F440038

General Info

Members Datasets Scaffolds Average Seq Length
421 300 407 332

Family's Representative Sequence

Representative Sequence 3300035118|Ga0373954_0019974|Ga0373954_0019974_1095_2156
Length 353
Sequence LFVEEDAMAANPQVQTTHEASAQAGEKIAGYRTFQLGQFTFARDEYFVIVTWPVASGGGVAAKGKSQSHTMSADAFLRAMMRDVAWNFFYGLVNFDAVFGTRNLYGRVELFAGRYNEAIHGAGLSYVEAFDSPTAMAKFKEILADWVNAGFDPFAAPAEVQGSPFGEKKGNNLAAIDRFRVATKRMTGIEGDSPLRTDASGFPVNRAFADVDQSEPEIRAEPGFEKELHAINLFKYLSRSDVTWNPSVTSVCGRSLFCPTTEEYILPIIHGNDRVEWFLQLSDEITWEVADRETGRPRARLTMKAGDVAAMPADIRHQGFSKKRSMLLVWENATADLPQRYERGELKPWPVDF

Samples

Sample ID Description Type Environment
1 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
2 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
3 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
4 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
5 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
6 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
7 2818991452 Burkholderia cepacia 561 Isolate Unclassified
8 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
9 2928170801 Burkholderia sp. 572 Isolate Unclassified
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
138 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
139 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
143 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
144 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
148 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
163 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
167 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
194 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
195 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
221 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
249 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
296 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
297 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
298 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
299 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
300 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.2
Metatranscriptomes 0.48
Isolates 3.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.51
Nodule 0.24
Rhizoplane 2.14
Rhizosphere 90.97
Stem 0
Stem Tuber 0
Unclassified 2.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000874 3300001989 Bacteria 11133
2 JGI25407J50210_10006920 3300003373 Bacteria 2835
3 Ga0055532_1000276 3300003758 Bacteria 33326
4 Ga0055532_1000345 3300003758 Bacteria 25200
5 Ga0055527_1001195 3300003760 Bacteria 5841
6 Ga0055535_1000172 3300003761 Bacteria 69740
7 Ga0055542_1000219 3300003762 Bacteria 69781
8 Ga0055529_1000235 3300003763 Bacteria 69781
9 Ga0055528_1000827 3300003790 Bacteria 21218
10 Ga0055541_1004908 3300003841 Bacteria 2385
11 Ga0058692_1002387 3300003856 Bacteria 6303
12 Ga0070683_100106883 3300005329 Bacteria 2638
13 Ga0070683_100347841 3300005329 Bacteria 1412
14 Ga0068869_100004501 3300005334 Bacteria 8669
15 Ga0068869_100023982 3300005334 Bacteria 4221
16 Ga0070680_100051495 3300005336 Bacteria 3360
17 Ga0070682_100270561 3300005337 Bacteria 1234
18 Ga0070691_10044797 3300005341 Bacteria 2098
19 Ga0070674_100059887 3300005356 Bacteria 2652
20 Ga0070709_10000871 3300005434 Bacteria 16897
21 Ga0070709_10114270 3300005434 Bacteria 1819
22 Ga0070714_100031611 3300005435 Bacteria 4418
23 Ga0070713_100072379 3300005436 Bacteria 2915
24 Ga0070713_100189114 3300005436 Bacteria 1854
25 Ga0070713_100192526 3300005436 Bacteria 1838
26 Ga0070710_10010785 3300005437 Bacteria 4495
27 Ga0070700_100002298 3300005441 Bacteria 9725
28 Ga0070708_100043239 3300005445 Bacteria 3958
29 Ga0070708_100242140 3300005445 Bacteria 1693
30 Ga0070678_100070820 3300005456 Bacteria 2608
31 Ga0070662_100059946 3300005457 Bacteria 2773
32 Ga0070681_10026786 3300005458 Bacteria 5796
33 Ga0070707_100022161 3300005468 Bacteria 6006
34 Ga0070707_100035167 3300005468 Bacteria 4779
35 Ga0070698_100047236 3300005471 Bacteria 4401
36 Ga0070699_100003354 3300005518 Bacteria 14166
37 Ga0070699_100361568 3300005518 Bacteria 1309
38 Ga0070679_100005205 3300005530 Bacteria 12035
39 Ga0070684_100053399 3300005535 Bacteria 3518
40 Ga0070684_100363966 3300005535 Bacteria 1331
41 Ga0068853_100025261 3300005539 Bacteria 4985
42 Ga0070665_100202379 3300005548 Bacteria 1986
43 Ga0068855_100005534 3300005563 Bacteria 15416
44 Ga0068855_100102158 3300005563 Bacteria 3300
45 Ga0068857_100330185 3300005577 Bacteria 1409
46 Ga0068856_100101000 3300005614 Bacteria 2877
47 Ga0068856_100118310 3300005614 Bacteria 2650
48 Ga0068856_100254801 3300005614 Bacteria 1770
49 Ga0070702_100140104 3300005615 Bacteria 1539
50 Ga0068859_100071493 3300005617 Bacteria 3505
51 Ga0068864_100571999 3300005618 Bacteria 1094
52 Ga0068866_10129537 3300005718 Bacteria 1433
53 Ga0068863_100079628 3300005841 Bacteria 3103
54 Ga0068863_100234232 3300005841 Bacteria 1772
55 Ga0068858_100008379 3300005842 Bacteria 9945
56 Ga0081455_10008533 3300005937 Bacteria 10636
57 Ga0081455_10057945 3300005937 Bacteria 3281
58 Ga0081455_10103486 3300005937 Bacteria 2280
59 Ga0081539_10035888 3300005985 Bacteria 2973
60 Ga0070717_10093248 3300006028 Bacteria 2545
61 Ga0070717_10123514 3300006028 Bacteria 2220
62 Ga0075432_10004633 3300006058 Bacteria 4682
63 Ga0070715_10010974 3300006163 Bacteria 3247
64 Ga0070716_100010404 3300006173 Bacteria 4662
65 Ga0070712_100083932 3300006175 Bacteria 2314
66 Ga0097621_100045229 3300006237 Bacteria 3554
67 Ga0068871_100050292 3300006358 Bacteria 3371
68 Ga0075428_100002991 3300006844 Bacteria 18429
69 Ga0075428_100003331 3300006844 Bacteria 17575
70 Ga0075428_100051729 3300006844 Bacteria 4504
71 Ga0075428_100200199 3300006844 Bacteria 2159
72 Ga0075430_100001779 3300006846 Bacteria 17608
73 Ga0075430_100036568 3300006846 Bacteria 4163
74 Ga0075430_100053854 3300006846 Bacteria 3387
75 Ga0075431_100016980 3300006847 Bacteria 7391
76 Ga0075431_100017905 3300006847 Bacteria 7206
77 Ga0075431_100079917 3300006847 Bacteria 3376
78 Ga0075433_10174388 3300006852 Bacteria 1913
79 Ga0075429_100000896 3300006880 Bacteria 23544
80 Ga0075429_100022565 3300006880 Bacteria 5457
81 Ga0068865_100110043 3300006881 Bacteria 2031
82 Ga0097620_100071497 3300006931 Bacteria 3505
83 Ga0075435_100067112 3300007076 Bacteria 2920
84 Ga0075435_100260798 3300007076 Bacteria 1476
85 Ga0105240_10000397 3300009093 Bacteria 81058
86 Ga0105240_10003872 3300009093 Bacteria 23103
87 Ga0111539_10007916 3300009094 Bacteria 13552
88 Ga0111539_10012627 3300009094 Bacteria 10584
89 Ga0105245_10175844 3300009098 Bacteria 2042
90 Ga0114129_10001819 3300009147 Bacteria 29052
91 Ga0114129_10030216 3300009147 Bacteria 7672
92 Ga0114129_10042968 3300009147 Bacteria 6361
93 Ga0114129_10259530 3300009147 Bacteria 2330
94 Ga0105243_10020048 3300009148 Bacteria 5070
95 Ga0105241_10039135 3300009174 Bacteria 3577
96 Ga0105242_10070427 3300009176 Bacteria 2900
97 Ga0105242_10208893 3300009176 Bacteria 1738
98 Ga0105248_10014337 3300009177 Bacteria 8723
99 Ga0105237_10018138 3300009545 Bacteria 7287
100 Ga0105237_10022938 3300009545 Bacteria 6401
101 Ga0105238_10001165 3300009551 Bacteria 26488
102 Ga0105239_10134188 3300010375 Bacteria 2755
103 Ga0105239_10175244 3300010375 Bacteria 2398
104 Ga0105246_10015809 3300011119 Bacteria 4770
105 Ga0157370_10002613 3300013104 Bacteria 21660
106 Ga0157369_10003590 3300013105 Bacteria 18428
107 Ga0157374_10485792 3300013296 Bacteria 1238
108 Ga0157372_10000303 3300013307 Bacteria 54864
109 Ga0157372_10828972 3300013307 Bacteria 1074
110 Ga0157375_10038098 3300013308 Bacteria 4613
111 Ga0157380_10012837 3300014326 Bacteria 6087
112 Ga0157376_10033749 3300014969 Bacteria 4124
113 Ga0206350_10952886 3300020080 Bacteria 3042
114 Ga0209566_100089 3300025225 Bacteria 142951
115 Ga0209674_101827 3300025226 Bacteria 5078
116 Ga0209672_100030 3300025228 Bacteria 337051
117 Ga0209147_100036 3300025229 Bacteria 337052
118 Ga0209147_100149 3300025229 Bacteria 102676
119 Ga0209258_100056 3300025242 Bacteria 337051
120 Ga0209148_1000105 3300025254 Bacteria 210795
121 Ga0209455_1000061 3300025272 Bacteria 337052
122 Ga0209673_1000108 3300025273 Bacteria 183732
123 Ga0209675_1032224 3300025291 Bacteria 1229
124 Ga0209564_1006293 3300025295 Bacteria 6461
125 Ga0207692_10064515 3300025898 Bacteria 1907
126 Ga0207642_10077295 3300025899 Bacteria 1605
127 Ga0207685_10021671 3300025905 Bacteria 2158
128 Ga0207699_10000744 3300025906 Bacteria 15543
129 Ga0207699_10011600 3300025906 Bacteria 4457
130 Ga0207654_10036214 3300025911 Bacteria 2755
131 Ga0207707_10005372 3300025912 Bacteria 11202
132 Ga0207707_10252091 3300025912 Bacteria 1533
133 Ga0207695_10000305 3300025913 Bacteria 119810
134 Ga0207695_10032983 3300025913 Bacteria 5658
135 Ga0207671_10049719 3300025914 Bacteria 3104
136 Ga0207671_10241947 3300025914 Bacteria 1417
137 Ga0207693_10004476 3300025915 Bacteria 11818
138 Ga0207693_10006257 3300025915 Bacteria 9874
139 Ga0207663_10092552 3300025916 Bacteria 2010
140 Ga0207660_10003273 3300025917 Bacteria 10594
141 Ga0207660_10068643 3300025917 Bacteria 2571
142 Ga0207652_10000788 3300025921 Bacteria 30216
143 Ga0207646_10032890 3300025922 Bacteria 4691
144 Ga0207646_10046243 3300025922 Bacteria 3905
145 Ga0207694_10014366 3300025924 Bacteria 5968
146 Ga0207659_10058504 3300025926 Bacteria 2767
147 Ga0207700_10023629 3300025928 Bacteria 4243
148 Ga0207700_10071369 3300025928 Bacteria 2674
149 Ga0207700_10115165 3300025928 Bacteria 2170
150 Ga0207664_10029443 3300025929 Bacteria 4182
151 Ga0207664_10045485 3300025929 Bacteria 3442
152 Ga0207686_10108087 3300025934 Bacteria 1870
153 Ga0207669_10065067 3300025937 Bacteria 2260
154 Ga0207704_10107781 3300025938 Bacteria 1875
155 Ga0207704_10154137 3300025938 Bacteria 1626
156 Ga0207665_10002285 3300025939 Bacteria 12938
157 Ga0207665_10011753 3300025939 Bacteria 5755
158 Ga0207691_10095510 3300025940 Bacteria 2659
159 Ga0207711_10010626 3300025941 Bacteria 7656
160 Ga0207689_10003114 3300025942 Bacteria 15221
161 Ga0207667_10002466 3300025949 Bacteria 23106
162 Ga0207658_10116317 3300025986 Bacteria 2124
163 Ga0207639_10018656 3300026041 Bacteria 4932
164 Ga0207708_10011564 3300026075 Bacteria 6577
165 Ga0207708_10280578 3300026075 Bacteria 1350
166 Ga0207702_10093520 3300026078 Bacteria 2637
167 Ga0207702_10141556 3300026078 Bacteria 2177
168 Ga0207641_10035908 3300026088 Bacteria 4134
169 Ga0207641_10073240 3300026088 Bacteria 2952
170 Ga0207648_10253575 3300026089 Bacteria 1569
171 Ga0207676_10432806 3300026095 Bacteria 1236
172 Ga0207674_10173032 3300026116 Bacteria 2112
173 Ga0207675_100097770 3300026118 Bacteria 2764
174 Ga0207683_10062665 3300026121 Bacteria 3275
175 Ga0207698_10357503 3300026142 Bacteria 1382
176 Ga0209371_1000103 3300027312 Bacteria 149486
177 Ga0209371_1008180 3300027312 Bacteria 3519
178 Ga0207428_10003561 3300027907 Bacteria 15047
179 Ga0207428_10041116 3300027907 Bacteria 3745
180 Ga0268265_10323401 3300028380 Bacteria 1398
181 Ga0265337_1001502 3300028556 Bacteria 11446
182 Ga0265326_10011933 3300028558 Bacteria 2557
183 Ga0265319_1004425 3300028563 Bacteria 6954
184 Ga0265319_1026493 3300028563 Bacteria 2064
185 Ga0265334_10001364 3300028573 Bacteria 11781
186 Ga0265318_10000365 3300028577 Bacteria 35710
187 Ga0265323_10003159 3300028653 Bacteria 7335
188 Ga0265322_10010770 3300028654 Bacteria 2656
189 Ga0265336_10001631 3300028666 Bacteria 9962
190 Ga0265338_10006196 3300028800 Bacteria 15332
191 Ga0265338_10006417 3300028800 Bacteria 14995
192 Ga0265338_10011296 3300028800 Bacteria 10334
193 Ga0265338_10112291 3300028800 Bacteria 2192
194 Ga0265324_10002669 3300029957 Bacteria 8898
195 Ga0268256_1000119 3300030500 Bacteria 114623
196 Ga0268256_1010866 3300030500 Bacteria 2924
197 Ga0265330_10000547 3300031235 Bacteria 24611
198 Ga0265332_10001198 3300031238 Bacteria 15028
199 Ga0265332_10002980 3300031238 Bacteria 8305
200 Ga0265328_10003218 3300031239 Bacteria 7245
201 Ga0265328_10004514 3300031239 Bacteria 6037
202 Ga0265328_10007394 3300031239 Bacteria 4578
203 Ga0265320_10004084 3300031240 Bacteria 9587
204 Ga0265320_10007175 3300031240 Bacteria 6942
205 Ga0265320_10026228 3300031240 Bacteria 3053
206 Ga0265325_10009569 3300031241 Bacteria 5656
207 Ga0265325_10011907 3300031241 Bacteria 4987
208 Ga0265325_10101809 3300031241 Bacteria 1405
209 Ga0265329_10011445 3300031242 Bacteria 3222
210 Ga0265340_10001214 3300031247 Bacteria 14769
211 Ga0265340_10011096 3300031247 Bacteria 4802
212 Ga0265340_10017322 3300031247 Bacteria 3725
213 Ga0265340_10045114 3300031247 Bacteria 2155
214 Ga0265339_10008776 3300031249 Bacteria 6403
215 Ga0265339_10016984 3300031249 Bacteria 4321
216 Ga0265339_10079498 3300031249 Bacteria 1735
217 Ga0265331_10004164 3300031250 Bacteria 9068
218 Ga0265331_10083848 3300031250 Bacteria 1478
219 Ga0265316_10017478 3300031344 Bacteria 6195
220 Ga0265316_10172548 3300031344 Bacteria 1612
221 Ga0265313_10005054 3300031595 Bacteria 9834
222 Ga0265313_10015392 3300031595 Bacteria 4457
223 Ga0307508_10128338 3300031616 Bacteria 2139
224 Ga0265314_10002624 3300031711 Bacteria 18138
225 Ga0265314_10005293 3300031711 Bacteria 11679
226 Ga0265342_10000914 3300031712 Bacteria 29315
227 Ga0265342_10003271 3300031712 Bacteria 13430
228 Ga0265342_10012774 3300031712 Bacteria 5671
229 Ga0265342_10025884 3300031712 Bacteria 3682
230 Ga0316576_10006307 3300031727 Bacteria 7370
231 Ga0316576_10016194 3300031727 Bacteria 5028
232 Ga0316578_10041202 3300031728 Bacteria 2674
233 Ga0316578_10054282 3300031728 Bacteria 2350
234 Ga0307416_100083218 3300032002 Bacteria 2714
235 Ga0307415_100016067 3300032126 Bacteria 4449
236 Ga0316583_10013644 3300032133 Bacteria 2933
237 Ga0316588_1024303 3300033528 Bacteria 1393
238 Ga0373948_0000602 3300034817 Bacteria 4621
239 Ga0373926_0013309 3300035083 Bacteria 2788
240 Ga0373936_0000614 3300035113 Bacteria 12300
241 Ga0373945_0000125 3300035116 Bacteria 19011
242 Ga0373954_0019974 3300035118 Bacteria 3025
243 Ga0373954_0033178 3300035118 Bacteria 2388
244 Ga0373956_0058533 3300035119 Bacteria 1742
245 Ga0373957_0007548 3300035120 Bacteria 3483
246 Ga0373943_0059111 3300035170 Bacteria 1910
247 Ga0373946_0000017 3300035171 Bacteria 45187
248 Ga0373955_0007326 3300035172 Bacteria 5069
249 Ga0373955_0011348 3300035172 Bacteria 4242
250 Ga0316574_0063918 3300035398 Bacteria 2315
251 Ga0373931_0000014 3300035691 Bacteria 251374
252 Ga0373935_0001662 3300035692 Bacteria 12430
253 Ga0373927_0001048 3300035695 Bacteria 21065
254 Ga0373933_0006132 3300035724 Bacteria 6544
255 Ga0373933_0007960 3300035724 Bacteria 5784
256 Ga0373947_0021310 3300035725 Bacteria 3750
257 Ga0373937_0001981 3300036401 Bacteria 17125
258 Ga0373937_0015325 3300036401 Bacteria 6778
259 Ga0316582_0022830 3300036647 Bacteria 3721
260 Ga0373925_0002799 3300037068 Bacteria 13767
261 Ga0373925_0006211 3300037068 Bacteria 8821
262 Ga0373925_0260239 3300037068 Bacteria 1394
263 Ga0395898_0039206 3300037466 Bacteria 4690
264 Ga0395905_0488496 3300037471 Bacteria 1131
265 Ga0395901_0038133 3300038443 Bacteria 4971
266 Ga0436365_0834993 3300039437 Bacteria 2972
267 Ga0436361_0191214 3300039447 Unclassified 1620
268 Ga0436363_0982980 3300039450 Bacteria 2462
269 Ga0450899_000470 3300042135 Bacteria 4527
270 Ga0450908_010505 3300042184 Bacteria 1708
271 Ga0466969_0006003 3300044656 Bacteria 6465
272 Ga0466969_0017830 3300044656 Bacteria 3703
273 Ga0466966_0006929 3300044684 Bacteria 7505
274 Ga0466961_0002906 3300044693 Bacteria 10633
275 Ga0466961_0020455 3300044693 Bacteria 4258
276 Ga0466961_0055352 3300044693 Bacteria 2529
277 Ga0466963_0032708 3300044694 Bacteria 3370
278 Ga0466964_0117422 3300044706 Bacteria 1194
279 Ga0466964_0132263 3300044706 Bacteria 1138
280 Ga0466971_0011519 3300044719 Bacteria 3871
281 Ga0466968_0016583 3300044735 Bacteria 2935
282 Ga0466970_0002270 3300044765 Bacteria 9286
283 Ga0466957_0120449 3300044842 Bacteria 1672
284 Ga0466960_0016410 3300044901 Bacteria 3212
285 Ga0466959_0000899 3300045049 Bacteria 17549
286 Ga0466967_0788335 3300045976 Bacteria 943
287 Ga0495592_0001252 3300046454 Bacteria 17583
288 Ga0495592_0070825 3300046454 Bacteria 2539
289 Ga0495591_001912 3300046458 Bacteria 12231
290 Ga0495629_0003155 3300046459 Bacteria 12480
291 Ga0495641_0036587 3300046461 Bacteria 2306
292 Ga0495651_0001670 3300046462 Bacteria 17161
293 Ga0495653_0001116 3300046463 Bacteria 20658
294 Ga0495639_0006223 3300046475 Bacteria 5128
295 Ga0495664_0013694 3300046477 Bacteria 4601
296 Ga0495664_0025036 3300046477 Bacteria 3473
297 Ga0495596_0001708 3300046500 Bacteria 12353
298 Ga0495606_0197471 3300046507 Bacteria 1149
299 Ga0495608_0002741 3300046511 Bacteria 12645
300 Ga0495608_0022797 3300046511 Bacteria 4295
301 Ga0495618_0001612 3300046514 Bacteria 15060
302 Ga0495628_0099242 3300046516 Bacteria 2249
303 Ga0495648_0064785 3300046524 Bacteria 2151
304 Ga0495666_0000370 3300046526 Bacteria 19749
305 Ga0495652_0030837 3300046529 Bacteria 4698
306 Ga0495652_0258022 3300046529 Bacteria 1288
307 Ga0495665_0020199 3300046531 Bacteria 3579
308 Ga0495640_0023400 3300046533 Bacteria 4500
309 Ga0495640_0125310 3300046533 Bacteria 1666
310 Ga0495587_0001688 3300046536 Bacteria 14735
311 Ga0495645_0020275 3300046543 Bacteria 4794
312 Ga0495667_0000865 3300046559 Bacteria 19576
313 Ga0495667_0177613 3300046559 Bacteria 1367
314 Ga0495634_0010527 3300046642 Bacteria 6772
315 Ga0495635_0001545 3300046663 Bacteria 15434
316 Ga0495635_0006842 3300046663 Bacteria 7966
317 Ga0495635_0007829 3300046663 Bacteria 7460
318 Ga0495661_0007191 3300046665 Bacteria 7766
319 Ga0495657_0011941 3300046675 Bacteria 6471
320 Ga0495657_0048361 3300046675 Bacteria 2870
321 Ga0495657_0154167 3300046675 Bacteria 1425
322 Ga0495623_0003441 3300046679 Bacteria 10470
323 Ga0495646_0017198 3300046680 Bacteria 4589
324 Ga0495646_0053600 3300046680 Bacteria 2431
325 Ga0495669_0069933 3300046684 Bacteria 1598
326 Ga0495613_0010529 3300046689 Bacteria 6864
327 Ga0495624_0023344 3300046690 Bacteria 4079
328 Ga0495671_0013737 3300046692 Bacteria 4374
329 Ga0495589_0005072 3300046794 Bacteria 6967
330 Ga0495600_0018945 3300046809 Bacteria 4393
331 Ga0495581_0028905 3300047315 Bacteria 3215
332 Ga0495581_0059385 3300047315 Bacteria 2210
333 Ga0495604_0283138 3300047317 Bacteria 1119
334 Ga0495674_0000554 3300047319 Bacteria 34730
335 Ga0495674_0084655 3300047319 Bacteria 2717
336 Ga0495676_0002314 3300047321 Bacteria 16908
337 Ga0495680_0032369 3300047322 Bacteria 4245
338 Ga0495683_0002792 3300047323 Bacteria 10382
339 Ga0495687_000107 3300047443 Bacteria 127815
340 Ga0495675_0000930 3300047444 Bacteria 17778
341 Ga0495679_001320 3300047446 Bacteria 14392
342 Ga0495673_0002832 3300047469 Bacteria 11816
343 Ga0495684_0095171 3300047471 Bacteria 2254
344 Ga0495684_0172746 3300047471 Bacteria 1606
345 Ga0495593_0024470 3300047673 Bacteria 3346
346 Ga0495602_0035228 3300048088 Bacteria 4669
347 Ga0495602_0040705 3300048088 Bacteria 4256
348 Ga0496102_0314293 3300048905 Bacteria 1476
349 Ga0496104_0086949 3300048907 Bacteria 2985
350 Ga0496110_0221113 3300048913 Bacteria 1722
351 Ga0496112_0475921 3300048915 Bacteria 1186
352 Ga0496115_0003650 3300048918 Bacteria 11075
353 Ga0496117_0008559 3300048920 Bacteria 9704
354 Ga0496118_0002842 3300048921 Bacteria 22604
355 Ga0501031_0089310 3300049568 Bacteria 2009
356 Ga0501032_0081742 3300049569 Bacteria 2150
357 Ga0501032_0212471 3300049569 Bacteria 1261
358 Ga0501033_0018994 3300049570 Bacteria 5196
359 Ga0501033_0231188 3300049570 Bacteria 1314
360 Ga0501034_0207123 3300049571 Bacteria 1917
361 Ga0501036_0051344 3300049572 Bacteria 3491
362 Ga0501037_0074681 3300049573 Bacteria 2463
363 Ga0501039_0002715 3300049575 Bacteria 13203
364 Ga0501040_0010555 3300049576 Bacteria 6040
365 Ga0501040_0038071 3300049576 Plasmid 3270
366 Ga0501041_0007300 3300049577 Bacteria 6486
367 Ga0501042_0010613 3300049578 Bacteria 6187
368 Ga0501043_0012158 3300049579 Bacteria 6728
369 Ga0501046_0000203 3300049580 Bacteria 61563
370 Ga0501047_0307335 3300049581 Bacteria 1427
371 Ga0501048_0010522 3300049582 Bacteria 6904
372 Ga0501068_0238824 3300049584 Bacteria 1156
373 Ga0501071_0114982 3300049587 Bacteria 1991
374 Ga0501071_0254824 3300049587 Bacteria 1325
375 Ga0501072_0003880 3300049588 Bacteria 11307
376 Ga0501074_0316902 3300049590 Bacteria 1108
377 Ga0501075_0005848 3300049591 Bacteria 8418
378 Ga0501075_0255781 3300049591 Bacteria 1335
379 Ga0501077_0006083 3300049593 Bacteria 7366
380 Ga0501079_0004851 3300049741 Bacteria 9964
381 Ga0501079_0192233 3300049741 Bacteria 1593
382 Ga0501081_0017581 3300049743 Bacteria 4737
383 Ga0501044_0061463 3300049823 Bacteria 3843
384 Ga0501045_0005199 3300049824 Bacteria 8998
385 nmdc:mga05p37_11231_c1 3300050507 Bacteria 10650
386 nmdc:mga05p37_222682_c1 3300050507 Bacteria 2276
387 nmdc:mga05p37_416884_c1 3300050507 Bacteria 1564
388 nmdc:mga05p37_5118_c1 3300050507 Bacteria 15376
389 nmdc:mga09592_2350_c1 3300050508 Bacteria 15271
390 nmdc:mga09592_55793_c1 3300050508 Bacteria 3338
391 nmdc:mga0qj67_15682_c1 3300050509 Bacteria 5740
392 nmdc:mga0qj67_2618_c1 3300050509 Bacteria 12901
393 nmdc:mga06r32_271532_c1 3300050510 Bacteria 1683
394 nmdc:mga06r32_45314_c1 3300050510 Bacteria 4192
395 nmdc:mga08y16_110251_c1 3300050511 Bacteria 2866
396 nmdc:mga08y16_5358_c1 3300050511 Bacteria 13417
397 nmdc:mga0a205_191393_c1 3300050515 Bacteria 1938
398 nmdc:mga0a205_2646_c1 3300050515 Bacteria 4866
399 Ga0495601_0065089 3300053077 Bacteria 2320
400 Ga0495601_0066977 3300053077 Bacteria 2287
401 Ga0495619_0120946 3300053085 Bacteria 1795
402 Ga0501084_0004532 3300054114 Bacteria 11361
403 Ga0501082_0122092 3300060353 Bacteria 2258
404 Ga0466962_0001334 3300061719 Bacteria 11398
405 Ga0466962_0062027 3300061719 Bacteria 1784
406 Ga0466962_0081991 3300061719 Bacteria 1543
407 Ga0530510_0007317 3300061734 Bacteria 7683

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0788335 Ga0466967_0788335_29_877 279
2 3300048915 Ga0496112_0475921 Ga0496112_0475921_26_877 279
3 3300053085 Ga0495619_0120946 Ga0495619_0120946_928_1779 280
4 3300025291 Ga0209675_1032224 Ga0209675_10322241 304
5 3300006844 Ga0075428_100003331 Ga0075428_1000033315 309
6 3300006846 Ga0075430_100001779 Ga0075430_10000177911 309
7 3300006847 Ga0075431_100016980 Ga0075431_1000169807 309
8 3300006880 Ga0075429_100000896 Ga0075429_10000089617 309
9 3300009147 Ga0114129_10001819 Ga0114129_1000181916 309
10 3300050507 nmdc:mga05p37_5118_c1 nmdc:mga05p37_5118_c1_10826_11809 309
11 3300050508 nmdc:mga09592_2350_c1 nmdc:mga09592_2350_c1_3355_4338 309
12 3300050509 nmdc:mga0qj67_2618_c1 nmdc:mga0qj67_2618_c1_1250_2233 309
13 3300050510 nmdc:mga06r32_45314_c1 nmdc:mga06r32_45314_c1_1367_2350 309
14 3300013307 Ga0157372_10000303 Ga0157372_1000030310 310
15 3300039450 Ga0436363_0982980 Ga0436363_0982980_1029_2015 310
16 3300005471 Ga0070698_100047236 Ga0070698_1000472363 311
17 3300006844 Ga0075428_100200199 Ga0075428_1002001992 311
18 3300006847 Ga0075431_100079917 Ga0075431_1000799174 311
19 3300050507 nmdc:mga05p37_416884_c1 nmdc:mga05p37_416884_c1_561_1547 311
20 3300005937 Ga0081455_10103486 Ga0081455_101034862 313
21 3300005436 Ga0070713_100072379 Ga0070713_1000723793 316
22 3300005614 Ga0068856_100254801 Ga0068856_1002548012 316
23 3300006028 Ga0070717_10093248 Ga0070717_100932481 316
24 3300020080 Ga0206350_10952886 Ga0206350_109528863 316
25 3300031727 Ga0316576_10006307 Ga0316576_100063075 317
26 3300035398 Ga0316574_0063918 Ga0316574_0063918_985_1953 317
27 3300039447 Ga0436361_0191214 Ga0436361_0191214_389_1363 319
28 3300005334 Ga0068869_100023982 Ga0068869_1000239823 320
29 3300009147 Ga0114129_10259530 Ga0114129_102595301 321
30 3300032133 Ga0316583_10013644 Ga0316583_100136443 321
31 3300034817 Ga0373948_0000602 Ga0373948_0000602_2051_3028 321
32 3300035691 Ga0373931_0000014 Ga0373931_0000014_200215_201192 321
33 3300036647 Ga0316582_0022830 Ga0316582_0022830_1636_2628 321
34 3300037466 Ga0395898_0039206 Ga0395898_0039206_648_1628 321
35 3300038443 Ga0395901_0038133 Ga0395901_0038133_3250_4230 321
36 3300049568 Ga0501031_0089310 Ga0501031_0089310_356_1363 321
37 3300049569 Ga0501032_0081742 Ga0501032_0081742_984_1991 321
38 3300049572 Ga0501036_0051344 Ga0501036_0051344_2165_3172 321
39 3300049573 Ga0501037_0074681 Ga0501037_0074681_441_1448 321
40 3300049575 Ga0501039_0002715 Ga0501039_0002715_4878_5885 321
41 3300049576 Ga0501040_0010555 Ga0501040_0010555_91_1098 321
42 3300049577 Ga0501041_0007300 Ga0501041_0007300_264_1271 321
43 3300049578 Ga0501042_0010613 Ga0501042_0010613_2665_3672 321
44 3300049579 Ga0501043_0012158 Ga0501043_0012158_1193_2173 321
45 3300049580 Ga0501046_0000203 Ga0501046_0000203_26636_27616 321
46 3300049582 Ga0501048_0010522 Ga0501048_0010522_3631_4638 321
47 3300049584 Ga0501068_0238824 Ga0501068_0238824_98_1105 321
48 3300049588 Ga0501072_0003880 Ga0501072_0003880_4225_5232 321
49 3300049591 Ga0501075_0005848 Ga0501075_0005848_741_1748 321
50 3300049593 Ga0501077_0006083 Ga0501077_0006083_3545_4552 321
51 3300049741 Ga0501079_0004851 Ga0501079_0004851_1630_2637 321
52 3300049824 Ga0501045_0005199 Ga0501045_0005199_1983_2990 321
53 3300050507 nmdc:mga05p37_222682_c1 nmdc:mga05p37_222682_c1_49_1029 321
54 3300054114 Ga0501084_0004532 Ga0501084_0004532_7813_8820 321
55 3300060353 Ga0501082_0122092 Ga0501082_0122092_1091_2098 321
56 3300061734 Ga0530510_0007317 Ga0530510_0007317_506_1513 321
57 3300005329 Ga0070683_100347841 Ga0070683_1003478412 322
58 3300005434 Ga0070709_10114270 Ga0070709_101142702 322
59 3300005535 Ga0070684_100053399 Ga0070684_1000533994 322
60 3300005614 Ga0068856_100101000 Ga0068856_1001010004 322
61 3300005841 Ga0068863_100234232 Ga0068863_1002342322 322
62 3300005937 Ga0081455_10057945 Ga0081455_100579452 322
63 3300006173 Ga0070716_100010404 Ga0070716_1000104044 322
64 3300006846 Ga0075430_100036568 Ga0075430_1000365682 322
65 3300006847 Ga0075431_100017905 Ga0075431_1000179052 322
66 3300007076 Ga0075435_100260798 Ga0075435_1002607982 322
67 3300009147 Ga0114129_10030216 Ga0114129_100302166 322
68 3300009147 Ga0114129_10042968 Ga0114129_100429684 322
69 3300025906 Ga0207699_10011600 Ga0207699_100116003 322
70 3300025915 Ga0207693_10004476 Ga0207693_100044765 322
71 3300025928 Ga0207700_10115165 Ga0207700_101151653 322
72 3300025929 Ga0207664_10045485 Ga0207664_100454853 322
73 3300025939 Ga0207665_10002285 Ga0207665_100022856 322
74 3300026078 Ga0207702_10141556 Ga0207702_101415562 322
75 3300026088 Ga0207641_10073240 Ga0207641_100732402 322
76 3300027312 Ga0209371_1008180 Ga0209371_10081802 322
77 3300028800 Ga0265338_10112291 Ga0265338_101122912 322
78 3300030500 Ga0268256_1010866 Ga0268256_10108664 322
79 3300031241 Ga0265325_10011907 Ga0265325_100119074 322
80 3300031247 Ga0265340_10001214 Ga0265340_100012142 322
81 3300031247 Ga0265340_10011096 Ga0265340_100110963 322
82 3300031247 Ga0265340_10045114 Ga0265340_100451143 322
83 3300031249 Ga0265339_10079498 Ga0265339_100794982 322
84 3300031250 Ga0265331_10083848 Ga0265331_100838482 322
85 3300031616 Ga0307508_10128338 Ga0307508_101283382 322
86 3300035083 Ga0373926_0013309 Ga0373926_0013309_1295_2278 322
87 3300035113 Ga0373936_0000614 Ga0373936_0000614_1831_2814 322
88 3300035116 Ga0373945_0000125 Ga0373945_0000125_3714_4697 322
89 3300035118 Ga0373954_0033178 Ga0373954_0033178_705_1688 322
90 3300035119 Ga0373956_0058533 Ga0373956_0058533_333_1316 322
91 3300035120 Ga0373957_0007548 Ga0373957_0007548_61_1044 322
92 3300035171 Ga0373946_0000017 Ga0373946_0000017_6831_7814 322
93 3300035172 Ga0373955_0011348 Ga0373955_0011348_3122_4105 322
94 3300035692 Ga0373935_0001662 Ga0373935_0001662_10913_11896 322
95 3300035695 Ga0373927_0001048 Ga0373927_0001048_17907_18890 322
96 3300035724 Ga0373933_0007960 Ga0373933_0007960_3644_4627 322
97 3300035725 Ga0373947_0021310 Ga0373947_0021310_1268_2251 322
98 3300036401 Ga0373937_0015325 Ga0373937_0015325_2278_3261 322
99 3300037068 Ga0373925_0006211 Ga0373925_0006211_1309_2292 322
100 3300042135 Ga0450899_000470 Ga0450899_000470_2256_3239 322
101 3300042184 Ga0450908_010505 Ga0450908_010505_574_1557 322
102 3300044706 Ga0466964_0132263 Ga0466964_0132263_19_1002 322
103 3300046454 Ga0495592_0070825 Ga0495592_0070825_444_1427 322
104 3300046461 Ga0495641_0036587 Ga0495641_0036587_16_999 322
105 3300046463 Ga0495653_0001116 Ga0495653_0001116_4358_5341 322
106 3300046475 Ga0495639_0006223 Ga0495639_0006223_1997_2980 322
107 3300046477 Ga0495664_0013694 Ga0495664_0013694_2237_3220 322
108 3300046511 Ga0495608_0002741 Ga0495608_0002741_4107_5090 322
109 3300046516 Ga0495628_0099242 Ga0495628_0099242_872_1855 322
110 3300046531 Ga0495665_0020199 Ga0495665_0020199_1667_2650 322
111 3300046533 Ga0495640_0125310 Ga0495640_0125310_532_1515 322
112 3300046543 Ga0495645_0020275 Ga0495645_0020275_195_1178 322
113 3300046559 Ga0495667_0000865 Ga0495667_0000865_5628_6611 322
114 3300046663 Ga0495635_0001545 Ga0495635_0001545_14437_15420 322
115 3300046663 Ga0495635_0007829 Ga0495635_0007829_3596_4579 322
116 3300046675 Ga0495657_0011941 Ga0495657_0011941_2224_3207 322
117 3300046680 Ga0495646_0053600 Ga0495646_0053600_379_1362 322
118 3300046809 Ga0495600_0018945 Ga0495600_0018945_1347_2330 322
119 3300047315 Ga0495581_0028905 Ga0495581_0028905_2149_3132 322
120 3300047317 Ga0495604_0283138 Ga0495604_0283138_116_1099 322
121 3300047319 Ga0495674_0000554 Ga0495674_0000554_10143_11126 322
122 3300047321 Ga0495676_0002314 Ga0495676_0002314_10014_10997 322
123 3300047322 Ga0495680_0032369 Ga0495680_0032369_1847_2830 322
124 3300047471 Ga0495684_0095171 Ga0495684_0095171_1252_2235 322
125 3300047673 Ga0495593_0024470 Ga0495593_0024470_2116_3099 322
126 3300048088 Ga0495602_0040705 Ga0495602_0040705_1980_2963 322
127 3300048907 Ga0496104_0086949 Ga0496104_0086949_794_1777 322
128 3300048913 Ga0496110_0221113 Ga0496110_0221113_405_1388 322
129 3300050508 nmdc:mga09592_55793_c1 nmdc:mga09592_55793_c1_1452_2435 322
130 3300050510 nmdc:mga06r32_271532_c1 nmdc:mga06r32_271532_c1_510_1493 322
131 3300053077 Ga0495601_0066977 Ga0495601_0066977_454_1437 322
132 3300005434 Ga0070709_10000871 Ga0070709_1000087115 323
133 3300005436 Ga0070713_100189114 Ga0070713_1001891142 323
134 3300005437 Ga0070710_10010785 Ga0070710_100107855 323
135 3300005445 Ga0070708_100242140 Ga0070708_1002421402 323
136 3300005468 Ga0070707_100035167 Ga0070707_1000351674 323
137 3300005518 Ga0070699_100361568 Ga0070699_1003615681 323
138 3300006028 Ga0070717_10123514 Ga0070717_101235142 323
139 3300006163 Ga0070715_10010974 Ga0070715_100109744 323
140 3300006175 Ga0070712_100083932 Ga0070712_1000839322 323
141 3300025898 Ga0207692_10064515 Ga0207692_100645152 323
142 3300025905 Ga0207685_10021671 Ga0207685_100216713 323
143 3300025906 Ga0207699_10000744 Ga0207699_100007445 323
144 3300025915 Ga0207693_10006257 Ga0207693_100062575 323
145 3300025916 Ga0207663_10092552 Ga0207663_100925522 323
146 3300025922 Ga0207646_10046243 Ga0207646_100462433 323
147 3300025928 Ga0207700_10023629 Ga0207700_100236292 323
148 3300025929 Ga0207664_10029443 Ga0207664_100294432 323
149 3300031727 Ga0316576_10016194 Ga0316576_100161946 323
150 3300031728 Ga0316578_10041202 Ga0316578_100412022 323
151 3300031728 Ga0316578_10054282 Ga0316578_100542822 323
152 3300033528 Ga0316588_1024303 Ga0316588_10243032 323
153 3300037068 Ga0373925_0002799 Ga0373925_0002799_7665_8651 323
154 3300039437 Ga0436365_0834993 Ga0436365_0834993_299_1282 323
155 3300049590 Ga0501074_0316902 Ga0501074_0316902_35_1024 323
156 3300005435 Ga0070714_100031611 Ga0070714_1000316112 324
157 3300005436 Ga0070713_100192526 Ga0070713_1001925262 324
158 3300005445 Ga0070708_100043239 Ga0070708_1000432392 324
159 3300005468 Ga0070707_100022161 Ga0070707_1000221616 324
160 3300005518 Ga0070699_100003354 Ga0070699_1000033545 324
161 3300005615 Ga0070702_100140104 Ga0070702_1001401041 324
162 3300013307 Ga0157372_10828972 Ga0157372_108289721 324
163 3300025922 Ga0207646_10032890 Ga0207646_100328904 324
164 3300025928 Ga0207700_10071369 Ga0207700_100713693 324
165 3300025939 Ga0207665_10011753 Ga0207665_100117533 324
166 3300028556 Ga0265337_1001502 Ga0265337_10015024 324
167 3300028563 Ga0265319_1004425 Ga0265319_10044255 324
168 3300028573 Ga0265334_10001364 Ga0265334_100013649 324
169 3300028653 Ga0265323_10003159 Ga0265323_100031592 324
170 3300028654 Ga0265322_10010770 Ga0265322_100107702 324
171 3300028666 Ga0265336_10001631 Ga0265336_100016312 324
172 3300028800 Ga0265338_10006196 Ga0265338_100061969 324
173 3300028800 Ga0265338_10006417 Ga0265338_1000641711 324
174 3300029957 Ga0265324_10002669 Ga0265324_100026693 324
175 3300031238 Ga0265332_10002980 Ga0265332_100029803 324
176 3300031240 Ga0265320_10026228 Ga0265320_100262282 324
177 3300031241 Ga0265325_10009569 Ga0265325_100095694 324
178 3300031241 Ga0265325_10101809 Ga0265325_101018092 324
179 3300031247 Ga0265340_10017322 Ga0265340_100173224 324
180 3300031344 Ga0265316_10172548 Ga0265316_101725482 324
181 3300031595 Ga0265313_10005054 Ga0265313_100050545 324
182 3300031711 Ga0265314_10005293 Ga0265314_100052936 324
183 3300031712 Ga0265342_10025884 Ga0265342_100258842 324
184 3300046477 Ga0495664_0025036 Ga0495664_0025036_685_1674 324
185 3300046529 Ga0495652_0258022 Ga0495652_0258022_259_1248 324
186 3300046675 Ga0495657_0154167 Ga0495657_0154167_140_1129 324
187 3300047319 Ga0495674_0084655 Ga0495674_0084655_1679_2668 324
188 3300048918 Ga0496115_0003650 Ga0496115_0003650_7440_8447 324
189 3300053077 Ga0495601_0065089 Ga0495601_0065089_1139_2128 324
190 3300028558 Ga0265326_10011933 Ga0265326_100119332 325
191 3300028563 Ga0265319_1026493 Ga0265319_10264932 325
192 3300028577 Ga0265318_10000365 Ga0265318_100003655 325
193 3300031235 Ga0265330_10000547 Ga0265330_100005473 325
194 3300031238 Ga0265332_10001198 Ga0265332_100011985 325
195 3300031239 Ga0265328_10007394 Ga0265328_100073943 325
196 3300031240 Ga0265320_10007175 Ga0265320_100071756 325
197 3300031242 Ga0265329_10011445 Ga0265329_100114453 325
198 3300031250 Ga0265331_10004164 Ga0265331_100041642 325
199 3300031344 Ga0265316_10017478 Ga0265316_100174785 325
200 3300031595 Ga0265313_10015392 Ga0265313_100153923 325
201 3300031711 Ga0265314_10002624 Ga0265314_1000262414 325
202 3300031712 Ga0265342_10000914 Ga0265342_100009143 325
203 3300003373 JGI25407J50210_10006920 JGI25407J50210_100069201 326
204 3300005337 Ga0070682_100270561 Ga0070682_1002705611 326
205 3300005441 Ga0070700_100002298 Ga0070700_1000022982 326
206 3300005457 Ga0070662_100059946 Ga0070662_1000599462 326
207 3300005539 Ga0068853_100025261 Ga0068853_1000252613 326
208 3300005563 Ga0068855_100102158 Ga0068855_1001021582 326
209 3300005577 Ga0068857_100330185 Ga0068857_1003301852 326
210 3300005937 Ga0081455_10008533 Ga0081455_100085333 326
211 3300005985 Ga0081539_10035888 Ga0081539_100358882 326
212 3300006058 Ga0075432_10004633 Ga0075432_100046333 326
213 3300006844 Ga0075428_100051729 Ga0075428_1000517293 326
214 3300007076 Ga0075435_100067112 Ga0075435_1000671122 326
215 3300009174 Ga0105241_10039135 Ga0105241_100391352 326
216 3300009176 Ga0105242_10070427 Ga0105242_100704273 326
217 3300009545 Ga0105237_10022938 Ga0105237_100229388 326
218 3300010375 Ga0105239_10134188 Ga0105239_101341883 326
219 3300025911 Ga0207654_10036214 Ga0207654_100362143 326
220 3300025912 Ga0207707_10252091 Ga0207707_102520912 326
221 3300025914 Ga0207671_10049719 Ga0207671_100497191 326
222 3300025934 Ga0207686_10108087 Ga0207686_101080872 326
223 3300025938 Ga0207704_10154137 Ga0207704_101541372 326
224 3300026041 Ga0207639_10018656 Ga0207639_100186564 326
225 3300026075 Ga0207708_10011564 Ga0207708_100115644 326
226 3300026116 Ga0207674_10173032 Ga0207674_101730322 326
227 3300027907 Ga0207428_10003561 Ga0207428_100035613 326
228 3300032126 Ga0307415_100016067 Ga0307415_1000160673 326
229 3300037471 Ga0395905_0488496 Ga0395905_0488496_75_1070 326
230 3300048905 Ga0496102_0314293 Ga0496102_0314293_81_1073 326
231 3300049741 Ga0501079_0192233 Ga0501079_0192233_530_1522 326
232 3300049743 Ga0501081_0017581 Ga0501081_0017581_1229_2221 326
233 3300050507 nmdc:mga05p37_11231_c1 nmdc:mga05p37_11231_c1_78_1073 326
234 3300050509 nmdc:mga0qj67_15682_c1 nmdc:mga0qj67_15682_c1_2682_3677 326
235 3300050511 nmdc:mga08y16_5358_c1 nmdc:mga08y16_5358_c1_12345_13340 326
236 3300050515 nmdc:mga0a205_2646_c1 nmdc:mga0a205_2646_c1_87_1082 326
237 3300031239 Ga0265328_10003218 Ga0265328_100032182 328
238 iso_pu_bacteria 2582581293 2585197301 328
239 3300005336 Ga0070680_100051495 Ga0070680_1000514952 329
240 3300006844 Ga0075428_100002991 Ga0075428_1000029915 329
241 3300006846 Ga0075430_100053854 Ga0075430_1000538542 329
242 3300006852 Ga0075433_10174388 Ga0075433_101743881 329
243 3300006880 Ga0075429_100022565 Ga0075429_1000225655 329
244 3300009094 Ga0111539_10007916 Ga0111539_100079167 329
245 3300009094 Ga0111539_10012627 Ga0111539_100126273 329
246 3300014326 Ga0157380_10012837 Ga0157380_100128374 329
247 3300025917 Ga0207660_10068643 Ga0207660_100686433 329
248 3300027907 Ga0207428_10041116 Ga0207428_100411163 329
249 3300028380 Ga0268265_10323401 Ga0268265_103234011 329
250 3300032002 Ga0307416_100083218 Ga0307416_1000832182 329
251 3300049576 Ga0501040_0038071 Ga0501040_0038071_56_1099 329
252 3300049587 Ga0501071_0114982 Ga0501071_0114982_158_1183 329
253 3300049591 Ga0501075_0255781 Ga0501075_0255781_237_1268 329
254 3300050511 nmdc:mga08y16_110251_c1 nmdc:mga08y16_110251_c1_92_1123 329
255 3300050515 nmdc:mga0a205_191393_c1 nmdc:mga0a205_191393_c1_823_1854 329
256 3300049570 Ga0501033_0018994 Ga0501033_0018994_679_1686 330
257 3300009098 Ga0105245_10175844 Ga0105245_101758442 331
258 3300035118 Ga0373954_0019974 Ga0373954_0019974_1095_2156 331
259 3300035170 Ga0373943_0059111 Ga0373943_0059111_494_1555 331
260 3300035172 Ga0373955_0007326 Ga0373955_0007326_3750_4811 331
261 3300035724 Ga0373933_0006132 Ga0373933_0006132_2018_3079 331
262 3300036401 Ga0373937_0001981 Ga0373937_0001981_13985_15046 331
263 3300044656 Ga0466969_0017830 Ga0466969_0017830_2498_3520 331
264 3300044693 Ga0466961_0055352 Ga0466961_0055352_856_1878 331
265 3300044694 Ga0466963_0032708 Ga0466963_0032708_1952_2974 331
266 3300044706 Ga0466964_0117422 Ga0466964_0117422_142_1164 331
267 3300044842 Ga0466957_0120449 Ga0466957_0120449_615_1637 331
268 3300044901 Ga0466960_0016410 Ga0466960_0016410_316_1338 331
269 3300049587 Ga0501071_0254824 Ga0501071_0254824_289_1296 331
270 3300061719 Ga0466962_0062027 Ga0466962_0062027_479_1501 331
271 3300005329 Ga0070683_100106883 Ga0070683_1001068833 332
272 3300005341 Ga0070691_10044797 Ga0070691_100447972 332
273 3300005458 Ga0070681_10026786 Ga0070681_100267866 332
274 3300005530 Ga0070679_100005205 Ga0070679_1000052056 332
275 3300005535 Ga0070684_100363966 Ga0070684_1003639662 332
276 3300005563 Ga0068855_100005534 Ga0068855_10000553416 332
277 3300005614 Ga0068856_100118310 Ga0068856_1001183102 332
278 3300009093 Ga0105240_10003872 Ga0105240_1000387216 332
279 3300009551 Ga0105238_10001165 Ga0105238_1000116516 332
280 3300013104 Ga0157370_10002613 Ga0157370_100026139 332
281 3300013105 Ga0157369_10003590 Ga0157369_1000359017 332
282 3300025912 Ga0207707_10005372 Ga0207707_100053725 332
283 3300025913 Ga0207695_10032983 Ga0207695_100329836 332
284 3300025914 Ga0207671_10241947 Ga0207671_102419472 332
285 3300025917 Ga0207660_10003273 Ga0207660_1000327310 332
286 3300025921 Ga0207652_10000788 Ga0207652_100007884 332
287 3300025924 Ga0207694_10014366 Ga0207694_100143664 332
288 3300025949 Ga0207667_10002466 Ga0207667_100024661 332
289 3300026078 Ga0207702_10093520 Ga0207702_100935203 332
290 3300026142 Ga0207698_10357503 Ga0207698_103575032 332
291 3300028800 Ga0265338_10011296 Ga0265338_100112963 332
292 3300031239 Ga0265328_10004514 Ga0265328_100045148 332
293 3300031240 Ga0265320_10004084 Ga0265320_100040845 332
294 3300031249 Ga0265339_10008776 Ga0265339_100087763 332
295 3300031249 Ga0265339_10016984 Ga0265339_100169843 332
296 3300031712 Ga0265342_10003271 Ga0265342_100032712 332
297 3300031712 Ga0265342_10012774 Ga0265342_100127743 332
298 3300037068 Ga0373925_0260239 Ga0373925_0260239_251_1270 332
299 3300046675 Ga0495657_0048361 Ga0495657_0048361_214_1233 332
300 3300049569 Ga0501032_0212471 Ga0501032_0212471_165_1190 332
301 3300049570 Ga0501033_0231188 Ga0501033_0231188_134_1159 332
302 3300049571 Ga0501034_0207123 Ga0501034_0207123_610_1635 332
303 3300049581 Ga0501047_0307335 Ga0501047_0307335_123_1148 332
304 3300049823 Ga0501044_0061463 Ga0501044_0061463_2203_3228 332
305 3300061719 Ga0466962_0081991 Ga0466962_0081991_314_1360 332
306 iso_pu_bacteria 2513237082 2513558717 335
307 iso_pu_bacteria 2599185239 2599735969 335
308 iso_pu_bacteria 2599185240 2599743809 335
309 iso_pu_bacteria 2599185355 2600207123 335
310 iso_pu_bacteria 2675903129 2676742406 335
311 iso_pu_bacteria 2818991452 2819629984 335
312 iso_pu_bacteria 2870068957 2870074466 335
313 iso_pu_bacteria 2928170801 2928174044 335
314 iso_pu_bacteria 8018845410 8018848665 335
315 iso_pu_bacteria 8020945358 8020952166 335
316 iso_pu_bacteria 8020953355 8020957539 335
317 iso_pu_bacteria 8021120328 8021126300 335
318 iso_pu_bacteria 8039098773 8039099992 335
319 3300005334 Ga0068869_100004501 Ga0068869_1000045013 338
320 3300005356 Ga0070674_100059887 Ga0070674_1000598873 338
321 3300005456 Ga0070678_100070820 Ga0070678_1000708202 338
322 3300005548 Ga0070665_100202379 Ga0070665_1002023792 338
323 3300005617 Ga0068859_100071493 Ga0068859_1000714933 338
324 3300005618 Ga0068864_100571999 Ga0068864_1005719991 338
325 3300005718 Ga0068866_10129537 Ga0068866_101295371 338
326 3300005841 Ga0068863_100079628 Ga0068863_1000796283 338
327 3300005842 Ga0068858_100008379 Ga0068858_10000837911 338
328 3300006237 Ga0097621_100045229 Ga0097621_1000452294 338
329 3300006358 Ga0068871_100050292 Ga0068871_1000502924 338
330 3300006881 Ga0068865_100110043 Ga0068865_1001100432 338
331 3300006931 Ga0097620_100071497 Ga0097620_1000714973 338
332 3300009148 Ga0105243_10020048 Ga0105243_100200483 338
333 3300009176 Ga0105242_10208893 Ga0105242_102088932 338
334 3300009177 Ga0105248_10014337 Ga0105248_1001433710 338
335 3300010375 Ga0105239_10175244 Ga0105239_101752443 338
336 3300011119 Ga0105246_10015809 Ga0105246_100158093 338
337 3300013296 Ga0157374_10485792 Ga0157374_104857921 338
338 3300013308 Ga0157375_10038098 Ga0157375_100380982 338
339 3300014969 Ga0157376_10033749 Ga0157376_100337495 338
340 3300025899 Ga0207642_10077295 Ga0207642_100772952 338
341 3300025926 Ga0207659_10058504 Ga0207659_100585043 338
342 3300025937 Ga0207669_10065067 Ga0207669_100650673 338
343 3300025938 Ga0207704_10107781 Ga0207704_101077812 338
344 3300025940 Ga0207691_10095510 Ga0207691_100955103 338
345 3300025941 Ga0207711_10010626 Ga0207711_100106264 338
346 3300025942 Ga0207689_10003114 Ga0207689_1000311410 338
347 3300025986 Ga0207658_10116317 Ga0207658_101163172 338
348 3300026075 Ga0207708_10280578 Ga0207708_102805781 338
349 3300026088 Ga0207641_10035908 Ga0207641_100359084 338
350 3300026089 Ga0207648_10253575 Ga0207648_102535752 338
351 3300026095 Ga0207676_10432806 Ga0207676_104328062 338
352 3300026118 Ga0207675_100097770 Ga0207675_1000977703 338
353 3300026121 Ga0207683_10062665 Ga0207683_100626653 338
354 3300044656 Ga0466969_0006003 Ga0466969_0006003_1946_2977 338
355 3300044684 Ga0466966_0006929 Ga0466966_0006929_2293_3324 338
356 3300044693 Ga0466961_0002906 Ga0466961_0002906_4443_5474 338
357 3300044719 Ga0466971_0011519 Ga0466971_0011519_1874_2905 338
358 3300044735 Ga0466968_0016583 Ga0466968_0016583_1232_2263 338
359 3300044765 Ga0466970_0002270 Ga0466970_0002270_5470_6501 338
360 3300045049 Ga0466959_0000899 Ga0466959_0000899_9762_10793 338
361 3300061719 Ga0466962_0001334 Ga0466962_0001334_4240_5271 338
362 3300001989 JGI24739J22299_10000874 JGI24739J22299_100008749 339
363 3300003758 Ga0055532_1000276 Ga0055532_100027625 339
364 3300003758 Ga0055532_1000345 Ga0055532_100034520 339
365 3300003760 Ga0055527_1001195 Ga0055527_10011952 339
366 3300003761 Ga0055535_1000172 Ga0055535_100017249 339
367 3300003762 Ga0055542_1000219 Ga0055542_100021950 339
368 3300003763 Ga0055529_1000235 Ga0055529_100023550 339
369 3300003790 Ga0055528_1000827 Ga0055528_10008274 339
370 3300003841 Ga0055541_1004908 Ga0055541_10049082 339
371 3300003856 Ga0058692_1002387 Ga0058692_10023875 339
372 3300009093 Ga0105240_10000397 Ga0105240_1000039735 339
373 3300009545 Ga0105237_10018138 Ga0105237_100181381 339
374 3300025225 Ga0209566_100089 Ga0209566_100089102 339
375 3300025226 Ga0209674_101827 Ga0209674_1018274 339
376 3300025228 Ga0209672_100030 Ga0209672_100030121 339
377 3300025229 Ga0209147_100036 Ga0209147_100036218 339
378 3300025229 Ga0209147_100149 Ga0209147_10014921 339
379 3300025242 Ga0209258_100056 Ga0209258_100056121 339
380 3300025254 Ga0209148_1000105 Ga0209148_1000105120 339
381 3300025272 Ga0209455_1000061 Ga0209455_1000061218 339
382 3300025273 Ga0209673_1000108 Ga0209673_100010868 339
383 3300025295 Ga0209564_1006293 Ga0209564_10062936 339
384 3300025913 Ga0207695_10000305 Ga0207695_1000030575 339
385 3300027312 Ga0209371_1000103 Ga0209371_100010332 339
386 3300030500 Ga0268256_1000119 Ga0268256_100011956 339
387 3300044693 Ga0466961_0020455 Ga0466961_0020455_539_1558 339
388 3300046454 Ga0495592_0001252 Ga0495592_0001252_9865_10884 339
389 3300046458 Ga0495591_001912 Ga0495591_001912_5274_6293 339
390 3300046459 Ga0495629_0003155 Ga0495629_0003155_4432_5451 339
391 3300046462 Ga0495651_0001670 Ga0495651_0001670_10068_11087 339
392 3300046500 Ga0495596_0001708 Ga0495596_0001708_6736_7755 339
393 3300046507 Ga0495606_0197471 Ga0495606_0197471_44_1063 339
394 3300046511 Ga0495608_0022797 Ga0495608_0022797_2535_3554 339
395 3300046514 Ga0495618_0001612 Ga0495618_0001612_12893_13912 339
396 3300046524 Ga0495648_0064785 Ga0495648_0064785_816_1835 339
397 3300046526 Ga0495666_0000370 Ga0495666_0000370_11964_12983 339
398 3300046529 Ga0495652_0030837 Ga0495652_0030837_2407_3426 339
399 3300046533 Ga0495640_0023400 Ga0495640_0023400_1102_2121 339
400 3300046536 Ga0495587_0001688 Ga0495587_0001688_8299_9318 339
401 3300046559 Ga0495667_0177613 Ga0495667_0177613_128_1147 339
402 3300046642 Ga0495634_0010527 Ga0495634_0010527_1063_2082 339
403 3300046663 Ga0495635_0006842 Ga0495635_0006842_6484_7503 339
404 3300046665 Ga0495661_0007191 Ga0495661_0007191_2025_3044 339
405 3300046679 Ga0495623_0003441 Ga0495623_0003441_4049_5068 339
406 3300046680 Ga0495646_0017198 Ga0495646_0017198_666_1685 339
407 3300046684 Ga0495669_0069933 Ga0495669_0069933_367_1386 339
408 3300046689 Ga0495613_0010529 Ga0495613_0010529_1739_2758 339
409 3300046690 Ga0495624_0023344 Ga0495624_0023344_2380_3399 339
410 3300046692 Ga0495671_0013737 Ga0495671_0013737_2162_3181 339
411 3300046794 Ga0495589_0005072 Ga0495589_0005072_5014_6033 339
412 3300047315 Ga0495581_0059385 Ga0495581_0059385_1080_2099 339
413 3300047323 Ga0495683_0002792 Ga0495683_0002792_6130_7149 339
414 3300047443 Ga0495687_000107 Ga0495687_000107_7773_8792 339
415 3300047444 Ga0495675_0000930 Ga0495675_0000930_11822_12841 339
416 3300047446 Ga0495679_001320 Ga0495679_001320_12439_13458 339
417 3300047469 Ga0495673_0002832 Ga0495673_0002832_5138_6157 339
418 3300047471 Ga0495684_0172746 Ga0495684_0172746_374_1393 339
419 3300048088 Ga0495602_0035228 Ga0495602_0035228_2835_3854 339
420 3300048920 Ga0496117_0008559 Ga0496117_0008559_6917_7936 339
421 3300048921 Ga0496118_0002842 Ga0496118_0002842_4528_5547 339

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18191

PnpCD_PnpD_N

Hydroquinone 1,2-dioxygenase large subunit N-terminal

22

181

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zxc-assembly2.cif.gz_Y crystal structure of hydroquinone 1,2-dioxygenase pnpcd in complex with fe3+ 0.9529 18 339
4zxc-assembly2.cif.gz_Y crystal structure of hydroquinone 1,2-dioxygenase pnpcd in complex with fe3+ 0.9443 18 339
5m21-assembly1.cif.gz_D crystal structure of hydroquinone 1,2-dioxygenase from sphingomonas sp. ttnp3 with 4-hydroxybenzoate bound 0.9434 18 339
5m4o-assembly1.cif.gz_D crystal structure of hydroquinone 1,2-dioxygenase from sphingomonas sp. ttnp3 in complex with 4-nitrophenol 0.9428 18 339
5m21-assembly1.cif.gz_D crystal structure of hydroquinone 1,2-dioxygenase from sphingomonas sp. ttnp3 with 4-hydroxybenzoate bound 0.9239 18 339
ID Description Score Start End Superfamily
af_P0AC73_2_142_2.60.120.370 Mainly Beta;Sandwich;Jelly Rolls;YhcH/YjgK/YiaL 0.842 232 318 2.60.120.370
1cauA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8416 240 320 2.60.120.10
1qwrB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8288 235 317 2.60.120.10
2oyzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8287 233 316 2.60.120.10
af_Q09407_1_158_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8232 255 321 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A381V3Q2-F1-model_v4 Hydroquinone 1,2-dioxygenase large subunit N-terminal domain-containing protein 0.9766 18 219
AF-A0A848H1S0-F1-model_v4 Hydroxyquinol 1,2-dioxygenase 0.9601 18 339 GO:0051213
AF-A0A0Q7CYD2-F1-model_v4 Hydroxyquinol 1,2-dioxygenase 0.9593 18 339 GO:0051213
AF-A0A2B4MDT9-F1-model_v4 deleted 0.9587 47 130
AF-A0A6A7LZ78-F1-model_v4 Hydroxyquinol 1,2-dioxygenase 0.9573 18 339 GO:0051213

Feature Viewer

pLDDT pTM Quality
83.86 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map