F440107

General Info

Members Datasets Scaffolds Average Seq Length
421 265 406 139

Family's Representative Sequence

Representative Sequence 3300049130|Ga0501310_001375|Ga0501310_001375_455_892
Length 145
Sequence MAFSSDSGGGKPMAEINVTPLVDVMLVLLIIFMITAPLMTHKVKVELPEANLNKHQDDTNGPHVTPITIAVEESGALYWNDEPVTKGVIESRFSVEAQKTPQPQVNVRGDKTAKYKLVQEVVQIAQSQGMRKVGFVAIKDRSGQQ

Samples

Sample ID Description Type Environment
1 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
2 2643221559 Lysobacter sp. Root559 Isolate Unclassified
3 2643221573 Lysobacter sp. Root604 Isolate Unclassified
4 2643221586 Lysobacter sp. Root667 Isolate Unclassified
5 2643221612 Lysobacter sp. Root76 Isolate Unclassified
6 2643221720 Lysobacter sp. Root916 Isolate Unclassified
7 2643221727 Lysobacter sp. Root96 Isolate Unclassified
8 2643221728 Lysobacter sp. Root983 Isolate Unclassified
9 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
10 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
11 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
12 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
13 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
14 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
15 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
18 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
45 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
46 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
47 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
48 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
49 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
50 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
51 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
52 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
53 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
54 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
55 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
56 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
57 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
58 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
59 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
107 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
108 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
122 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
129 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
130 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
131 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
132 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
133 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
136 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
137 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
140 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
141 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
142 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
143 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
144 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
145 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
146 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
147 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
162 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
163 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
189 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
190 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
191 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
231 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
232 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
233 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
234 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
235 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
236 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
237 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
238 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
239 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
240 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
241 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
242 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
243 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
244 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
245 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
246 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
247 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
248 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
249 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
250 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
251 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
252 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
253 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
256 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
257 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
258 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
259 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
260 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
261 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
262 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.24
Metatranscriptomes 15.2
Isolates 3.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.41
Nodule 0.24
Rhizoplane 4.51
Rhizosphere 85.27
Stem 0
Stem Tuber 0
Unclassified 3.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000312 3300002773 Bacteria 31247
2 JGI25151J46595_10000324 3300003187 Bacteria 51796
3 JGI25151J46595_10051097 3300003187 Bacteria 1402
4 JGI25151J46595_10070059 3300003187 Bacteria 1067
5 JGI25151J46595_10077730 3300003187 Bacteria 974
6 JGI26145J50221_1001607 3300003371 Bacteria 1784
7 JGI26143J51219_1001428 3300003502 Bacteria 975
8 Ga0055526_1018358 3300003771 Bacteria 2613
9 Ga0055526_1029225 3300003771 Bacteria 1643
10 Ga0055524_1023000 3300003775 Bacteria 2018
11 Ga0055536_1000952 3300003781 Bacteria 18535
12 Ga0055536_1024099 3300003781 Bacteria 1772
13 Ga0055534_1009514 3300003784 Bacteria 2105
14 Ga0055528_1024945 3300003790 Bacteria 1774
15 Ga0055530_10002625 3300003791 Bacteria 11285
16 Ga0055540_1025224 3300003792 Bacteria 1460
17 Ga0055531_10042823 3300003794 Bacteria 1289
18 Ga0058860_11988552 3300004801 Bacteria 798
19 Ga0065714_10021854 3300005288 Bacteria 1431
20 Ga0065714_10200207 3300005288 Bacteria 879
21 Ga0065714_10519501 3300005288 Bacteria 513
22 Ga0065715_10157824 3300005293 Bacteria 1647
23 Ga0065715_10453529 3300005293 Bacteria 811
24 Ga0070670_101079614 3300005331 Bacteria 732
25 Ga0070668_100066041 3300005347 Bacteria 2806
26 Ga0070668_101313260 3300005347 Bacteria 658
27 Ga0070671_100048887 3300005355 Bacteria 3518
28 Ga0070671_100100999 3300005355 Bacteria 2420
29 Ga0070662_100443290 3300005457 Bacteria 1077
30 Ga0070685_10644890 3300005466 Bacteria 767
31 Ga0068857_100781590 3300005577 Bacteria 911
32 Ga0068852_100131906 3300005616 Bacteria 2302
33 Ga0068864_100068441 3300005618 Bacteria 3084
34 Ga0068870_10575476 3300005840 Bacteria 762
35 Ga0068862_100238649 3300005844 Bacteria 1652
36 Ga0068862_100239203 3300005844 Bacteria 1650
37 Ga0075428_100387708 3300006844 Bacteria 1498
38 Ga0075428_102263942 3300006844 Bacteria 560
39 Ga0075431_101463953 3300006847 Bacteria 642
40 Ga0099826_10177938 3300006948 Bacteria 1187
41 Ga0105249_10799651 3300009553 Bacteria 1007
42 Ga0105032_101669 3300009979 Bacteria 2013
43 Ga0157317_1002947 3300012475 Bacteria 1034
44 Ga0157320_1001917 3300012481 Bacteria 1115
45 Ga0157321_1006780 3300012487 Bacteria 789
46 Ga0157343_1012313 3300012488 Bacteria 675
47 Ga0157322_1000020 3300012490 Bacteria 2722
48 Ga0157329_1008795 3300012491 Bacteria 761
49 Ga0157323_1000864 3300012495 Bacteria 1404
50 Ga0157319_1002768 3300012497 Bacteria 1034
51 Ga0157345_1012008 3300012498 Bacteria 777
52 Ga0157314_1001929 3300012500 Bacteria 1447
53 Ga0157313_1002164 3300012503 Bacteria 1146
54 Ga0157342_1012277 3300012507 Bacteria 900
55 Ga0157315_1007046 3300012508 Bacteria 899
56 Ga0157315_1007766 3300012508 Bacteria 879
57 Ga0157316_1000645 3300012510 Bacteria 1903
58 Ga0157327_1000490 3300012512 Bacteria 2137
59 Ga0157371_10966412 3300013102 Bacteria 648
60 Ga0157372_10460167 3300013307 Bacteria 1483
61 Ga0157375_10409909 3300013308 Bacteria 1521
62 Ga0157380_10107272 3300014326 Bacteria 2339
63 Ga0157380_10930978 3300014326 Bacteria 897
64 Ga0157380_11051058 3300014326 Bacteria 851
65 Ga0183360_10004 3300015689 Bacteria 289992
66 Ga0163161_10764738 3300017792 Bacteria 809
67 Ga0209673_1018682 3300025273 Bacteria 2512
68 Ga0209130_1006613 3300025284 Bacteria 3733
69 Ga0209675_1014411 3300025291 Bacteria 2409
70 Ga0209676_1000035 3300025292 Bacteria 459284
71 Ga0209025_1000546 3300025294 Bacteria 70540
72 Ga0209025_1001609 3300025294 Bacteria 28293
73 Ga0209564_1010132 3300025295 Bacteria 4383
74 Ga0209050_1000819 3300025298 Bacteria 43369
75 Ga0209256_1013071 3300025299 Bacteria 3111
76 Ga0209256_1072004 3300025299 Bacteria 775
77 Ga0209051_1007309 3300025303 Bacteria 6061
78 Ga0209257_1024228 3300025304 Bacteria 2106
79 Ga0207697_10338123 3300025315 Bacteria 668
80 Ga0207650_10945062 3300025925 Bacteria 732
81 Ga0207650_11026820 3300025925 Bacteria 701
82 Ga0207659_10887881 3300025926 Bacteria 766
83 Ga0207644_10014691 3300025931 Bacteria 5246
84 Ga0207644_10067803 3300025931 Bacteria 2601
85 Ga0207706_10446411 3300025933 Bacteria 1119
86 Ga0207691_10345155 3300025940 Bacteria 1274
87 Ga0207711_10145915 3300025941 Bacteria 2132
88 Ga0207712_10559676 3300025961 Bacteria 984
89 Ga0207668_10132131 3300025972 Bacteria 1907
90 Ga0207703_10950700 3300026035 Bacteria 824
91 Ga0207639_11919074 3300026041 Bacteria 553
92 Ga0207641_10097187 3300026088 Bacteria 2588
93 Ga0207676_10151715 3300026095 Bacteria 1996
94 Ga0207683_12013378 3300026121 Bacteria 526
95 Ga0207698_10511725 3300026142 Bacteria 1170
96 Ga0209969_1010540 3300027360 Bacteria 1323
97 Ga0209967_1037108 3300027364 Bacteria 737
98 Ga0209996_1041213 3300027395 Bacteria 687
99 Ga0209984_1001826 3300027424 Bacteria 2340
100 Ga0210000_1004400 3300027462 Bacteria 2036
101 Ga0209995_1007089 3300027471 Bacteria 1807
102 Ga0209968_1032835 3300027526 Bacteria 871
103 Ga0209999_1001428 3300027543 Bacteria 4099
104 Ga0209982_1002527 3300027552 Bacteria 2572
105 Ga0209970_1001515 3300027614 Bacteria 4054
106 Ga0210002_1006683 3300027617 Bacteria 1742
107 Ga0209983_1001086 3300027665 Bacteria 5998
108 Ga0209983_1016184 3300027665 Bacteria 1539
109 Ga0209971_1000834 3300027682 Bacteria 7940
110 Ga0209974_10026481 3300027876 Bacteria 1920
111 Ga0268265_10146213 3300028380 Bacteria 1986
112 Ga0268265_10632905 3300028380 Bacteria 1026
113 Ga0316177_1192159 3300030731 Bacteria 3938
114 Ga0316176_1083343 3300030732 Bacteria 2033
115 Ga0314311_1160650 3300030733 Bacteria 2225
116 Ga0307408_100021618 3300031548 Bacteria 4357
117 Ga0307408_100222047 3300031548 Bacteria 1542
118 Ga0307408_100480262 3300031548 Bacteria 1084
119 Ga0307408_101032857 3300031548 Bacteria 759
120 Ga0307408_102241296 3300031548 Bacteria 528
121 Ga0307405_10067691 3300031731 Bacteria 2282
122 Ga0307405_10145774 3300031731 Bacteria 1658
123 Ga0307405_10370073 3300031731 Bacteria 1112
124 Ga0307405_10604269 3300031731 Bacteria 895
125 Ga0307413_10014835 3300031824 Bacteria 3973
126 Ga0307413_10043349 3300031824 Bacteria 2651
127 Ga0307413_10081886 3300031824 Bacteria 2071
128 Ga0307413_10093695 3300031824 Bacteria 1964
129 Ga0307413_10168470 3300031824 Bacteria 1547
130 Ga0307413_10391855 3300031824 Bacteria 1085
131 Ga0307413_10425546 3300031824 Bacteria 1047
132 Ga0307413_10485617 3300031824 Bacteria 988
133 Ga0307410_10120261 3300031852 Bacteria 1914
134 Ga0307410_10252623 3300031852 Bacteria 1371
135 Ga0307410_10440870 3300031852 Bacteria 1060
136 Ga0307410_10858775 3300031852 Bacteria 775
137 Ga0307406_10003753 3300031901 Bacteria 8260
138 Ga0307406_10197033 3300031901 Bacteria 1479
139 Ga0307406_10446492 3300031901 Bacteria 1036
140 Ga0307407_10219218 3300031903 Bacteria 1285
141 Ga0307412_10013064 3300031911 Bacteria 4857
142 Ga0307412_10154250 3300031911 Bacteria 1698
143 Ga0307412_10268625 3300031911 Bacteria 1333
144 Ga0307412_10315886 3300031911 Bacteria 1241
145 Ga0307412_10751510 3300031911 Bacteria 842
146 Ga0307409_100265790 3300031995 Bacteria 1577
147 Ga0307416_100364631 3300032002 Bacteria 1468
148 Ga0307416_100607152 3300032002 Bacteria 1174
149 Ga0307416_101470603 3300032002 Bacteria 787
150 Ga0307414_10001036 3300032004 Bacteria 14214
151 Ga0307414_10002666 3300032004 Bacteria 9388
152 Ga0307414_10022584 3300032004 Bacteria 3972
153 Ga0307414_10032425 3300032004 Bacteria 3439
154 Ga0307414_10035269 3300032004 Bacteria 3327
155 Ga0307414_10035771 3300032004 Bacteria 3308
156 Ga0307414_10089247 3300032004 Bacteria 2284
157 Ga0307414_10386569 3300032004 Bacteria 1211
158 Ga0307414_10769836 3300032004 Bacteria 876
159 Ga0307414_10911426 3300032004 Bacteria 806
160 Ga0307414_11055508 3300032004 Bacteria 749
161 Ga0307414_11279398 3300032004 Bacteria 680
162 Ga0307414_11309736 3300032004 Bacteria 672
163 Ga0307414_11562470 3300032004 Bacteria 614
164 Ga0307411_10016644 3300032005 Bacteria 4165
165 Ga0307411_10089673 3300032005 Bacteria 2142
166 Ga0307411_10197291 3300032005 Bacteria 1542
167 Ga0307411_12178774 3300032005 Bacteria 519
168 Ga0307415_100289938 3300032126 Bacteria 1350
169 Ga0307415_100368927 3300032126 Bacteria 1215
170 Ga0307415_100492964 3300032126 Bacteria 1069
171 Ga0307415_100958850 3300032126 Bacteria 792
172 Ga0373959_0057463 3300034820 Bacteria 854
173 Ga0373951_0114629 3300035091 Bacteria 728
174 Ga0395899_0074735 3300037312 Bacteria 2475
175 Ga0395900_0573018 3300037418 Bacteria 1071
176 Ga0395898_0511118 3300037466 Bacteria 1142
177 Ga0395905_0007229 3300037471 Bacteria 11068
178 Ga0395905_0379334 3300037471 Bacteria 1308
179 Ga0395905_1114442 3300037471 Bacteria 692
180 Ga0395901_0142128 3300038443 Bacteria 2522
181 Ga0237816_00839 3300039145 Bacteria 2521
182 Ga0439436_0019534 3300041404 Bacteria 2022
183 Ga0439436_0058909 3300041404 Bacteria 1076
184 Ga0439436_0061026 3300041404 Bacteria 1056
185 Ga0439436_0106776 3300041404 Bacteria 781
186 Ga0439447_034685 3300041407 Bacteria 1253
187 Ga0439466_0137997 3300041411 Bacteria 749
188 Ga0439465_0000046 3300041413 Bacteria 25484
189 Ga0439465_0001948 3300041413 Bacteria 6769
190 Ga0439465_0007663 3300041413 Bacteria 3425
191 Ga0439465_0147941 3300041413 Bacteria 837
192 Ga0451837_0670496 3300041494 Bacteria 591
193 Ga0451837_1258706 3300041494 Bacteria 505
194 Ga0451853_0284673 3300041512 Bacteria 778
195 Ga0439433_0027627 3300041999 Bacteria 1288
196 Ga0439433_0214475 3300041999 Bacteria 512
197 Ga0439445_0032547 3300042004 Bacteria 1360
198 Ga0439445_0033185 3300042004 Bacteria 1348
199 Ga0439445_0037651 3300042004 Bacteria 1277
200 Ga0439445_0126240 3300042004 Bacteria 736
201 Ga0439432_012037 3300042006 Bacteria 2970
202 Ga0439432_098673 3300042006 Bacteria 875
203 Ga0439449_0000068 3300042007 Bacteria 32267
204 Ga0439449_0002768 3300042007 Bacteria 6822
205 Ga0439449_0017191 3300042007 Bacteria 2715
206 Ga0439449_0030354 3300042007 Bacteria 2014
207 Ga0439449_0030497 3300042007 Bacteria 2010
208 Ga0439449_0109693 3300042007 Bacteria 1022
209 Ga0439449_0134625 3300042007 Bacteria 919
210 Ga0439452_067413 3300042010 Bacteria 793
211 Ga0439452_129722 3300042010 Bacteria 535
212 Ga0439457_009480 3300042014 Bacteria 2265
213 Ga0439457_095083 3300042014 Bacteria 692
214 Ga0439462_0022236 3300042015 Bacteria 1658
215 Ga0439462_0076434 3300042015 Bacteria 912
216 Ga0450897_024208 3300042128 Bacteria 664
217 Ga0450894_012580 3300042131 Bacteria 1108
218 Ga0450898_106941 3300042134 Bacteria 589
219 Ga0450899_049032 3300042135 Bacteria 537
220 Ga0439434_0072175 3300042435 Bacteria 1088
221 Ga0439440_0020258 3300042993 Bacteria 1490
222 Ga0453684_0000937 3300044712 Bacteria 96425
223 Ga0451576_0000430 3300045051 Bacteria 96425
224 Ga0466958_0076870 3300045836 Bacteria 2050
225 Ga0466967_0292669 3300045976 Bacteria 1565
226 Ga0495663_0214274 3300046525 Bacteria 675
227 Ga0495663_0243401 3300046525 Bacteria 637
228 Ga0495598_0117207 3300046537 Bacteria 899
229 Ga0495621_0000877 3300046539 Bacteria 7685
230 Ga0495621_0015809 3300046539 Bacteria 2412
231 Ga0495656_0001731 3300046615 Bacteria 7145
232 Ga0495656_0002255 3300046615 Bacteria 6372
233 Ga0495659_0413209 3300046664 Bacteria 583
234 Ga0495661_0555765 3300046665 Bacteria 543
235 Ga0495670_0054950 3300046691 Bacteria 1996
236 Ga0495670_0060989 3300046691 Bacteria 1895
237 Ga0495670_0184027 3300046691 Bacteria 1104
238 Ga0495581_0481353 3300047315 Bacteria 722
239 Ga0495636_0002734 3300047318 Bacteria 6798
240 Ga0495636_0003404 3300047318 Bacteria 6170
241 Ga0495636_0016931 3300047318 Bacteria 2914
242 Ga0495636_0265090 3300047318 Bacteria 797
243 Ga0495677_0147892 3300047445 Bacteria 904
244 Ga0495677_0153774 3300047445 Bacteria 886
245 Ga0495677_0251377 3300047445 Bacteria 691
246 Ga0495685_008036 3300047447 Bacteria 3495
247 Ga0495615_0080507 3300048090 Bacteria 892
248 Ga0496100_0328800 3300048903 Bacteria 1150
249 Ga0496100_0363069 3300048903 Bacteria 1096
250 Ga0496101_0430284 3300048904 Bacteria 1040
251 Ga0496105_0266879 3300048908 Bacteria 1383
252 Ga0496106_0040625 3300048909 Bacteria 3484
253 Ga0496107_0055346 3300048910 Bacteria 2865
254 Ga0496108_0040958 3300048911 Bacteria 3865
255 Ga0496108_0081913 3300048911 Bacteria 2735
256 Ga0496109_0075107 3300048912 Bacteria 3108
257 Ga0496109_0145854 3300048912 Bacteria 2214
258 Ga0496110_0048386 3300048913 Bacteria 3727
259 Ga0496111_0077547 3300048914 Bacteria 2422
260 Ga0496111_0146141 3300048914 Bacteria 1753
261 Ga0496112_0032542 3300048915 Bacteria 5064
262 Ga0496112_0042879 3300048915 Bacteria 4428
263 Ga0496113_0011797 3300048916 Bacteria 5852
264 Ga0496113_0019980 3300048916 Bacteria 4699
265 Ga0496114_0097504 3300048917 Bacteria 2504
266 Ga0496114_0222357 3300048917 Bacteria 1658
267 Ga0496121_0009100 3300048924 Bacteria 11492
268 Ga0496125_0034404 3300048928 Bacteria 4467
269 Ga0501306_003014 3300049127 Bacteria 1781
270 Ga0501306_003779 3300049127 Bacteria 1654
271 Ga0501308_004962 3300049128 Bacteria 1306
272 Ga0501308_015023 3300049128 Bacteria 913
273 Ga0501308_017548 3300049128 Bacteria 867
274 Ga0501308_023720 3300049128 Bacteria 784
275 Ga0501310_001044 3300049130 Bacteria 2489
276 Ga0501310_001375 3300049130 Bacteria 2204
277 Ga0501341_08091 3300049131 Bacteria 667
278 Ga0501343_019001 3300049132 Bacteria 600
279 Ga0501343_019425 3300049132 Bacteria 595
280 Ga0501345_02021 3300049134 Bacteria 815
281 Ga0501304_003052 3300049160 Bacteria 1204
282 Ga0501304_004236 3300049160 Bacteria 1083
283 Ga0501305_001166 3300049161 Bacteria 2488
284 Ga0501305_008674 3300049161 Bacteria 1320
285 Ga0501305_010467 3300049161 Bacteria 1238
286 Ga0501305_040074 3300049161 Bacteria 759
287 Ga0501305_042564 3300049161 Bacteria 743
288 Ga0501307_002376 3300049162 Bacteria 1748
289 Ga0501307_002677 3300049162 Bacteria 1682
290 Ga0501307_012575 3300049162 Bacteria 1009
291 Ga0501307_041945 3300049162 Bacteria 667
292 Ga0501342_01532 3300049163 Bacteria 739
293 Ga0501290_014609 3300049513 Bacteria 1033
294 Ga0501292_036477 3300049515 Bacteria 839
295 Ga0501303_047432 3300049526 Bacteria 555
296 Ga0501311_009293 3300049527 Bacteria 1171
297 Ga0501312_001898 3300049528 Bacteria 2164
298 Ga0501312_003878 3300049528 Bacteria 1730
299 Ga0501312_020399 3300049528 Bacteria 980
300 Ga0501313_002010 3300049529 Bacteria 1878
301 Ga0501313_044724 3300049529 Bacteria 602
302 Ga0501314_002394 3300049530 Bacteria 1446
303 Ga0501314_044392 3300049530 Bacteria 525
304 Ga0501315_001030 3300049531 Bacteria 2224
305 Ga0501315_003468 3300049531 Bacteria 1581
306 Ga0501315_057551 3300049531 Bacteria 623
307 Ga0501316_004611 3300049532 Bacteria 1390
308 Ga0501316_057936 3300049532 Bacteria 569
309 Ga0501317_001204 3300049533 Bacteria 2167
310 Ga0501317_027563 3300049533 Bacteria 807
311 Ga0501318_001031 3300049534 Bacteria 2052
312 Ga0501318_037487 3300049534 Bacteria 682
313 Ga0501319_005326 3300049535 Bacteria 920
314 Ga0501320_000408 3300049536 Bacteria 2445
315 Ga0501321_000803 3300049537 Bacteria 2237
316 Ga0501321_001207 3300049537 Bacteria 1993
317 Ga0501323_003098 3300049539 Bacteria 1672
318 Ga0501324_009225 3300049540 Bacteria 882
319 Ga0501325_003948 3300049541 Bacteria 1109
320 Ga0501325_004534 3300049541 Bacteria 1068
321 Ga0501327_02304 3300049543 Bacteria 985
322 Ga0501328_02034 3300049544 Bacteria 863
323 Ga0501330_004329 3300049546 Bacteria 876
324 Ga0501331_00413 3300049547 Bacteria 1747
325 Ga0501331_03605 3300049547 Bacteria 839
326 Ga0501332_03673 3300049548 Bacteria 894
327 Ga0501332_12780 3300049548 Bacteria 579
328 Ga0501333_000403 3300049549 Bacteria 1945
329 Ga0501334_03199 3300049550 Bacteria 1007
330 Ga0501335_008725 3300049551 Bacteria 957
331 Ga0501336_004789 3300049552 Bacteria 960
332 Ga0501336_021764 3300049552 Bacteria 588
333 Ga0501340_001649 3300049556 Bacteria 1228
334 Ga0501340_017766 3300049556 Bacteria 577
335 Ga0501031_0005533 3300049568 Bacteria 8223
336 Ga0501031_0034929 3300049568 Bacteria 3280
337 Ga0501032_0008534 3300049569 Bacteria 7472
338 Ga0501032_0139369 3300049569 Bacteria 1597
339 Ga0501033_0493089 3300049570 Bacteria 848
340 Ga0501034_0000637 3300049571 Bacteria 54474
341 Ga0501034_0001650 3300049571 Bacteria 28818
342 Ga0501034_0008788 3300049571 Bacteria 10630
343 Ga0501034_0011424 3300049571 Bacteria 9202
344 Ga0501036_0007357 3300049572 Bacteria 8971
345 Ga0501036_0179549 3300049572 Bacteria 1782
346 Ga0501037_0006033 3300049573 Bacteria 8844
347 Ga0501037_0455252 3300049573 Bacteria 872
348 Ga0501038_0007572 3300049574 Bacteria 10013
349 Ga0501038_0037922 3300049574 Bacteria 4222
350 Ga0501039_0006567 3300049575 Bacteria 8829
351 Ga0501039_0046603 3300049575 Bacteria 3349
352 Ga0501043_0002889 3300049579 Bacteria 14350
353 Ga0501043_0009678 3300049579 Bacteria 7554
354 Ga0501043_0026298 3300049579 Bacteria 4566
355 Ga0501046_0135712 3300049580 Bacteria 1864
356 Ga0501047_0075161 3300049581 Bacteria 3251
357 Ga0501047_0325833 3300049581 Bacteria 1375
358 Ga0501048_0113654 3300049582 Bacteria 1913
359 Ga0501048_0522828 3300049582 Bacteria 851
360 Ga0501068_0004137 3300049584 Bacteria 7865
361 Ga0501070_0022855 3300049586 Bacteria 5234
362 Ga0501070_0457578 3300049586 Bacteria 1028
363 Ga0501073_0015952 3300049589 Bacteria 5444
364 Ga0501198_013843 3300049649 Bacteria 1225
365 Ga0501201_016046 3300049651 Bacteria 765
366 Ga0501208_076085 3300049655 Bacteria 683
367 Ga0501216_019787 3300049660 Bacteria 1171
368 Ga0501217_052247 3300049661 Bacteria 1071
369 Ga0501222_072338 3300049662 Bacteria 538
370 Ga0501223_026945 3300049663 Bacteria 1119
371 Ga0501235_031017 3300049669 Bacteria 1206
372 Ga0501238_025899 3300049671 Bacteria 841
373 Ga0501240_002323 3300049673 Bacteria 2003
374 Ga0501240_022455 3300049673 Bacteria 961
375 Ga0501242_004538 3300049674 Bacteria 1542
376 Ga0501243_021495 3300049675 Bacteria 1066
377 Ga0501247_004688 3300049677 Bacteria 1504
378 Ga0501250_001076 3300049680 Bacteria 2123
379 Ga0501251_004740 3300049681 Bacteria 1414
380 Ga0501252_005480 3300049682 Bacteria 1382
381 Ga0501252_064914 3300049682 Bacteria 577
382 Ga0501253_041279 3300049683 Bacteria 930
383 Ga0501257_107424 3300049686 Bacteria 737
384 Ga0501259_025965 3300049688 Bacteria 1076
385 Ga0501259_100733 3300049688 Bacteria 662
386 Ga0501260_003182 3300049689 Bacteria 1463
387 Ga0501260_036073 3300049689 Bacteria 586
388 Ga0501221_037748 3300049704 Bacteria 1041
389 Ga0501225_0029006 3300049705 Bacteria 1520
390 Ga0501225_0104437 3300049705 Bacteria 830
391 Ga0501234_042289 3300049707 Bacteria 748
392 Ga0501245_012441 3300049708 Bacteria 1249
393 Ga0501080_0004451 3300049742 Bacteria 12468
394 Ga0501241_012433 3300049758 Bacteria 1547
395 Ga0501266_002361 3300049763 Bacteria 2387
396 Ga0501267_019629 3300049764 Bacteria 739
397 Ga0501268_063848 3300049765 Bacteria 734
398 Ga0501270_018942 3300049767 Bacteria 1026
399 Ga0501271_013014 3300049768 Bacteria 907
400 Ga0501272_016848 3300049769 Bacteria 857
401 Ga0501276_006107 3300049773 Bacteria 941
402 Ga0501035_0016349 3300049822 Bacteria 6843
403 Ga0501035_0255606 3300049822 Bacteria 1486
404 Ga0501044_0015440 3300049823 Bacteria 8225
405 Ga0501044_0403280 3300049823 Bacteria 1279
406 Ga0501044_0776968 3300049823 Bacteria 838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042006 Ga0439432_098673 Ga0439432_098673_17_370 117
2 3300042134 Ga0450898_106941 Ga0450898_106941_17_370 117
3 3300049529 Ga0501313_044724 Ga0501313_044724_226_591 118
4 3300048903 Ga0496100_0328800 Ga0496100_0328800_769_1128 119
5 3300049662 Ga0501222_072338 Ga0501222_072338_160_525 120
6 iso_pu_bacteria 2895522137 2895523122 126
7 iso_pu_bacteria 2895525241 2895527026 126
8 3300049547 Ga0501331_00413 Ga0501331_00413_1308_1691 127
9 3300049556 Ga0501340_017766 Ga0501340_017766_162_545 127
10 3300042007 Ga0439449_0134625 Ga0439449_0134625_24_413 128
11 3300047445 Ga0495677_0153774 Ga0495677_0153774_13_399 128
12 3300049128 Ga0501308_017548 Ga0501308_017548_462_848 128
13 3300049132 Ga0501343_019001 Ga0501343_019001_198_584 128
14 3300049132 Ga0501343_019425 Ga0501343_019425_17_403 128
15 3300049161 Ga0501305_042564 Ga0501305_042564_326_712 128
16 3300049548 Ga0501332_12780 Ga0501332_12780_13_399 128
17 3300049552 Ga0501336_021764 Ga0501336_021764_182_568 128
18 3300013102 Ga0157371_10966412 Ga0157371_109664122 129
19 3300013307 Ga0157372_10460167 Ga0157372_104601672 129
20 3300034820 Ga0373959_0057463 Ga0373959_0057463_206_595 129
21 3300035091 Ga0373951_0114629 Ga0373951_0114629_172_561 129
22 3300037471 Ga0395905_0379334 Ga0395905_0379334_21_410 129
23 3300041411 Ga0439466_0137997 Ga0439466_0137997_200_589 129
24 3300046539 Ga0495621_0015809 Ga0495621_0015809_26_421 129
25 3300046664 Ga0495659_0413209 Ga0495659_0413209_167_562 129
26 3300049551 Ga0501335_008725 Ga0501335_008725_232_624 129
27 3300049571 Ga0501034_0000637 Ga0501034_0000637_12825_13217 129
28 3300049573 Ga0501037_0455252 Ga0501037_0455252_29_418 129
29 3300049675 Ga0501243_021495 Ga0501243_021495_643_1035 129
30 3300039145 Ga0237816_00839 Ga0237816_00839_1460_1852 130
31 3300041404 Ga0439436_0058909 Ga0439436_0058909_319_717 130
32 3300041413 Ga0439465_0007663 Ga0439465_0007663_634_1029 130
33 3300042006 Ga0439432_012037 Ga0439432_012037_2513_2911 130
34 3300042007 Ga0439449_0017191 Ga0439449_0017191_1563_1961 130
35 3300042010 Ga0439452_129722 Ga0439452_129722_95_490 130
36 3300042015 Ga0439462_0022236 Ga0439462_0022236_1148_1546 130
37 3300049160 Ga0501304_003052 Ga0501304_003052_355_753 130
38 3300049513 Ga0501290_014609 Ga0501290_014609_377_775 130
39 3300049526 Ga0501303_047432 Ga0501303_047432_14_412 130
40 3300049537 Ga0501321_001207 Ga0501321_001207_288_686 130
41 3300049541 Ga0501325_004534 Ga0501325_004534_161_559 130
42 3300049651 Ga0501201_016046 Ga0501201_016046_59_457 130
43 3300049660 Ga0501216_019787 Ga0501216_019787_246_644 130
44 3300049682 Ga0501252_064914 Ga0501252_064914_157_555 130
45 3300049683 Ga0501253_041279 Ga0501253_041279_56_454 130
46 3300049705 Ga0501225_0029006 Ga0501225_0029006_592_990 130
47 3300049758 Ga0501241_012433 Ga0501241_012433_284_682 130
48 3300049764 Ga0501267_019629 Ga0501267_019629_11_409 130
49 3300049773 Ga0501276_006107 Ga0501276_006107_497_895 130
50 iso_pu_bacteria 2995948881 2995954142 132
51 3300047318 Ga0495636_0265090 Ga0495636_0265090_136_540 133
52 iso_pu_bacteria 8003014200 8003017180 133
53 iso_pu_bacteria 2643221559 2643817329 134
54 iso_pu_bacteria 2643221573 2643879954 134
55 iso_pu_bacteria 2643221586 2643939829 134
56 iso_pu_bacteria 2643221612 2644078357 134
57 iso_pu_bacteria 2643221720 2644662496 134
58 iso_pu_bacteria 2643221727 2644696803 134
59 iso_pu_bacteria 2643221728 2644701081 134
60 3300003187 JGI25151J46595_10000324 JGI25151J46595_1000032422 136
61 3300015689 Ga0183360_10004 Ga0183360_1000414 136
62 3300031548 Ga0307408_100021618 Ga0307408_1000216185 136
63 3300031901 Ga0307406_10003753 Ga0307406_100037533 136
64 3300032004 Ga0307414_10769836 Ga0307414_107698361 136
65 3300041404 Ga0439436_0019534 Ga0439436_0019534_187_600 136
66 3300041407 Ga0439447_034685 Ga0439447_034685_384_797 136
67 3300041999 Ga0439433_0214475 Ga0439433_0214475_35_448 136
68 3300044712 Ga0453684_0000937 Ga0453684_0000937_6901_7314 136
69 3300045051 Ga0451576_0000430 Ga0451576_0000430_6901_7314 136
70 3300048924 Ga0496121_0009100 Ga0496121_0009100_6135_6548 136
71 iso_pu_bacteria 2571042365 2572255625 136
72 iso_pu_bacteria 2923516293 2923516743 136
73 3300005347 Ga0070668_101313260 Ga0070668_1013132601 137
74 3300005844 Ga0068862_100239203 Ga0068862_1002392032 137
75 3300012498 Ga0157345_1012008 Ga0157345_10120082 137
76 3300014326 Ga0157380_10930978 Ga0157380_109309781 137
77 3300028380 Ga0268265_10632905 Ga0268265_106329052 137
78 3300031731 Ga0307405_10145774 Ga0307405_101457742 137
79 3300031901 Ga0307406_10446492 Ga0307406_104464922 137
80 3300031911 Ga0307412_10013064 Ga0307412_100130645 137
81 3300032002 Ga0307416_101470603 Ga0307416_1014706032 137
82 3300041404 Ga0439436_0061026 Ga0439436_0061026_126_542 137
83 3300046525 Ga0495663_0243401 Ga0495663_0243401_177_593 137
84 3300046615 Ga0495656_0002255 Ga0495656_0002255_2928_3344 137
85 3300046691 Ga0495670_0060989 Ga0495670_0060989_992_1408 137
86 3300047318 Ga0495636_0016931 Ga0495636_0016931_932_1348 137
87 3300049530 Ga0501314_044392 Ga0501314_044392_39_455 137
88 iso_pu_bacteria 2895498888 2895503284 137
89 iso_pu_bacteria 2895511927 2895513127 137
90 3300003187 JGI25151J46595_10051097 JGI25151J46595_100510971 138
91 3300003187 JGI25151J46595_10070059 JGI25151J46595_100700592 138
92 3300003771 Ga0055526_1018358 Ga0055526_10183582 138
93 3300003771 Ga0055526_1029225 Ga0055526_10292253 138
94 3300003775 Ga0055524_1023000 Ga0055524_10230002 138
95 3300003781 Ga0055536_1024099 Ga0055536_10240992 138
96 3300003784 Ga0055534_1009514 Ga0055534_10095142 138
97 3300003790 Ga0055528_1024945 Ga0055528_10249451 138
98 3300003791 Ga0055530_10002625 Ga0055530_100026252 138
99 3300003792 Ga0055540_1025224 Ga0055540_10252242 138
100 3300003794 Ga0055531_10042823 Ga0055531_100428231 138
101 3300005844 Ga0068862_100238649 Ga0068862_1002386492 138
102 3300006948 Ga0099826_10177938 Ga0099826_101779382 138
103 3300012512 Ga0157327_1000490 Ga0157327_10004902 138
104 3300025273 Ga0209673_1018682 Ga0209673_10186823 138
105 3300025284 Ga0209130_1006613 Ga0209130_10066132 138
106 3300025291 Ga0209675_1014411 Ga0209675_10144113 138
107 3300025294 Ga0209025_1000546 Ga0209025_100054656 138
108 3300025295 Ga0209564_1010132 Ga0209564_10101324 138
109 3300025298 Ga0209050_1000819 Ga0209050_100081934 138
110 3300025299 Ga0209256_1013071 Ga0209256_10130713 138
111 3300025299 Ga0209256_1072004 Ga0209256_10720042 138
112 3300025303 Ga0209051_1007309 Ga0209051_10073097 138
113 3300025304 Ga0209257_1024228 Ga0209257_10242284 138
114 3300025315 Ga0207697_10338123 Ga0207697_103381231 138
115 3300025925 Ga0207650_10945062 Ga0207650_109450622 138
116 3300031548 Ga0307408_102241296 Ga0307408_1022412961 138
117 3300031731 Ga0307405_10370073 Ga0307405_103700731 138
118 3300031824 Ga0307413_10093695 Ga0307413_100936952 138
119 3300031852 Ga0307410_10120261 Ga0307410_101202613 138
120 3300032004 Ga0307414_10035771 Ga0307414_100357716 138
121 3300032005 Ga0307411_10089673 Ga0307411_100896733 138
122 3300032126 Ga0307415_100368927 Ga0307415_1003689272 138
123 3300041413 Ga0439465_0147941 Ga0439465_0147941_152_571 138
124 3300042014 Ga0439457_009480 Ga0439457_009480_1765_2184 138
125 3300042135 Ga0450899_049032 Ga0450899_049032_101_520 138
126 3300045836 Ga0466958_0076870 Ga0466958_0076870_150_593 138
127 3300049131 Ga0501341_08091 Ga0501341_08091_226_645 138
128 3300049134 Ga0501345_02021 Ga0501345_02021_197_616 138
129 3300049161 Ga0501305_008674 Ga0501305_008674_455_874 138
130 3300049162 Ga0501307_002677 Ga0501307_002677_438_857 138
131 3300049528 Ga0501312_020399 Ga0501312_020399_256_675 138
132 3300049532 Ga0501316_057936 Ga0501316_057936_61_486 138
133 3300049543 Ga0501327_02304 Ga0501327_02304_139_558 138
134 3300049579 Ga0501043_0002889 Ga0501043_0002889_1579_1998 138
135 3300003187 JGI25151J46595_10077730 JGI25151J46595_100777302 139
136 3300004801 Ga0058860_11988552 Ga0058860_119885521 139
137 3300005331 Ga0070670_101079614 Ga0070670_1010796142 139
138 3300005355 Ga0070671_100048887 Ga0070671_1000488874 139
139 3300005457 Ga0070662_100443290 Ga0070662_1004432902 139
140 3300005466 Ga0070685_10644890 Ga0070685_106448902 139
141 3300005577 Ga0068857_100781590 Ga0068857_1007815902 139
142 3300005616 Ga0068852_100131906 Ga0068852_1001319062 139
143 3300005618 Ga0068864_100068441 Ga0068864_1000684414 139
144 3300005840 Ga0068870_10575476 Ga0068870_105754762 139
145 3300006844 Ga0075428_100387708 Ga0075428_1003877082 139
146 3300009553 Ga0105249_10799651 Ga0105249_107996512 139
147 3300009979 Ga0105032_101669 Ga0105032_1016691 139
148 3300012475 Ga0157317_1002947 Ga0157317_10029472 139
149 3300012481 Ga0157320_1001917 Ga0157320_10019172 139
150 3300012487 Ga0157321_1006780 Ga0157321_10067802 139
151 3300012490 Ga0157322_1000020 Ga0157322_10000203 139
152 3300012491 Ga0157329_1008795 Ga0157329_10087951 139
153 3300012495 Ga0157323_1000864 Ga0157323_10008641 139
154 3300012497 Ga0157319_1002768 Ga0157319_10027682 139
155 3300012500 Ga0157314_1001929 Ga0157314_10019292 139
156 3300012503 Ga0157313_1002164 Ga0157313_10021642 139
157 3300012507 Ga0157342_1012277 Ga0157342_10122772 139
158 3300012508 Ga0157315_1007046 Ga0157315_10070461 139
159 3300012510 Ga0157316_1000645 Ga0157316_10006453 139
160 3300014326 Ga0157380_11051058 Ga0157380_110510582 139
161 3300017792 Ga0163161_10764738 Ga0163161_107647381 139
162 3300025294 Ga0209025_1001609 Ga0209025_100160921 139
163 3300025925 Ga0207650_11026820 Ga0207650_110268201 139
164 3300025926 Ga0207659_10887881 Ga0207659_108878811 139
165 3300025931 Ga0207644_10067803 Ga0207644_100678033 139
166 3300025933 Ga0207706_10446411 Ga0207706_104464112 139
167 3300025940 Ga0207691_10345155 Ga0207691_103451552 139
168 3300025941 Ga0207711_10145915 Ga0207711_101459153 139
169 3300025961 Ga0207712_10559676 Ga0207712_105596762 139
170 3300026035 Ga0207703_10950700 Ga0207703_109507002 139
171 3300026088 Ga0207641_10097187 Ga0207641_100971872 139
172 3300026095 Ga0207676_10151715 Ga0207676_101517152 139
173 3300026121 Ga0207683_12013378 Ga0207683_120133781 139
174 3300026142 Ga0207698_10511725 Ga0207698_105117252 139
175 3300028380 Ga0268265_10146213 Ga0268265_101462132 139
176 3300031548 Ga0307408_100480262 Ga0307408_1004802622 139
177 3300031548 Ga0307408_101032857 Ga0307408_1010328572 139
178 3300031852 Ga0307410_10440870 Ga0307410_104408702 139
179 3300031911 Ga0307412_10315886 Ga0307412_103158862 139
180 3300031911 Ga0307412_10751510 Ga0307412_107515102 139
181 3300032005 Ga0307411_12178774 Ga0307411_121787741 139
182 3300032126 Ga0307415_100958850 Ga0307415_1009588502 139
183 3300041413 Ga0439465_0001948 Ga0439465_0001948_5313_5735 139
184 3300041494 Ga0451837_1258706 Ga0451837_1258706_19_444 139
185 3300041512 Ga0451853_0284673 Ga0451853_0284673_247_669 139
186 3300042007 Ga0439449_0002768 Ga0439449_0002768_5079_5501 139
187 3300042007 Ga0439449_0030354 Ga0439449_0030354_534_956 139
188 3300042010 Ga0439452_067413 Ga0439452_067413_196_618 139
189 3300046525 Ga0495663_0214274 Ga0495663_0214274_218_640 139
190 3300046537 Ga0495598_0117207 Ga0495598_0117207_290_715 139
191 3300046539 Ga0495621_0000877 Ga0495621_0000877_1470_1895 139
192 3300046615 Ga0495656_0001731 Ga0495656_0001731_3781_4203 139
193 3300046691 Ga0495670_0184027 Ga0495670_0184027_206_628 139
194 3300047315 Ga0495581_0481353 Ga0495581_0481353_74_496 139
195 3300047318 Ga0495636_0003404 Ga0495636_0003404_823_1245 139
196 3300047445 Ga0495677_0147892 Ga0495677_0147892_115_537 139
197 3300048090 Ga0495615_0080507 Ga0495615_0080507_278_700 139
198 3300048904 Ga0496101_0430284 Ga0496101_0430284_146_568 139
199 3300048908 Ga0496105_0266879 Ga0496105_0266879_509_931 139
200 3300048909 Ga0496106_0040625 Ga0496106_0040625_2418_2840 139
201 3300048910 Ga0496107_0055346 Ga0496107_0055346_555_977 139
202 3300048911 Ga0496108_0081913 Ga0496108_0081913_532_954 139
203 3300048912 Ga0496109_0145854 Ga0496109_0145854_955_1377 139
204 3300048913 Ga0496110_0048386 Ga0496110_0048386_1998_2420 139
205 3300048914 Ga0496111_0077547 Ga0496111_0077547_1308_1730 139
206 3300048915 Ga0496112_0042879 Ga0496112_0042879_404_826 139
207 3300048916 Ga0496113_0019980 Ga0496113_0019980_2353_2775 139
208 3300048917 Ga0496114_0097504 Ga0496114_0097504_1225_1647 139
209 3300048928 Ga0496125_0034404 Ga0496125_0034404_3667_4092 139
210 3300049161 Ga0501305_040074 Ga0501305_040074_45_467 139
211 3300049162 Ga0501307_041945 Ga0501307_041945_26_448 139
212 3300049531 Ga0501315_057551 Ga0501315_057551_17_439 139
213 3300049556 Ga0501340_001649 Ga0501340_001649_359_784 139
214 3300003371 JGI26145J50221_1001607 JGI26145J50221_10016072 140
215 3300003502 JGI26143J51219_1001428 JGI26143J51219_10014282 140
216 3300003781 Ga0055536_1000952 Ga0055536_100095215 140
217 3300005288 Ga0065714_10021854 Ga0065714_100218542 140
218 3300005288 Ga0065714_10200207 Ga0065714_102002072 140
219 3300005288 Ga0065714_10519501 Ga0065714_105195011 140
220 3300005293 Ga0065715_10157824 Ga0065715_101578242 140
221 3300005293 Ga0065715_10453529 Ga0065715_104535291 140
222 3300005347 Ga0070668_100066041 Ga0070668_1000660413 140
223 3300005355 Ga0070671_100100999 Ga0070671_1001009992 140
224 3300006844 Ga0075428_102263942 Ga0075428_1022639421 140
225 3300006847 Ga0075431_101463953 Ga0075431_1014639532 140
226 3300012488 Ga0157343_1012313 Ga0157343_10123132 140
227 3300012508 Ga0157315_1007766 Ga0157315_10077662 140
228 3300013308 Ga0157375_10409909 Ga0157375_104099093 140
229 3300014326 Ga0157380_10107272 Ga0157380_101072723 140
230 3300025292 Ga0209676_1000035 Ga0209676_100003579 140
231 3300025931 Ga0207644_10014691 Ga0207644_100146913 140
232 3300025972 Ga0207668_10132131 Ga0207668_101321313 140
233 3300026041 Ga0207639_11919074 Ga0207639_119190742 140
234 3300027360 Ga0209969_1010540 Ga0209969_10105401 140
235 3300027364 Ga0209967_1037108 Ga0209967_10371082 140
236 3300027395 Ga0209996_1041213 Ga0209996_10412132 140
237 3300027424 Ga0209984_1001826 Ga0209984_10018263 140
238 3300027462 Ga0210000_1004400 Ga0210000_10044003 140
239 3300027471 Ga0209995_1007089 Ga0209995_10070892 140
240 3300027526 Ga0209968_1032835 Ga0209968_10328352 140
241 3300027543 Ga0209999_1001428 Ga0209999_10014284 140
242 3300027552 Ga0209982_1002527 Ga0209982_10025274 140
243 3300027614 Ga0209970_1001515 Ga0209970_10015153 140
244 3300027617 Ga0210002_1006683 Ga0210002_10066832 140
245 3300027665 Ga0209983_1001086 Ga0209983_10010866 140
246 3300027665 Ga0209983_1016184 Ga0209983_10161843 140
247 3300027682 Ga0209971_1000834 Ga0209971_10008346 140
248 3300027876 Ga0209974_10026481 Ga0209974_100264812 140
249 3300030731 Ga0316177_1192159 Ga0316177_11921592 140
250 3300030732 Ga0316176_1083343 Ga0316176_10833432 140
251 3300030733 Ga0314311_1160650 Ga0314311_11606503 140
252 3300031731 Ga0307405_10067691 Ga0307405_100676913 140
253 3300031824 Ga0307413_10014835 Ga0307413_100148356 140
254 3300031824 Ga0307413_10043349 Ga0307413_100433492 140
255 3300031824 Ga0307413_10391855 Ga0307413_103918552 140
256 3300031824 Ga0307413_10425546 Ga0307413_104255462 140
257 3300031824 Ga0307413_10485617 Ga0307413_104856172 140
258 3300031901 Ga0307406_10197033 Ga0307406_101970332 140
259 3300031903 Ga0307407_10219218 Ga0307407_102192182 140
260 3300031911 Ga0307412_10154250 Ga0307412_101542502 140
261 3300032002 Ga0307416_100364631 Ga0307416_1003646312 140
262 3300032004 Ga0307414_10001036 Ga0307414_100010369 140
263 3300032004 Ga0307414_10002666 Ga0307414_100026668 140
264 3300032004 Ga0307414_10022584 Ga0307414_100225842 140
265 3300032004 Ga0307414_10035269 Ga0307414_100352694 140
266 3300032004 Ga0307414_10386569 Ga0307414_103865692 140
267 3300032004 Ga0307414_10911426 Ga0307414_109114261 140
268 3300032004 Ga0307414_11055508 Ga0307414_110555081 140
269 3300032004 Ga0307414_11279398 Ga0307414_112793982 140
270 3300032004 Ga0307414_11309736 Ga0307414_113097362 140
271 3300032004 Ga0307414_11562470 Ga0307414_115624701 140
272 3300032126 Ga0307415_100289938 Ga0307415_1002899382 140
273 3300037312 Ga0395899_0074735 Ga0395899_0074735_1981_2406 140
274 3300037418 Ga0395900_0573018 Ga0395900_0573018_23_448 140
275 3300037466 Ga0395898_0511118 Ga0395898_0511118_201_626 140
276 3300037471 Ga0395905_0007229 Ga0395905_0007229_80_505 140
277 3300037471 Ga0395905_1114442 Ga0395905_1114442_256_681 140
278 3300038443 Ga0395901_0142128 Ga0395901_0142128_1890_2315 140
279 3300041404 Ga0439436_0106776 Ga0439436_0106776_300_725 140
280 3300041494 Ga0451837_0670496 Ga0451837_0670496_105_530 140
281 3300041999 Ga0439433_0027627 Ga0439433_0027627_796_1221 140
282 3300042004 Ga0439445_0033185 Ga0439445_0033185_539_964 140
283 3300042004 Ga0439445_0037651 Ga0439445_0037651_329_754 140
284 3300042007 Ga0439449_0109693 Ga0439449_0109693_515_940 140
285 3300042128 Ga0450897_024208 Ga0450897_024208_203_628 140
286 3300042131 Ga0450894_012580 Ga0450894_012580_484_909 140
287 3300042993 Ga0439440_0020258 Ga0439440_0020258_41_466 140
288 3300045976 Ga0466967_0292669 Ga0466967_0292669_980_1405 140
289 3300046665 Ga0495661_0555765 Ga0495661_0555765_16_441 140
290 3300046691 Ga0495670_0054950 Ga0495670_0054950_183_614 140
291 3300047318 Ga0495636_0002734 Ga0495636_0002734_5516_5947 140
292 3300047445 Ga0495677_0251377 Ga0495677_0251377_250_681 140
293 3300047447 Ga0495685_008036 Ga0495685_008036_1113_1544 140
294 3300048903 Ga0496100_0363069 Ga0496100_0363069_184_609 140
295 3300048911 Ga0496108_0040958 Ga0496108_0040958_1066_1491 140
296 3300048912 Ga0496109_0075107 Ga0496109_0075107_1480_1905 140
297 3300048914 Ga0496111_0146141 Ga0496111_0146141_1153_1578 140
298 3300048915 Ga0496112_0032542 Ga0496112_0032542_4014_4439 140
299 3300048916 Ga0496113_0011797 Ga0496113_0011797_1276_1701 140
300 3300048917 Ga0496114_0222357 Ga0496114_0222357_358_783 140
301 3300049127 Ga0501306_003779 Ga0501306_003779_428_856 140
302 3300049128 Ga0501308_004962 Ga0501308_004962_538_966 140
303 3300049128 Ga0501308_023720 Ga0501308_023720_51_479 140
304 3300049130 Ga0501310_001044 Ga0501310_001044_1611_2039 140
305 3300049160 Ga0501304_004236 Ga0501304_004236_200_628 140
306 3300049161 Ga0501305_001166 Ga0501305_001166_1607_2035 140
307 3300049162 Ga0501307_002376 Ga0501307_002376_848_1276 140
308 3300049163 Ga0501342_01532 Ga0501342_01532_24_452 140
309 3300049515 Ga0501292_036477 Ga0501292_036477_384_812 140
310 3300049527 Ga0501311_009293 Ga0501311_009293_504_932 140
311 3300049528 Ga0501312_001898 Ga0501312_001898_1372_1800 140
312 3300049529 Ga0501313_002010 Ga0501313_002010_205_633 140
313 3300049531 Ga0501315_001030 Ga0501315_001030_1326_1754 140
314 3300049532 Ga0501316_004611 Ga0501316_004611_619_1047 140
315 3300049533 Ga0501317_001204 Ga0501317_001204_1418_1846 140
316 3300049534 Ga0501318_001031 Ga0501318_001031_1372_1800 140
317 3300049535 Ga0501319_005326 Ga0501319_005326_33_461 140
318 3300049536 Ga0501320_000408 Ga0501320_000408_1569_1997 140
319 3300049537 Ga0501321_000803 Ga0501321_000803_1373_1801 140
320 3300049540 Ga0501324_009225 Ga0501324_009225_333_761 140
321 3300049541 Ga0501325_003948 Ga0501325_003948_235_663 140
322 3300049546 Ga0501330_004329 Ga0501330_004329_229_657 140
323 3300049547 Ga0501331_03605 Ga0501331_03605_216_644 140
324 3300049548 Ga0501332_03673 Ga0501332_03673_209_637 140
325 3300049549 Ga0501333_000403 Ga0501333_000403_334_762 140
326 3300049550 Ga0501334_03199 Ga0501334_03199_236_664 140
327 3300049552 Ga0501336_004789 Ga0501336_004789_221_649 140
328 3300049568 Ga0501031_0005533 Ga0501031_0005533_4742_5167 140
329 3300049568 Ga0501031_0034929 Ga0501031_0034929_318_743 140
330 3300049569 Ga0501032_0008534 Ga0501032_0008534_3616_4041 140
331 3300049569 Ga0501032_0139369 Ga0501032_0139369_251_676 140
332 3300049570 Ga0501033_0493089 Ga0501033_0493089_11_436 140
333 3300049571 Ga0501034_0001650 Ga0501034_0001650_23292_23717 140
334 3300049571 Ga0501034_0008788 Ga0501034_0008788_5569_5994 140
335 3300049571 Ga0501034_0011424 Ga0501034_0011424_3113_3538 140
336 3300049572 Ga0501036_0007357 Ga0501036_0007357_4813_5238 140
337 3300049572 Ga0501036_0179549 Ga0501036_0179549_1110_1535 140
338 3300049573 Ga0501037_0006033 Ga0501037_0006033_3674_4099 140
339 3300049574 Ga0501038_0007572 Ga0501038_0007572_5291_5716 140
340 3300049574 Ga0501038_0037922 Ga0501038_0037922_2482_2907 140
341 3300049575 Ga0501039_0006567 Ga0501039_0006567_4863_5288 140
342 3300049575 Ga0501039_0046603 Ga0501039_0046603_904_1329 140
343 3300049579 Ga0501043_0009678 Ga0501043_0009678_4910_5335 140
344 3300049579 Ga0501043_0026298 Ga0501043_0026298_3767_4192 140
345 3300049580 Ga0501046_0135712 Ga0501046_0135712_906_1331 140
346 3300049581 Ga0501047_0075161 Ga0501047_0075161_858_1283 140
347 3300049581 Ga0501047_0325833 Ga0501047_0325833_432_857 140
348 3300049582 Ga0501048_0113654 Ga0501048_0113654_507_932 140
349 3300049582 Ga0501048_0522828 Ga0501048_0522828_287_712 140
350 3300049584 Ga0501068_0004137 Ga0501068_0004137_2605_3030 140
351 3300049586 Ga0501070_0022855 Ga0501070_0022855_2042_2467 140
352 3300049586 Ga0501070_0457578 Ga0501070_0457578_269_694 140
353 3300049589 Ga0501073_0015952 Ga0501073_0015952_1848_2273 140
354 3300049649 Ga0501198_013843 Ga0501198_013843_633_1061 140
355 3300049663 Ga0501223_026945 Ga0501223_026945_418_846 140
356 3300049673 Ga0501240_022455 Ga0501240_022455_337_765 140
357 3300049674 Ga0501242_004538 Ga0501242_004538_191_619 140
358 3300049677 Ga0501247_004688 Ga0501247_004688_1011_1439 140
359 3300049682 Ga0501252_005480 Ga0501252_005480_526_954 140
360 3300049686 Ga0501257_107424 Ga0501257_107424_133_561 140
361 3300049688 Ga0501259_100733 Ga0501259_100733_65_493 140
362 3300049689 Ga0501260_003182 Ga0501260_003182_849_1277 140
363 3300049704 Ga0501221_037748 Ga0501221_037748_262_690 140
364 3300049705 Ga0501225_0104437 Ga0501225_0104437_60_488 140
365 3300049707 Ga0501234_042289 Ga0501234_042289_116_544 140
366 3300049708 Ga0501245_012441 Ga0501245_012441_478_906 140
367 3300049742 Ga0501080_0004451 Ga0501080_0004451_7702_8127 140
368 3300049768 Ga0501271_013014 Ga0501271_013014_108_536 140
369 3300049822 Ga0501035_0016349 Ga0501035_0016349_5027_5452 140
370 3300049822 Ga0501035_0255606 Ga0501035_0255606_460_885 140
371 3300049823 Ga0501044_0015440 Ga0501044_0015440_4509_4934 140
372 3300049823 Ga0501044_0403280 Ga0501044_0403280_455_880 140
373 3300049823 Ga0501044_0776968 Ga0501044_0776968_302_727 140
374 3300002773 JGI25152J39213_1000312 JGI25152J39213_100031221 141
375 3300031548 Ga0307408_100222047 Ga0307408_1002220472 141
376 3300031731 Ga0307405_10604269 Ga0307405_106042692 141
377 3300031824 Ga0307413_10081886 Ga0307413_100818863 141
378 3300031824 Ga0307413_10168470 Ga0307413_101684702 141
379 3300031852 Ga0307410_10252623 Ga0307410_102526232 141
380 3300031852 Ga0307410_10858775 Ga0307410_108587751 141
381 3300031911 Ga0307412_10268625 Ga0307412_102686252 141
382 3300031995 Ga0307409_100265790 Ga0307409_1002657902 141
383 3300032002 Ga0307416_100607152 Ga0307416_1006071522 141
384 3300032004 Ga0307414_10032425 Ga0307414_100324254 141
385 3300032004 Ga0307414_10089247 Ga0307414_100892473 141
386 3300032005 Ga0307411_10016644 Ga0307411_100166442 141
387 3300032005 Ga0307411_10197291 Ga0307411_101972911 141
388 3300032126 Ga0307415_100492964 Ga0307415_1004929641 141
389 3300041413 Ga0439465_0000046 Ga0439465_0000046_6003_6431 141
390 3300042004 Ga0439445_0032547 Ga0439445_0032547_650_1084 141
391 3300042004 Ga0439445_0126240 Ga0439445_0126240_205_633 141
392 3300042007 Ga0439449_0000068 Ga0439449_0000068_7429_7857 141
393 3300042007 Ga0439449_0030497 Ga0439449_0030497_26_454 141
394 3300042014 Ga0439457_095083 Ga0439457_095083_92_523 141
395 3300042015 Ga0439462_0076434 Ga0439462_0076434_378_809 141
396 3300042435 Ga0439434_0072175 Ga0439434_0072175_66_497 141
397 3300049127 Ga0501306_003014 Ga0501306_003014_706_1140 141
398 3300049128 Ga0501308_015023 Ga0501308_015023_367_801 141
399 3300049130 Ga0501310_001375 Ga0501310_001375_455_892 141
400 3300049161 Ga0501305_010467 Ga0501305_010467_474_908 141
401 3300049162 Ga0501307_012575 Ga0501307_012575_477_911 141
402 3300049528 Ga0501312_003878 Ga0501312_003878_1271_1705 141
403 3300049530 Ga0501314_002394 Ga0501314_002394_541_975 141
404 3300049531 Ga0501315_003468 Ga0501315_003468_671_1105 141
405 3300049533 Ga0501317_027563 Ga0501317_027563_151_585 141
406 3300049534 Ga0501318_037487 Ga0501318_037487_223_657 141
407 3300049539 Ga0501323_003098 Ga0501323_003098_628_1062 141
408 3300049544 Ga0501328_02034 Ga0501328_02034_178_612 141
409 3300049655 Ga0501208_076085 Ga0501208_076085_78_512 141
410 3300049661 Ga0501217_052247 Ga0501217_052247_289_723 141
411 3300049669 Ga0501235_031017 Ga0501235_031017_471_905 141
412 3300049671 Ga0501238_025899 Ga0501238_025899_85_519 141
413 3300049673 Ga0501240_002323 Ga0501240_002323_806_1240 141
414 3300049680 Ga0501250_001076 Ga0501250_001076_521_955 141
415 3300049681 Ga0501251_004740 Ga0501251_004740_461_895 141
416 3300049688 Ga0501259_025965 Ga0501259_025965_619_1053 141
417 3300049689 Ga0501260_036073 Ga0501260_036073_130_564 141
418 3300049763 Ga0501266_002361 Ga0501266_002361_704_1138 141
419 3300049765 Ga0501268_063848 Ga0501268_063848_157_591 141
420 3300049767 Ga0501270_018942 Ga0501270_018942_94_528 141
421 3300049769 Ga0501272_016848 Ga0501272_016848_161_595 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

10

139

0.97

Feature Viewer

pLDDT pTM Quality
69.87 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map