Bacteria 2351
341 Ga0501036_0265162 3300049572 Bacteria 1438
342 Ga0501037_0191846 3300049573 Bacteria 1446
343 Ga0501038_0572129 3300049574 Bacteria 857
344 Ga0501039_0002390 3300049575 Bacteria 13961
345 Ga0501039_0671770 3300049575 Bacteria 811
346 Ga0501039_0932540 3300049575 Bacteria 675
347 Ga0501040_0013965 3300049576 Bacteria 5287
348 Ga0501040_0074665 3300049576 Bacteria 2343
349 Ga0501040_0199472 3300049576 Bacteria 1420
350 Ga0501041_0043148 3300049577 Bacteria 2742
351 Ga0501041_0139681 3300049577 Bacteria 1510
352 Ga0501042_0019338 3300049578 Bacteria 4727
353 Ga0501042_0713090 3300049578 Bacteria 729
354 Ga0501043_0056263 3300049579 Bacteria 3089
355 Ga0501046_0009619 3300049580 Bacteria 8335
356 Ga0501047_0635660 3300049581 Bacteria 887
357 Ga0501048_0176621 3300049582 Bacteria 1513
358 Ga0501068_0053248 3300049584 Bacteria 2449
359 Ga0501068_0640176 3300049584 Bacteria 694
360 Ga0501069_0256462 3300049585 Bacteria 1020
361 Ga0501069_0644103 3300049585 Bacteria 637
362 Ga0501070_0134513 3300049586 Bacteria 2041
363 Ga0501070_0440221 3300049586 Bacteria 1051
364 Ga0501070_1539880 3300049586 Bacteria 502
365 Ga0501071_0030816 3300049587 Bacteria 3796
366 Ga0501071_0043057 3300049587 Bacteria 3236
367 Ga0501072_0023620 3300049588 Bacteria 4775
368 Ga0501072_0133618 3300049588 Bacteria 1978
369 Ga0501072_1294261 3300049588 Bacteria 565
370 Ga0501073_0078096 3300049589 Bacteria 2303
371 Ga0501073_0265682 3300049589 Bacteria 1184
372 Ga0501073_0474520 3300049589 Bacteria 865
373 Ga0501073_1001089 3300049589 Bacteria 575
374 Ga0501074_0050559 3300049590 Bacteria 3000
375 Ga0501074_0255784 3300049590 Bacteria 1245
376 Ga0501075_0085610 3300049591 Bacteria 2388
377 Ga0501075_0195767 3300049591 Bacteria 1541
378 Ga0501075_0305481 3300049591 Bacteria 1212
379 Ga0501075_1381986 3300049591 Bacteria 533
380 Ga0501076_0219602 3300049592 Bacteria 1553
381 Ga0501076_0559059 3300049592 Bacteria 943
382 Ga0501077_0027433 3300049593 Bacteria 3616
383 Ga0501077_0143691 3300049593 Bacteria 1513
384 Ga0501079_0019856 3300049741 Bacteria 5132
385 Ga0501079_0073554 3300049741 Bacteria 2641
386 Ga0501080_0189842 3300049742 Bacteria 1888
387 Ga0501080_0335188 3300049742 Bacteria 1367
388 Ga0501080_0361741 3300049742 Bacteria 1309
389 Ga0501081_0003540 3300049743 Bacteria 9978
390 Ga0501081_0056469 3300049743 Bacteria 2713
391 Ga0501081_0075422 3300049743 Bacteria 2354
392 Ga0501083_0107368 3300049744 Bacteria 1837
393 Ga0501083_1054158 3300049744 Bacteria 529
394 Ga0501035_0181655 3300049822 Bacteria 1812
395 Ga0501035_0285130 3300049822 Bacteria 1395
396 Ga0501045_0002088 3300049824 Bacteria 13497
397 Ga0501045_0086194 3300049824 Bacteria 2318
398 nmdc:mga05p37_1405795_c1 3300050507 Bacteria 702
399 nmdc:mga05p37_197064_c1 3300050507 Bacteria 2442
400 nmdc:mga05p37_250184_c1 3300050507 Bacteria 2126
401 nmdc:mga05p37_534497_c1 3300050507 Bacteria 1338
402 nmdc:mga05p37_95770_c1 3300050507 Bacteria 3657
403 nmdc:mga06r32_770526_c1 3300050510 Bacteria 924
404 nmdc:mga08y16_652838_c1 3300050511 Bacteria 1056
405 nmdc:mga0n895_1242531_c1 3300050512 Bacteria 718
406 nmdc:mga0a205_22417_c1 3300050515 Bacteria 5982
407 Ga0495601_0999628 3300053077 Bacteria 526
408 Ga0495619_0306189 3300053085 Bacteria 1100
409 Ga0495619_0325837 3300053085 Bacteria 1063
410 Ga0495619_0538235 3300053085 Bacteria 802
411 Ga0500585_092992 3300053144 Bacteria 1089
412 Ga0501084_0196391 3300054114 Bacteria 1702
413 Ga0501084_0233479 3300054114 Bacteria 1552
414 Ga0590074_075465 3300059423 Bacteria 639
415 Ga0590075_076021 3300059424 Bacteria 869
416 Ga0590075_080686 3300059424 Bacteria 843
417 Ga0501082_0006927 3300060353 Bacteria 9797
418 Ga0501082_0508909 3300060353 Bacteria 1052
419 Ga0530510_0189733 3300061734 Bacteria 1525
420 Ga0530510_0266899 3300061734 Bacteria 1277
421 2774905794 2773857933 Bacteria 5818019
422 8003323744 8003314358 Bacteria 10575343
423 Ga0070698_100000310
424 JGI25407J50210_10020505
425 JGI25407J50210_10033254
426 Ga0070658_10433501
427 Ga0070668_100068229
428 Ga0070668_102286114
429 Ga0070709_10230987
430 Ga0070714_101983384
431 Ga0070713_100291660
432 Ga0070713_100320438
433 Ga0070710_10735670
434 Ga0070711_101500680
435 Ga0070663_100087240
436 Ga0070662_100103018
437 Ga0070662_101775238
438 Ga0070706_100787068
439 Ga0070684_100383928
440 Ga0070704_101009726
441 Ga0068855_100636572
442 Ga0068855_101098363
443 Ga0068855_101528251
444 Ga0068855_101693959
445 Ga0068856_100346383
446 Ga0068861_100229385
447 Ga0068861_100729731
448 Ga0068861_101410666
449 Ga0081455_10313328
450 Ga0081538_10003239
451 Ga0081538_10003468
452 Ga0081538_10013035
453 Ga0081538_10013258
454 Ga0081538_10017475
455 Ga0081538_10039062
456 Ga0081538_10094380
457 Ga0081539_10042318
458 Ga0070717_10444927
459 Ga0075428_100321948
460 Ga0075429_100501457
461 Ga0111539_10076578
462 Ga0111539_10633595
463 Ga0105245_12581398
464 Ga0114129_10117729
465 Ga0114129_10606313
466 Ga0114129_12368884
467 Ga0105242_11419839
468 Ga0105238_10070878
469 Ga0105249_10233740
470 Ga0105030_122649
471 Ga0157370_10010361
472 Ga0157370_10195303
473 Ga0157369_10067081
474 Ga0157369_10355787
475 Ga0163162_10451196
476 Ga0157372_10366413
477 Ga0157380_12567954
478 Ga0182008_10068565
479 Ga0157379_12401691
480 Ga0163161_10274206
481 Ga0163161_10694736
482 Ga0206355_1529605
483 Ga0206353_10435858
484 Ga0154015_1007075
485 Ga0207705_10397308
486 Ga0207684_10635183
487 Ga0207707_11444674
488 Ga0207652_10337888
489 Ga0207694_10056630
490 Ga0207700_10552915
491 Ga0207700_10891192
492 Ga0207664_10058271
493 Ga0207706_10035090
494 Ga0207667_11278327
495 Ga0207712_10279145
496 Ga0207712_11729326
497 Ga0207668_10050638
498 Ga0207668_10304672
499 Ga0207678_10191881
500 Ga0207702_10343061
501 Ga0207675_100173638
502 Ga0207675_100268872
503 Ga0268264_11368586
504 Ga0316182_1055609
505 Ga0307408_100094652
506 Ga0307408_100117222
507 Ga0307405_10046029
508 Ga0307405_10111038
509 Ga0307405_10386622
510 Ga0307405_10585013
511 Ga0307405_10835478
512 Ga0307405_11192282
513 Ga0307405_11723024
514 Ga0307405_11783775
515 Ga0307413_10112651
516 Ga0307413_10120248
517 Ga0307413_10261400
518 Ga0307413_10672999
519 Ga0307413_10730628
520 Ga0307413_10735691
521 Ga0307410_10006440
522 Ga0307410_10043619
523 Ga0307410_10136067
524 Ga0307410_10158035
525 Ga0307410_10166132
526 Ga0307410_10174142
527 Ga0307410_10207768
528 Ga0307410_10261196
529 Ga0307410_11676180
530 Ga0307410_12102468
531 Ga0307406_10003184
532 Ga0307406_10085073
533 Ga0307406_10135981
534 Ga0307406_10322581
535 Ga0307406_10329382
536 Ga0307406_10638187
537 Ga0307406_10662856
538 Ga0307406_10786980
539 Ga0307407_10094260
540 Ga0307407_10122256
541 Ga0307407_10165324
542 Ga0307407_10184387
543 Ga0307407_10258772
544 Ga0307407_10295421
545 Ga0307407_10391679
546 Ga0307407_10546611
547 Ga0307407_10654079
548 Ga0307407_11067981
549 Ga0307407_11401104
550 Ga0307412_10069181
551 Ga0307412_10084965
552 Ga0307412_10238378
553 Ga0307412_10297755
554 Ga0307412_11088681
555 Ga0307412_11563048
556 Ga0307412_11586563
557 Ga0307412_12236043
558 Ga0307409_100006732
559 Ga0307409_100037650
560 Ga0307409_100080142
561 Ga0307409_100084126
562 Ga0307409_100192767
563 Ga0307409_100302075
564 Ga0307409_100466978
565 Ga0307409_100833647
566 Ga0307409_100909037
567 Ga0307409_100980135
568 Ga0307409_101444937
569 Ga0307409_101859855
570 Ga0307409_102024047
571 Ga0307409_102217072
572 Ga0307416_100080688
573 Ga0307416_100104273
574 Ga0307416_100119020
575 Ga0307416_100124345
576 Ga0307416_100262422
577 Ga0307416_100276164
578 Ga0307416_100385384
579 Ga0307416_100420619
580 Ga0307416_100455828
581 Ga0307416_100638190
582 Ga0307416_101545404
583 Ga0307416_101602062
584 Ga0307416_101666782
585 Ga0307416_101873075
586 Ga0307416_103629190
587 Ga0307414_10194743
588 Ga0307414_10280371
589 Ga0307414_10343085
590 Ga0307414_10406784
591 Ga0307414_10409725
592 Ga0307414_10585959
593 Ga0307411_10041228
594 Ga0307411_10220688
595 Ga0307411_10252016
596 Ga0307411_10260843
597 Ga0307411_10462665
598 Ga0307411_10799386
599 Ga0307411_11643486
600 Ga0307415_100018434
601 Ga0307415_100027530
602 Ga0307415_100051533
603 Ga0307415_100162703
604 Ga0307415_100190603
605 Ga0307415_100246673
606 Ga0307415_100285443
607 Ga0307415_100493402
608 Ga0307415_100551305
609 Ga0307415_100756715
610 Ga0307415_100912807
611 Ga0307415_101722733
612 Ga0307415_102403446
613 Ga0373930_0060396
614 Ga0373950_0088069
615 Ga0373940_0127918
616 Ga0373924_0346042
617 Ga0373927_0401665
618 Ga0373947_0146087
619 Ga0373947_0167269
620 Ga0373937_0419973
621 Ga0373937_0463243
622 Ga0395899_0003739
623 Ga0395899_0332044
624 Ga0395900_0039604
625 Ga0395900_0228751
626 Ga0395900_0291246
627 Ga0395900_0360873
628 Ga0395900_0379627
629 Ga0395900_0479591
630 Ga0395900_0808077
631 Ga0395898_0262558
632 Ga0395898_0265064
633 Ga0395898_0318169
634 Ga0395898_0354768
635 Ga0395898_0397830
636 Ga0395898_0527459
637 Ga0395905_0341988
638 Ga0395905_0726295
639 Ga0395905_1106967
640 Ga0395905_1178874
641 Ga0395901_0030569
642 Ga0395901_0124097
643 Ga0395901_0431180
644 Ga0395901_0441211
645 Ga0395901_0618079
646 Ga0395901_0707507
647 Ga0395901_0980152
648 Ga0395901_1448202
649 Ga0436363_1199049
650 Ga0451802_1177276
651 Ga0451849_0108419
652 Ga0451843_0009608
653 Ga0439443_030984
654 Ga0439448_0047775
655 Ga0439448_0060507
656 Ga0439448_0217970
657 Ga0439450_065490
658 Ga0439451_084352
659 Ga0439454_005152
660 Ga0439455_0012764
661 Ga0439455_0045101
662 Ga0439456_036145
663 Ga0439463_062708
664 Ga0439463_069628
665 Ga0439463_130944
666 Ga0439463_161931
667 Ga0450914_011420
668 Ga0450914_019841
669 Ga0450915_001961
670 Ga0450888_012719
671 Ga0450888_017734
672 Ga0450902_034079
673 Ga0450904_003971
674 Ga0439458_0029250
675 Ga0439458_0137545
676 Ga0439435_0134160
677 Ga0439444_0006227
678 Ga0439444_0009786
679 Ga0439444_0038131
680 Ga0439444_0078939
681 Ga0439459_0026459
682 Ga0439459_0119628
683 Ga0439464_0004883
684 Ga0439464_0273577
685 Ga0439464_0327084
686 Ga0439460_0129062
687 Ga0439460_0142282
688 Ga0439460_0166334
689 Ga0450893_0028719
690 Ga0451577_0250421
691 Ga0439440_0001059
692 Ga0439440_0024480
693 Ga0439440_0113708
694 Ga0439440_0222704
695 Ga0466969_0098478
696 Ga0466969_0117234
697 Ga0466961_0174412
698 Ga0466963_1190600
699 Ga0466964_0337507
700 Ga0466968_0445960
701 Ga0466959_0152583
702 Ga0466967_0595394
703 Ga0466967_0713053
704 Ga0495590_0287393
705 Ga0495641_0223618
706 Ga0495653_0701771
707 Ga0495582_0412135
708 Ga0495639_0622895
709 Ga0495664_0231270
710 Ga0495594_0000012
711 Ga0495607_0068045
712 Ga0495608_0341166
713 Ga0495618_0127029
714 Ga0495618_0712730
715 Ga0495628_0572022
716 Ga0495631_0177174
717 Ga0495644_0176129
718 Ga0495663_0036196
719 Ga0495663_0329293
720 Ga0495665_0350389
721 Ga0495598_0108774
722 Ga0495645_0235963
723 Ga0495667_0708945
724 Ga0495656_0043946
725 Ga0495656_0053925
726 Ga0495656_0277000
727 Ga0495635_0058153
728 Ga0495635_0069497
729 Ga0495623_0169739
730 Ga0495646_0269359
731 Ga0495647_0395713
732 Ga0495658_0461799
733 Ga0495658_0656414
734 Ga0495658_0707531
735 Ga0495613_0152335
736 Ga0495613_0227162
737 Ga0495624_0035134
738 Ga0495670_0531247
739 Ga0495600_0117153
740 Ga0495581_0155209
741 Ga0495581_0265173
742 Ga0495676_0012445
743 Ga0495675_0516806
744 Ga0495677_0434569
745 Ga0495685_103386
746 Ga0495593_0105478
747 Ga0495615_0069201
748 Ga0496104_0315228
749 Ga0496108_0265925
750 Ga0496112_0272165
751 Ga0496114_1267656
752 Ga0496115_1144757
753 Ga0501031_0085421
754 Ga0501031_0370745
755 Ga0501032_0151783
756 Ga0501033_0033937
757 Ga0501033_0099124
758 Ga0501033_0488911
759 Ga0501034_1478925
760 Ga0501036_0042950
761 Ga0501036_0086443
762 Ga0501036_0108185
763 Ga0501036_0265162
764 Ga0501037_0191846
765 Ga0501038_0572129
766 Ga0501039_0002390
767 Ga0501039_0671770
768 Ga0501039_0932540
769 Ga0501040_0013965
770 Ga0501040_0074665
771 Ga0501040_0199472
772 Ga0501041_0043148
773 Ga0501041_0139681
774 Ga0501042_0019338
775 Ga0501042_0713090
776 Ga0501043_0056263
777 Ga0501046_0009619
778 Ga0501047_0635660
779 Ga0501048_0176621
780 Ga0501068_0053248
781 Ga0501068_0640176
782 Ga0501069_0256462
783 Ga0501069_0644103
784 Ga0501070_0134513
785 Ga0501070_0440221
786 Ga0501070_1539880
787 Ga0501071_0030816
788 Ga0501071_0043057
789 Ga0501072_0023620
790 Ga0501072_0133618
791 Ga0501072_1294261
792 Ga0501073_0078096
793 Ga0501073_0265682
794 Ga0501073_0474520
795 Ga0501073_1001089
796 Ga0501074_0050559
797 Ga0501074_0255784
798 Ga0501075_0085610
799 Ga0501075_0195767
800 Ga0501075_0305481
801 Ga0501075_1381986
802 Ga0501076_0219602
803 Ga0501076_0559059
804 Ga0501077_0027433
805 Ga0501077_0143691
806 Ga0501079_0019856
807 Ga0501079_0073554
808 Ga0501080_0189842
809 Ga0501080_0335188
810 Ga0501080_0361741
811 Ga0501081_0003540
812 Ga0501081_0056469
813 Ga0501081_0075422
814 Ga0501083_0107368
815 Ga0501083_1054158
816 Ga0501035_0181655
817 Ga0501035_0285130
818 Ga0501045_0002088
819 Ga0501045_0086194
820 nmdc:mga05p37_1405795_c1
821 nmdc:mga05p37_197064_c1
822 nmdc:mga05p37_250184_c1
823 nmdc:mga05p37_534497_c1
824 nmdc:mga05p37_95770_c1
825 nmdc:mga06r32_770526_c1
826 nmdc:mga08y16_652838_c1
827 nmdc:mga0n895_1242531_c1
828 nmdc:mga0a205_22417_c1
829 Ga0495601_0999628
830 Ga0495619_0306189
831 Ga0495619_0325837
832 Ga0495619_0538235
833 Ga0500585_092992
834 Ga0501084_0196391
835 Ga0501084_0233479
836 Ga0590074_075465
837 Ga0590075_076021
838 Ga0590075_080686
839 Ga0501082_0006927
840 Ga0501082_0508909
841 Ga0530510_0189733
842 Ga0530510_0266899
843 2774905794
844 8003323744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01527

HTH_Tnp_1

Transposase

15

97

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rn7-assembly1.cif.gz_A nmr solution structure of tnpe protein from shigella flexneri. northeast structural genomics target sfr125 0.7748 1 66
1o4x-assembly1.cif.gz_A ternary complex of the dna binding domains of the oct1 and sox2 transcription factors with a 19mer oligonucleotide from the hoxb1 regulatory element 0.773 7 58
5z2s-assembly1.cif.gz_A crystal structure of dux4-hd2 domain 0.7377 8 56
4rbo-assembly1.cif.gz_A crystal structure of a nanog homeobox (nanog) from homo sapiens at 3.30 a resolution 0.729 7 59
6dfy-assembly1.cif.gz_D remodeled crystal structure of dna-bound dux4-hd2 0.7198 11 56
ID Description Score Start End Superfamily
af_P9WKH5_4_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9647 6 66 1.10.10.10
af_P9WGW7_231_285_1.10.150.240 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.8874 12 59 1.10.150.240
af_P9WKH5_4_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8813 6 66 1.10.10.10
2rn7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7855 1 65 1.10.10.10
af_P9WGW7_231_285_1.10.150.240 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.7701 12 59 1.10.150.240
ID Description Score Start End GO Terms
AF-A0A7W1RT29-F1-model_v4 Transposase 1.008 6 55 GO:0003677
GO:0004803
GO:0006313
AF-A0A4R4W4S8-F1-model_v4 IS3 family transposase 0.9975 5 50
AF-T1CE34-F1-model_v4 Transposase IS3/IS911 family protein 0.9683 1 94 GO:0003677
GO:0004803
GO:0006313
AF-Q8PJU9-F1-model_v4 deleted 0.9637 1 51
AF-A0A5C8BJU8-F1-model_v4 deleted 0.9624 1 57

Map