F440044

General Info

Members Datasets Scaffolds Average Seq Length
421 293 836 321

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0030751|Ga0395905_0030751_3448_4449
Length 333
Sequence MSRPRSVLKNPLPRALAGCTAAALALSLSACGGAKVGTDTAAGAQGGSGGKCGTFNLAVNAWVGYEADAAVVAYVAEKKLGCKVVKKNLDEQVSWQGFGTGEVDAVLENWGHEDLAKKYITEQKVAQDAGPTGNIGVIGWYVPPFLAKQHPDITDWKNLNKYADLFKTSESGGQGQILDGDPGFVTNDAALVKNLNLNYKVVYAGSEAALITSFRQAEQTQKPMIGYFYSPQWFLAEVPLVKVNLPKYTKGCDAVPAKVACDYPEYNLNKVVSTKFAQSGSPAYNLVKNFKWTNDDQNLVAKSIAQDKLSDDAAAKKWVDANPDKVNAWLAAG

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
131 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
142 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
143 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
144 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
145 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
155 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
156 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
157 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
160 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
161 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
162 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
163 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
208 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
209 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
256 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
257 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
258 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
259 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
260 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
261 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
262 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
263 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
264 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
265 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
266 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
267 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
268 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
269 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
270 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
271 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
272 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
286 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
287 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
288 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
289 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
290 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
291 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
292 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
293 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.01
Metatranscriptomes 2.85
Isolates 2.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.21
Nodule 0
Rhizoplane 8.08
Rhizosphere 73.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0030751 3300037471 Bacteria 5057
2 LJQas_1003712 3300000549 Bacteria 2028
3 JGI24746J21847_1002366 3300001977 Bacteria 3011
4 JGI24740J21852_10056864 3300001979 Bacteria 1095
5 JGI24739J22299_10008656 3300001989 Bacteria 3797
6 JGI24737J22298_10008725 3300001990 Bacteria 3386
7 JGI24737J22298_10018406 3300001990 Bacteria 2242
8 JGI24737J22298_10018500 3300001990 Bacteria 2236
9 JGI24745J21846_1007119 3300002073 Bacteria 1252
10 JGI24738J21930_10008048 3300002075 Bacteria 2408
11 JGI24738J21930_10028145 3300002075 Bacteria 1150
12 JGI24744J21845_10003804 3300002077 Bacteria 3117
13 JGI24034J26672_10012510 3300002239 Bacteria 1279
14 Ga0070683_100022891 3300005329 Bacteria 5587
15 Ga0070670_100301402 3300005331 Bacteria 1402
16 Ga0068868_100451104 3300005338 Bacteria 1119
17 Ga0070660_100104902 3300005339 Bacteria 2243
18 Ga0070692_10012945 3300005345 Bacteria 3878
19 Ga0070668_100000251 3300005347 Bacteria 35641
20 Ga0070668_100035827 3300005347 Bacteria 3786
21 Ga0070668_100085565 3300005347 Bacteria 2478
22 Ga0070675_100149500 3300005354 Bacteria 2002
23 Ga0070671_100007841 3300005355 Bacteria 8532
24 Ga0070671_100310274 3300005355 Bacteria 1344
25 Ga0070674_100009360 3300005356 Bacteria 5866
26 Ga0070674_100013067 3300005356 Bacteria 5120
27 Ga0070673_100020442 3300005364 Bacteria 4776
28 Ga0070659_100150895 3300005366 Bacteria 1896
29 Ga0070667_100046261 3300005367 Bacteria 3660
30 Ga0070667_100095787 3300005367 Bacteria 2559
31 Ga0070667_100132579 3300005367 Bacteria 2176
32 Ga0070667_100138923 3300005367 Bacteria 2126
33 Ga0070709_10205312 3300005434 Bacteria 1398
34 Ga0070701_10006284 3300005438 Bacteria 4988
35 Ga0070711_100000406 3300005439 Bacteria 22315
36 Ga0070705_100109152 3300005440 Bacteria 1764
37 Ga0070678_100030658 3300005456 Bacteria 3700
38 Ga0070678_100081951 3300005456 Bacteria 2448
39 Ga0068867_100108810 3300005459 Bacteria 2126
40 Ga0070679_100393462 3300005530 Bacteria 1332
41 Ga0070684_100025051 3300005535 Bacteria 5010
42 Ga0070697_100386594 3300005536 Bacteria 1212
43 Ga0070672_100084745 3300005543 Bacteria 2545
44 Ga0070686_100088021 3300005544 Bacteria 2072
45 Ga0070695_100018443 3300005545 Bacteria 4238
46 Ga0070696_100012322 3300005546 Bacteria 5734
47 Ga0070665_100000310 3300005548 Bacteria 75775
48 Ga0070665_100021894 3300005548 Bacteria 6429
49 Ga0070704_100103983 3300005549 Bacteria 2146
50 Ga0068857_100263007 3300005577 Bacteria 1584
51 Ga0068854_100003077 3300005578 Bacteria 10390
52 Ga0068866_10006617 3300005718 Bacteria 4833
53 Ga0068861_100117816 3300005719 Bacteria 2138
54 Ga0068863_100003945 3300005841 Bacteria 14662
55 Ga0068863_100065833 3300005841 Bacteria 3429
56 Ga0068863_100077409 3300005841 Bacteria 3148
57 Ga0068863_100195242 3300005841 Bacteria 1946
58 Ga0068858_100113936 3300005842 Bacteria 2526
59 Ga0068858_100158624 3300005842 Bacteria 2130
60 Ga0068860_100026190 3300005843 Bacteria 5623
61 Ga0068860_100144190 3300005843 Bacteria 2291
62 Ga0068860_100160036 3300005843 Bacteria 2171
63 Ga0081455_10014541 3300005937 Bacteria 7705
64 Ga0081455_10083412 3300005937 Bacteria 2612
65 Ga0081539_10009251 3300005985 Bacteria 8289
66 Ga0081539_10042763 3300005985 Bacteria 2635
67 Ga0081539_10070236 3300005985 Bacteria 1881
68 Ga0075365_10025680 3300006038 Bacteria 3731
69 Ga0075368_10019717 3300006042 Bacteria 2547
70 Ga0075363_100026594 3300006048 Bacteria 2961
71 Ga0075363_100108161 3300006048 Bacteria 1544
72 Ga0070715_10001750 3300006163 Bacteria 6463
73 Ga0070712_100042928 3300006175 Bacteria 3111
74 Ga0075362_10037642 3300006177 Bacteria 2122
75 Ga0075367_10000046 3300006178 Bacteria 28270
76 Ga0075367_10000231 3300006178 Bacteria 18831
77 Ga0075367_10157516 3300006178 Bacteria 1411
78 Ga0075369_10036970 3300006186 Bacteria 2079
79 Ga0075369_10059001 3300006186 Bacteria 1671
80 Ga0097621_100087961 3300006237 Bacteria 2595
81 Ga0075370_10074356 3300006353 Bacteria 1947
82 Ga0075428_100003633 3300006844 Bacteria 16911
83 Ga0075430_100050398 3300006846 Bacteria 3512
84 Ga0075431_100078491 3300006847 Bacteria 3408
85 Ga0099795_10003729 3300007788 Bacteria 3820
86 Ga0111539_10156193 3300009094 Bacteria 2670
87 Ga0105245_10001215 3300009098 Bacteria 23288
88 Ga0105245_10432617 3300009098 Bacteria 1321
89 Ga0105247_10314057 3300009101 Bacteria 1091
90 Ga0114129_10093548 3300009147 Bacteria 4164
91 Ga0105243_10154191 3300009148 Bacteria 1974
92 Ga0105241_10115684 3300009174 Bacteria 2153
93 Ga0105248_10010428 3300009177 Bacteria 10232
94 Ga0105248_10046055 3300009177 Bacteria 4889
95 Ga0105248_10557811 3300009177 Bacteria 1292
96 Ga0105238_10367320 3300009551 Bacteria 1429
97 Ga0105249_10012214 3300009553 Bacteria 7565
98 Ga0105239_10247473 3300010375 Bacteria 2002
99 Ga0157369_10105527 3300013105 Bacteria 3000
100 Ga0157369_10285992 3300013105 Bacteria 1717
101 Ga0157369_10436811 3300013105 Bacteria 1356
102 Ga0157374_10048137 3300013296 Bacteria 3955
103 Ga0163162_10193466 3300013306 Bacteria 2162
104 Ga0157372_10076730 3300013307 Bacteria 3773
105 Ga0157372_10093955 3300013307 Bacteria 3414
106 Ga0157375_10063858 3300013308 Bacteria 3665
107 Ga0157375_10369976 3300013308 Bacteria 1599
108 Ga0163163_10007568 3300014325 Bacteria 9592
109 Ga0163163_10075292 3300014325 Bacteria 3369
110 Ga0163163_10179084 3300014325 Bacteria 2167
111 Ga0157380_10155219 3300014326 Bacteria 1983
112 Ga0182008_10000573 3300014497 Bacteria 27236
113 Ga0157379_10006431 3300014968 Bacteria 10122
114 Ga0157379_10084588 3300014968 Bacteria 2843
115 Ga0182007_10000293 3300015262 Bacteria 32494
116 Ga0206351_10461531 3300020077 Bacteria 1365
117 Ga0206353_11017134 3300020082 Bacteria 3911
118 Ga0209759_1006091 3300025256 Bacteria 4109
119 Ga0207653_10008365 3300025885 Bacteria 3223
120 Ga0207642_10000424 3300025899 Bacteria 12711
121 Ga0207710_10007875 3300025900 Bacteria 4508
122 Ga0207680_10026980 3300025903 Bacteria 3190
123 Ga0207647_10007748 3300025904 Bacteria 7730
124 Ga0207647_10027544 3300025904 Bacteria 3704
125 Ga0207699_10067221 3300025906 Bacteria 2178
126 Ga0207645_10006563 3300025907 Bacteria 8324
127 Ga0207693_10010648 3300025915 Bacteria 7462
128 Ga0207662_10011377 3300025918 Bacteria 4933
129 Ga0207657_10009025 3300025919 Bacteria 10068
130 Ga0207681_10086055 3300025923 Bacteria 2232
131 Ga0207650_10341532 3300025925 Bacteria 1230
132 Ga0207687_10006551 3300025927 Bacteria 7686
133 Ga0207664_10104081 3300025929 Bacteria 2350
134 Ga0207644_10002738 3300025931 Bacteria 11352
135 Ga0207644_10068674 3300025931 Bacteria 2586
136 Ga0207690_10390298 3300025932 Bacteria 1108
137 Ga0207706_10039643 3300025933 Bacteria 4176
138 Ga0207709_10009148 3300025935 Bacteria 5457
139 Ga0207704_10001568 3300025938 Bacteria 10248
140 Ga0207665_10011040 3300025939 Bacteria 5928
141 Ga0207691_10520821 3300025940 Bacteria 1009
142 Ga0207689_10048444 3300025942 Bacteria 3504
143 Ga0207661_10015152 3300025944 Bacteria 5667
144 Ga0207679_10273946 3300025945 Bacteria 1444
145 Ga0207667_10066113 3300025949 Bacteria 3770
146 Ga0207651_10112803 3300025960 Bacteria 2044
147 Ga0207712_10215262 3300025961 Bacteria 1533
148 Ga0207712_10360161 3300025961 Bacteria 1211
149 Ga0207668_10085548 3300025972 Bacteria 2301
150 Ga0207668_10107865 3300025972 Bacteria 2083
151 Ga0207668_10271663 3300025972 Bacteria 1386
152 Ga0207658_10030047 3300025986 Bacteria 3843
153 Ga0207658_10141426 3300025986 Bacteria 1948
154 Ga0207658_10380307 3300025986 Bacteria 1236
155 Ga0207677_10057447 3300026023 Bacteria 2672
156 Ga0207703_10039365 3300026035 Bacteria 3778
157 Ga0207703_10169488 3300026035 Bacteria 1919
158 Ga0207639_10126200 3300026041 Bacteria 2111
159 Ga0207678_10013840 3300026067 Bacteria 7088
160 Ga0207702_10370228 3300026078 Bacteria 1375
161 Ga0207641_10038134 3300026088 Bacteria 4017
162 Ga0207641_10217447 3300026088 Bacteria 1770
163 Ga0207674_10095309 3300026116 Bacteria 2962
164 Ga0207674_10134238 3300026116 Bacteria 2438
165 Ga0207675_100153712 3300026118 Bacteria 2192
166 Ga0207675_100389146 3300026118 Bacteria 1372
167 Ga0207683_10033309 3300026121 Bacteria 4475
168 Ga0207683_10156256 3300026121 Bacteria 2060
169 Ga0207698_10029154 3300026142 Bacteria 3948
170 Ga0209179_1003508 3300027512 Bacteria 2268
171 Ga0209813_10003661 3300027866 Bacteria 3613
172 Ga0207428_10075410 3300027907 Bacteria 2643
173 Ga0268266_10004222 3300028379 Bacteria 13835
174 Ga0268266_10014678 3300028379 Bacteria 6730
175 Ga0268266_10180150 3300028379 Bacteria 1923
176 Ga0268264_10015684 3300028381 Bacteria 6205
177 Ga0307517_10005154 3300028786 Bacteria 19834
178 Ga0307517_10051702 3300028786 Bacteria 4139
179 Ga0307515_10000065 3300028794 Bacteria 244497
180 Ga0307515_10002464 3300028794 Bacteria 40245
181 Ga0307515_10049697 3300028794 Bacteria 6300
182 Ga0307515_10120305 3300028794 Bacteria 2980
183 Ga0307511_10002094 3300030521 Bacteria 20894
184 Ga0307512_10002042 3300030522 Bacteria 26638
185 Ga0307512_10003635 3300030522 Bacteria 17632
186 Ga0307512_10017112 3300030522 Bacteria 6667
187 Ga0307512_10138231 3300030522 Bacteria 1500
188 Ga0307513_10003996 3300031456 Bacteria 19795
189 Ga0307513_10060663 3300031456 Bacteria 4009
190 Ga0307509_10026155 3300031507 Bacteria 6511
191 Ga0307509_10048125 3300031507 Bacteria 4582
192 Ga0307509_10078207 3300031507 Bacteria 3428
193 Ga0307508_10001137 3300031616 Bacteria 30648
194 Ga0307508_10003699 3300031616 Bacteria 15327
195 Ga0307508_10023371 3300031616 Bacteria 5612
196 Ga0307508_10072847 3300031616 Bacteria 3010
197 Ga0307508_10087836 3300031616 Bacteria 2693
198 Ga0307516_10000690 3300031730 Bacteria 45875
199 Ga0307516_10007185 3300031730 Bacteria 12853
200 Ga0307516_10013506 3300031730 Bacteria 8693
201 Ga0307518_10059301 3300031838 Bacteria 2779
202 Ga0307410_10275264 3300031852 Bacteria 1318
203 Ga0307409_100021937 3300031995 Bacteria 4391
204 Ga0307416_100236647 3300032002 Bacteria 1765
205 Ga0307415_100013369 3300032126 Bacteria 4790
206 Ga0307507_10086712 3300033179 Bacteria 2712
207 Ga0307507_10087980 3300033179 Bacteria 2683
208 Ga0373958_0028246 3300034819 Bacteria 1085
209 Ga0373938_0020163 3300034957 Bacteria 1340
210 Ga0373928_0005914 3300035084 Bacteria 2342
211 Ga0373928_0024262 3300035084 Bacteria 1299
212 Ga0373940_0001348 3300035088 Bacteria 4394
213 Ga0373940_0005283 3300035088 Bacteria 2787
214 Ga0373941_0014164 3300035115 Bacteria 2125
215 Ga0373942_0000108 3300035207 Bacteria 18755
216 Ga0373942_0000190 3300035207 Bacteria 15667
217 Ga0373942_0000342 3300035207 Bacteria 12710
218 Ga0373942_0007019 3300035207 Bacteria 2603
219 Ga0373962_0002241 3300035242 Bacteria 4624
220 Ga0373931_0041892 3300035691 Bacteria 2407
221 Ga0395899_0034568 3300037312 Bacteria 3796
222 Ga0395900_0050372 3300037418 Bacteria 4289
223 Ga0395900_0260776 3300037418 Bacteria 1731
224 Ga0395898_0003787 3300037466 Bacteria 16734
225 Ga0395898_0015662 3300037466 Bacteria 7770
226 Ga0395898_0023092 3300037466 Bacteria 6290
227 Ga0395898_0103052 3300037466 Bacteria 2738
228 Ga0395898_0574722 3300037466 Bacteria 1069
229 Ga0395905_0141056 3300037471 Bacteria 2267
230 Ga0395901_0012805 3300038443 Bacteria 8506
231 Ga0395901_0168336 3300038443 Bacteria 2300
232 Ga0400485_22316 3300038735 Bacteria 100302
233 Ga0400486_28906 3300038742 Bacteria 68419
234 Ga0439466_0006175 3300041411 Bacteria 4563
235 Ga0439465_0001446 3300041413 Bacteria 7689
236 Ga0451853_0092639 3300041512 Bacteria 2288
237 Ga0439431_0005825 3300041997 Bacteria 2721
238 Ga0439442_001524 3300042002 Bacteria 4543
239 Ga0439445_0002643 3300042004 Bacteria 3991
240 Ga0439458_0008552 3300042157 Bacteria 2281
241 Ga0439434_0024809 3300042435 Bacteria 1809
242 Ga0466969_0014531 3300044656 Bacteria 4139
243 Ga0466969_0110985 3300044656 Bacteria 1284
244 Ga0466972_0017747 3300044658 Bacteria 3561
245 Ga0466972_0030707 3300044658 Bacteria 2645
246 Ga0466965_0042584 3300044683 Bacteria 2240
247 Ga0466966_0010420 3300044684 Bacteria 6174
248 Ga0466966_0027631 3300044684 Bacteria 3698
249 Ga0466961_0009807 3300044693 Bacteria 6096
250 Ga0466961_0051404 3300044693 Bacteria 2632
251 Ga0466961_0128233 3300044693 Bacteria 1590
252 Ga0466963_0046042 3300044694 Bacteria 2875
253 Ga0466963_0098946 3300044694 Bacteria 1994
254 Ga0466963_0180096 3300044694 Bacteria 1475
255 Ga0466964_0028695 3300044706 Bacteria 2194
256 Ga0466964_0038851 3300044706 Bacteria 1915
257 Ga0466964_0085162 3300044706 Bacteria 1364
258 Ga0466971_0006138 3300044719 Bacteria 5224
259 Ga0466971_0034543 3300044719 Bacteria 2266
260 Ga0466968_0080928 3300044735 Bacteria 1427
261 Ga0466970_0036955 3300044765 Bacteria 2587
262 Ga0466970_0054617 3300044765 Bacteria 2133
263 Ga0466960_0003166 3300044901 Bacteria 6313
264 Ga0466960_0005290 3300044901 Bacteria 5101
265 Ga0466960_0026575 3300044901 Bacteria 2631
266 Ga0466960_0122150 3300044901 Bacteria 1365
267 Ga0466959_0039195 3300045049 Bacteria 3501
268 Ga0466959_0073755 3300045049 Bacteria 2468
269 Ga0466959_0207290 3300045049 Bacteria 1363
270 Ga0466958_0020156 3300045836 Bacteria 3887
271 Ga0466958_0081091 3300045836 Bacteria 1996
272 Ga0466967_0014071 3300045976 Bacteria 6214
273 Ga0466967_0063026 3300045976 Bacteria 3293
274 Ga0495603_0088201 3300046455 Bacteria 1815
275 Ga0495580_0042195 3300046472 Bacteria 3251
276 Ga0495582_0039669 3300046473 Bacteria 2592
277 Ga0495639_0019595 3300046475 Bacteria 2954
278 Ga0495594_0082457 3300046499 Bacteria 1796
279 Ga0495608_0118777 3300046511 Bacteria 1696
280 Ga0495618_0009020 3300046514 Bacteria 6017
281 Ga0495628_0010315 3300046516 Bacteria 7942
282 Ga0495632_0018102 3300046519 Bacteria 3873
283 Ga0495643_0028568 3300046522 Bacteria 3125
284 Ga0495666_0065790 3300046526 Bacteria 1729
285 Ga0495633_0113264 3300046558 Bacteria 1258
286 Ga0495611_0039537 3300046648 Bacteria 2100
287 Ga0495635_0068280 3300046663 Bacteria 2438
288 Ga0495657_0078861 3300046675 Bacteria 2133
289 Ga0495646_0040457 3300046680 Bacteria 2871
290 Ga0495658_0083370 3300046683 Bacteria 1880
291 Ga0495613_0210131 3300046689 Bacteria 1369
292 Ga0495624_0010227 3300046690 Bacteria 6468
293 Ga0495649_0039314 3300046694 Bacteria 2594
294 Ga0495600_0019887 3300046809 Bacteria 4291
295 Ga0495660_0011312 3300046810 Bacteria 5181
296 Ga0495581_0018144 3300047315 Bacteria 4087
297 Ga0495604_0034215 3300047317 Bacteria 4021
298 Ga0495674_0144359 3300047319 Bacteria 1998
299 Ga0495676_0005721 3300047321 Bacteria 11401
300 Ga0495676_0050862 3300047321 Bacteria 3320
301 Ga0495680_0005399 3300047322 Bacteria 12039
302 Ga0495683_0001580 3300047323 Bacteria 14713
303 Ga0495687_005539 3300047443 Bacteria 8011
304 Ga0495679_036826 3300047446 Bacteria 1543
305 Ga0495685_000371 3300047447 Bacteria 14362
306 Ga0495681_0004093 3300047470 Bacteria 10026
307 Ga0495593_0003339 3300047673 Bacteria 9612
308 Ga0495593_0022027 3300047673 Bacteria 3555
309 Ga0495614_0010976 3300048089 Bacteria 3985
310 Ga0496100_0002079 3300048903 Bacteria 10074
311 Ga0496101_0001168 3300048904 Bacteria 15708
312 Ga0496101_0005663 3300048904 Bacteria 7970
313 Ga0496102_0009094 3300048905 Bacteria 8525
314 Ga0496102_0173507 3300048905 Bacteria 2030
315 Ga0496102_0231642 3300048905 Bacteria 1741
316 Ga0496102_0274224 3300048905 Bacteria 1590
317 Ga0496103_0072799 3300048906 Bacteria 2153
318 Ga0496104_0005436 3300048907 Bacteria 11149
319 Ga0496104_0007997 3300048907 Bacteria 9375
320 Ga0496105_0005216 3300048908 Bacteria 9847
321 Ga0496105_0029299 3300048908 Bacteria 4505
322 Ga0496105_0261402 3300048908 Bacteria 1400
323 Ga0496106_0053657 3300048909 Bacteria 3045
324 Ga0496106_0191459 3300048909 Bacteria 1626
325 Ga0496107_0009722 3300048910 Bacteria 6669
326 Ga0496107_0082139 3300048910 Bacteria 2350
327 Ga0496107_0083642 3300048910 Bacteria 2327
328 Ga0496108_0005691 3300048911 Bacteria 10088
329 Ga0496108_0050333 3300048911 Bacteria 3487
330 Ga0496108_0062475 3300048911 Bacteria 3136
331 Ga0496109_0008625 3300048912 Bacteria 8677
332 Ga0496109_0110241 3300048912 Bacteria 2559
333 Ga0496109_0297534 3300048912 Bacteria 1522
334 Ga0496110_0026053 3300048913 Bacteria 5000
335 Ga0496110_0059491 3300048913 Bacteria 3368
336 Ga0496110_0125646 3300048913 Bacteria 2314
337 Ga0496112_0019657 3300048915 Bacteria 6380
338 Ga0496112_0132702 3300048915 Bacteria 2461
339 Ga0496113_0044492 3300048916 Bacteria 3289
340 Ga0496114_0002035 3300048917 Bacteria 15389
341 Ga0496114_0134344 3300048917 Bacteria 2138
342 Ga0496114_0137034 3300048917 Bacteria 2117
343 Ga0496115_0006028 3300048918 Bacteria 8853
344 Ga0501034_0019101 3300049571 Bacteria 7016
345 Ga0501034_0214966 3300049571 Bacteria 1877
346 Ga0501036_0011279 3300049572 Bacteria 7394
347 Ga0501037_0195942 3300049573 Bacteria 1429
348 Ga0501038_0099783 3300049574 Bacteria 2420
349 Ga0501039_0414457 3300049575 Bacteria 1058
350 Ga0501047_0067692 3300049581 Bacteria 3441
351 Ga0501067_0002737 3300049583 Bacteria 9692
352 Ga0501068_0011603 3300049584 Bacteria 4977
353 Ga0501069_0011974 3300049585 Bacteria 4603
354 Ga0501070_0075476 3300049586 Bacteria 2791
355 Ga0501072_0012946 3300049588 Bacteria 6382
356 Ga0501073_0002614 3300049589 Bacteria 13483
357 Ga0501074_0001687 3300049590 Bacteria 15040
358 Ga0501076_0239038 3300049592 Bacteria 1486
359 Ga0501080_0004003 3300049742 Bacteria 13046
360 Ga0501044_0022951 3300049823 Bacteria 6642
361 nmdc:mga03n38_47215_c1 3300050490 Bacteria 1904
362 nmdc:mga00v17_2906_c1 3300050491 Bacteria 8786
363 nmdc:mga00v17_82999_c1 3300050491 Bacteria 2004
364 nmdc:mga0yw44_62947_c2 3300050492 Bacteria 1988
365 nmdc:mga06z11_1014_c1 3300050494 Bacteria 10267
366 nmdc:mga06z11_309_c1 3300050494 Bacteria 18563
367 nmdc:mga04h51_3646_c1 3300050495 Bacteria 3764
368 nmdc:mga07m45_25402_c1 3300050496 Bacteria 3248
369 nmdc:mga05p37_7614_c1 3300050507 Bacteria 12780
370 nmdc:mga0qj67_40428_c1 3300050509 Bacteria 3665
371 nmdc:mga06r32_45228_c1 3300050510 Bacteria 4195
372 nmdc:mga08y16_183936_c1 3300050511 Bacteria 2169
373 nmdc:mga0sz30_3947_c1 3300050516 Bacteria 5346
374 nmdc:mga0sz30_42352_c1 3300050516 Bacteria 1916
375 nmdc:mga0sz30_57881_c1 3300050516 Bacteria 1652
376 Ga0495619_0159564 3300053085 Bacteria 1557
377 Ga0500578_0097175 3300053086 Bacteria 1866
378 Ga0500643_005605 3300053087 Bacteria 5380
379 Ga0500651_0096834 3300053093 Bacteria 1813
380 Ga0500641_0020124 3300053096 Bacteria 2530
381 Ga0500654_057916 3300053099 Bacteria 2014
382 Ga0500553_039197 3300053101 Bacteria 2331
383 Ga0500560_049436 3300053107 Bacteria 1345
384 Ga0500562_031006 3300053108 Bacteria 1410
385 Ga0500580_056533 3300053113 Bacteria 1642
386 Ga0500594_0008323 3300053118 Bacteria 2361
387 Ga0500614_005640 3300053123 Bacteria 2624
388 Ga0500652_002234 3300053131 Bacteria 5822
389 Ga0500658_0004062 3300053134 Bacteria 5502
390 Ga0500561_0003114 3300053137 Bacteria 2865
391 Ga0500573_0029804 3300053140 Bacteria 3146
392 Ga0500579_075568 3300053143 Bacteria 1917
393 Ga0500600_0005895 3300053149 Bacteria 7270
394 Ga0500600_0027261 3300053149 Bacteria 3387
395 Ga0500600_0036526 3300053149 Bacteria 2855
396 Ga0500616_0005877 3300053153 Bacteria 8211
397 Ga0501084_0113246 3300054114 Bacteria 2280
398 Ga0587077_011960 3300059493 Bacteria 1377
399 Ga0587085_008093 3300059506 Bacteria 1332
400 Ga0587090_007830 3300059510 Bacteria 1416
401 Ga0587091_011232 3300059511 Bacteria 1392
402 Ga0587092_010480 3300059512 Bacteria 1269
403 Ga0587099_001871 3300059622 Bacteria 1581
404 Ga0587113_003804 3300059625 Bacteria 1171
405 Ga0587115_003282 3300059626 Bacteria 1691
406 Ga0587128_005067 3300059630 Bacteria 1558
407 Ga0587069_003784 3300059642 Bacteria 1661
408 Ga0501082_0083656 3300060353 Bacteria 2753
409 Ga0466962_0004100 3300061719 Bacteria 6979
410 2585312150 2582581314 Bacteria 11452267
411 2616693840 2616644814 Bacteria 11555299
412 2731906703 2731639228 Bacteria 4187555
413 2753263010 2751185782 Bacteria 11227053
414 2753263489 2751185782 Bacteria 11227053
415 2816422371 2816332119 Bacteria 8120218
416 2919054094 2919051321 Bacteria 4210889
417 8055069799 8055066027 Bacteria 9479577
418 8056830741 8056829672 Bacteria 9045328
419 Ga0395905_0030751
420 LJQas_1003712
421 JGI24746J21847_1002366
422 JGI24740J21852_10056864
423 JGI24739J22299_10008656
424 JGI24737J22298_10008725
425 JGI24737J22298_10018406
426 JGI24737J22298_10018500
427 JGI24745J21846_1007119
428 JGI24738J21930_10008048
429 JGI24738J21930_10028145
430 JGI24744J21845_10003804
431 JGI24034J26672_10012510
432 Ga0070683_100022891
433 Ga0070670_100301402
434 Ga0068868_100451104
435 Ga0070660_100104902
436 Ga0070692_10012945
437 Ga0070668_100000251
438 Ga0070668_100035827
439 Ga0070668_100085565
440 Ga0070675_100149500
441 Ga0070671_100007841
442 Ga0070671_100310274
443 Ga0070674_100009360
444 Ga0070674_100013067
445 Ga0070673_100020442
446 Ga0070659_100150895
447 Ga0070667_100046261
448 Ga0070667_100095787
449 Ga0070667_100132579
450 Ga0070667_100138923
451 Ga0070709_10205312
452 Ga0070701_10006284
453 Ga0070711_100000406
454 Ga0070705_100109152
455 Ga0070678_100030658
456 Ga0070678_100081951
457 Ga0068867_100108810
458 Ga0070679_100393462
459 Ga0070684_100025051
460 Ga0070697_100386594
461 Ga0070672_100084745
462 Ga0070686_100088021
463 Ga0070695_100018443
464 Ga0070696_100012322
465 Ga0070665_100000310
466 Ga0070665_100021894
467 Ga0070704_100103983
468 Ga0068857_100263007
469 Ga0068854_100003077
470 Ga0068866_10006617
471 Ga0068861_100117816
472 Ga0068863_100003945
473 Ga0068863_100065833
474 Ga0068863_100077409
475 Ga0068863_100195242
476 Ga0068858_100113936
477 Ga0068858_100158624
478 Ga0068860_100026190
479 Ga0068860_100144190
480 Ga0068860_100160036
481 Ga0081455_10014541
482 Ga0081455_10083412
483 Ga0081539_10009251
484 Ga0081539_10042763
485 Ga0081539_10070236
486 Ga0075365_10025680
487 Ga0075368_10019717
488 Ga0075363_100026594
489 Ga0075363_100108161
490 Ga0070715_10001750
491 Ga0070712_100042928
492 Ga0075362_10037642
493 Ga0075367_10000046
494 Ga0075367_10000231
495 Ga0075367_10157516
496 Ga0075369_10036970
497 Ga0075369_10059001
498 Ga0097621_100087961
499 Ga0075370_10074356
500 Ga0075428_100003633
501 Ga0075430_100050398
502 Ga0075431_100078491
503 Ga0099795_10003729
504 Ga0111539_10156193
505 Ga0105245_10001215
506 Ga0105245_10432617
507 Ga0105247_10314057
508 Ga0114129_10093548
509 Ga0105243_10154191
510 Ga0105241_10115684
511 Ga0105248_10010428
512 Ga0105248_10046055
513 Ga0105248_10557811
514 Ga0105238_10367320
515 Ga0105249_10012214
516 Ga0105239_10247473
517 Ga0157369_10105527
518 Ga0157369_10285992
519 Ga0157369_10436811
520 Ga0157374_10048137
521 Ga0163162_10193466
522 Ga0157372_10076730
523 Ga0157372_10093955
524 Ga0157375_10063858
525 Ga0157375_10369976
526 Ga0163163_10007568
527 Ga0163163_10075292
528 Ga0163163_10179084
529 Ga0157380_10155219
530 Ga0182008_10000573
531 Ga0157379_10006431
532 Ga0157379_10084588
533 Ga0182007_10000293
534 Ga0206351_10461531
535 Ga0206353_11017134
536 Ga0209759_1006091
537 Ga0207653_10008365
538 Ga0207642_10000424
539 Ga0207710_10007875
540 Ga0207680_10026980
541 Ga0207647_10007748
542 Ga0207647_10027544
543 Ga0207699_10067221
544 Ga0207645_10006563
545 Ga0207693_10010648
546 Ga0207662_10011377
547 Ga0207657_10009025
548 Ga0207681_10086055
549 Ga0207650_10341532
550 Ga0207687_10006551
551 Ga0207664_10104081
552 Ga0207644_10002738
553 Ga0207644_10068674
554 Ga0207690_10390298
555 Ga0207706_10039643
556 Ga0207709_10009148
557 Ga0207704_10001568
558 Ga0207665_10011040
559 Ga0207691_10520821
560 Ga0207689_10048444
561 Ga0207661_10015152
562 Ga0207679_10273946
563 Ga0207667_10066113
564 Ga0207651_10112803
565 Ga0207712_10215262
566 Ga0207712_10360161
567 Ga0207668_10085548
568 Ga0207668_10107865
569 Ga0207668_10271663
570 Ga0207658_10030047
571 Ga0207658_10141426
572 Ga0207658_10380307
573 Ga0207677_10057447
574 Ga0207703_10039365
575 Ga0207703_10169488
576 Ga0207639_10126200
577 Ga0207678_10013840
578 Ga0207702_10370228
579 Ga0207641_10038134
580 Ga0207641_10217447
581 Ga0207674_10095309
582 Ga0207674_10134238
583 Ga0207675_100153712
584 Ga0207675_100389146
585 Ga0207683_10033309
586 Ga0207683_10156256
587 Ga0207698_10029154
588 Ga0209179_1003508
589 Ga0209813_10003661
590 Ga0207428_10075410
591 Ga0268266_10004222
592 Ga0268266_10014678
593 Ga0268266_10180150
594 Ga0268264_10015684
595 Ga0307517_10005154
596 Ga0307517_10051702
597 Ga0307515_10000065
598 Ga0307515_10002464
599 Ga0307515_10049697
600 Ga0307515_10120305
601 Ga0307511_10002094
602 Ga0307512_10002042
603 Ga0307512_10003635
604 Ga0307512_10017112
605 Ga0307512_10138231
606 Ga0307513_10003996
607 Ga0307513_10060663
608 Ga0307509_10026155
609 Ga0307509_10048125
610 Ga0307509_10078207
611 Ga0307508_10001137
612 Ga0307508_10003699
613 Ga0307508_10023371
614 Ga0307508_10072847
615 Ga0307508_10087836
616 Ga0307516_10000690
617 Ga0307516_10007185
618 Ga0307516_10013506
619 Ga0307518_10059301
620 Ga0307410_10275264
621 Ga0307409_100021937
622 Ga0307416_100236647
623 Ga0307415_100013369
624 Ga0307507_10086712
625 Ga0307507_10087980
626 Ga0373958_0028246
627 Ga0373938_0020163
628 Ga0373928_0005914
629 Ga0373928_0024262
630 Ga0373940_0001348
631 Ga0373940_0005283
632 Ga0373941_0014164
633 Ga0373942_0000108
634 Ga0373942_0000190
635 Ga0373942_0000342
636 Ga0373942_0007019
637 Ga0373962_0002241
638 Ga0373931_0041892
639 Ga0395899_0034568
640 Ga0395900_0050372
641 Ga0395900_0260776
642 Ga0395898_0003787
643 Ga0395898_0015662
644 Ga0395898_0023092
645 Ga0395898_0103052
646 Ga0395898_0574722
647 Ga0395905_0141056
648 Ga0395901_0012805
649 Ga0395901_0168336
650 Ga0400485_22316
651 Ga0400486_28906
652 Ga0439466_0006175
653 Ga0439465_0001446
654 Ga0451853_0092639
655 Ga0439431_0005825
656 Ga0439442_001524
657 Ga0439445_0002643
658 Ga0439458_0008552
659 Ga0439434_0024809
660 Ga0466969_0014531
661 Ga0466969_0110985
662 Ga0466972_0017747
663 Ga0466972_0030707
664 Ga0466965_0042584
665 Ga0466966_0010420
666 Ga0466966_0027631
667 Ga0466961_0009807
668 Ga0466961_0051404
669 Ga0466961_0128233
670 Ga0466963_0046042
671 Ga0466963_0098946
672 Ga0466963_0180096
673 Ga0466964_0028695
674 Ga0466964_0038851
675 Ga0466964_0085162
676 Ga0466971_0006138
677 Ga0466971_0034543
678 Ga0466968_0080928
679 Ga0466970_0036955
680 Ga0466970_0054617
681 Ga0466960_0003166
682 Ga0466960_0005290
683 Ga0466960_0026575
684 Ga0466960_0122150
685 Ga0466959_0039195
686 Ga0466959_0073755
687 Ga0466959_0207290
688 Ga0466958_0020156
689 Ga0466958_0081091
690 Ga0466967_0014071
691 Ga0466967_0063026
692 Ga0495603_0088201
693 Ga0495580_0042195
694 Ga0495582_0039669
695 Ga0495639_0019595
696 Ga0495594_0082457
697 Ga0495608_0118777
698 Ga0495618_0009020
699 Ga0495628_0010315
700 Ga0495632_0018102
701 Ga0495643_0028568
702 Ga0495666_0065790
703 Ga0495633_0113264
704 Ga0495611_0039537
705 Ga0495635_0068280
706 Ga0495657_0078861
707 Ga0495646_0040457
708 Ga0495658_0083370
709 Ga0495613_0210131
710 Ga0495624_0010227
711 Ga0495649_0039314
712 Ga0495600_0019887
713 Ga0495660_0011312
714 Ga0495581_0018144
715 Ga0495604_0034215
716 Ga0495674_0144359
717 Ga0495676_0005721
718 Ga0495676_0050862
719 Ga0495680_0005399
720 Ga0495683_0001580
721 Ga0495687_005539
722 Ga0495679_036826
723 Ga0495685_000371
724 Ga0495681_0004093
725 Ga0495593_0003339
726 Ga0495593_0022027
727 Ga0495614_0010976
728 Ga0496100_0002079
729 Ga0496101_0001168
730 Ga0496101_0005663
731 Ga0496102_0009094
732 Ga0496102_0173507
733 Ga0496102_0231642
734 Ga0496102_0274224
735 Ga0496103_0072799
736 Ga0496104_0005436
737 Ga0496104_0007997
738 Ga0496105_0005216
739 Ga0496105_0029299
740 Ga0496105_0261402
741 Ga0496106_0053657
742 Ga0496106_0191459
743 Ga0496107_0009722
744 Ga0496107_0082139
745 Ga0496107_0083642
746 Ga0496108_0005691
747 Ga0496108_0050333
748 Ga0496108_0062475
749 Ga0496109_0008625
750 Ga0496109_0110241
751 Ga0496109_0297534
752 Ga0496110_0026053
753 Ga0496110_0059491
754 Ga0496110_0125646
755 Ga0496112_0019657
756 Ga0496112_0132702
757 Ga0496113_0044492
758 Ga0496114_0002035
759 Ga0496114_0134344
760 Ga0496114_0137034
761 Ga0496115_0006028
762 Ga0501034_0019101
763 Ga0501034_0214966
764 Ga0501036_0011279
765 Ga0501037_0195942
766 Ga0501038_0099783
767 Ga0501039_0414457
768 Ga0501047_0067692
769 Ga0501067_0002737
770 Ga0501068_0011603
771 Ga0501069_0011974
772 Ga0501070_0075476
773 Ga0501072_0012946
774 Ga0501073_0002614
775 Ga0501074_0001687
776 Ga0501076_0239038
777 Ga0501080_0004003
778 Ga0501044_0022951
779 nmdc:mga03n38_47215_c1
780 nmdc:mga00v17_2906_c1
781 nmdc:mga00v17_82999_c1
782 nmdc:mga0yw44_62947_c2
783 nmdc:mga06z11_1014_c1
784 nmdc:mga06z11_309_c1
785 nmdc:mga04h51_3646_c1
786 nmdc:mga07m45_25402_c1
787 nmdc:mga05p37_7614_c1
788 nmdc:mga0qj67_40428_c1
789 nmdc:mga06r32_45228_c1
790 nmdc:mga08y16_183936_c1
791 nmdc:mga0sz30_3947_c1
792 nmdc:mga0sz30_42352_c1
793 nmdc:mga0sz30_57881_c1
794 Ga0495619_0159564
795 Ga0500578_0097175
796 Ga0500643_005605
797 Ga0500651_0096834
798 Ga0500641_0020124
799 Ga0500654_057916
800 Ga0500553_039197
801 Ga0500560_049436
802 Ga0500562_031006
803 Ga0500580_056533
804 Ga0500594_0008323
805 Ga0500614_005640
806 Ga0500652_002234
807 Ga0500658_0004062
808 Ga0500561_0003114
809 Ga0500573_0029804
810 Ga0500579_075568
811 Ga0500600_0005895
812 Ga0500600_0027261
813 Ga0500600_0036526
814 Ga0500616_0005877
815 Ga0501084_0113246
816 Ga0587077_011960
817 Ga0587085_008093
818 Ga0587090_007830
819 Ga0587091_011232
820 Ga0587092_010480
821 Ga0587099_001871
822 Ga0587113_003804
823 Ga0587115_003282
824 Ga0587128_005067
825 Ga0587069_003784
826 Ga0501082_0083656
827 Ga0466962_0004100
828 2585312150
829 2616693840
830 2731906703
831 2753263010
832 2753263489
833 2816422371
834 2919054094
835 8055069799
836 8056830741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

53

321

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xz6-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8935 36 313
3tmg-assembly4.cif.gz_D crystal structure of glycine betaine, l-proline abc transporter, glycine/betaine/l-proline-binding protein (prox) from borrelia burgdorferi 0.8561 36 313
4xz6-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8561 36 313
7yle-assembly1.cif.gz_A rndmpx in complex with dmsp 0.851 34 313
1r9q-assembly1.cif.gz_A structure analysis of prox in complex with proline betaine 0.8323 36 311
ID Description Score Start End Superfamily
3l6hA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.885 36 313 3.40.190.10
3l6hA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8682 36 313 3.40.190.10
2regA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8624 30 311 3.40.190.10
3tmgB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8441 36 313 3.40.190.10
3zs6A03 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.82 36 85 3.10.105.10
ID Description Score Start End GO Terms
AF-A0A1H4KWY8-F1-model_v4 Glycine betaine/proline transport system substrate-binding protein 0.9947 46 313 GO:0022857
GO:0043190
AF-A0A545AL69-F1-model_v4 Glycine/betaine ABC transporter substrate-binding protein 0.9896 37 313 GO:0022857
GO:0043190
AF-A0A1H4KWY8-F1-model_v4 Glycine betaine/proline transport system substrate-binding protein 0.9873 46 313 GO:0022857
GO:0043190
AF-A0A545AL69-F1-model_v4 Glycine/betaine ABC transporter substrate-binding protein 0.986 37 313 GO:0022857
GO:0043190
AF-A0A1I5EY64-F1-model_v4 Substrate binding domain of ABC-type glycine betaine transport system 0.9841 121 313 GO:0022857
GO:0043190

Map