F440033

General Info

Members Datasets Scaffolds Average Seq Length
421 169 842 291

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10000784|Ga0316576_1000078410
Length 332
Sequence MSPKRPGRVGQGLMRGGVPASEQPAKEPRIERGDTLKQAMSWFEKLIPSRIRTEASTKRAVPEGVWAKCPGCHAILYRAELERNLEVCPKCAHHSRLSARRRLETFLDAEQREEIAGDLESLDPLKFKDLKKYKDRLAQAQKQSAEKEALIVMRGRLKGQPIVAAAFEFGFMGGSMGSVVGERFVRGVEAALERDSPYVCFAASGGARMQESLFSLMQMAKTSAALGRMREQSLPFISVMTDPTMGGVSASLAMLGDLNIAEPNALIGFAGPRVIEQTVHEKLPDGFQRSEFLLDKGALDMIMDRRDLRERIADLLAILTHRPRYCRTVVPV

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
41 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
72 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
76 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
77 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
78 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
79 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
83 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
84 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
85 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
94 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
101 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
102 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
103 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
104 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
105 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
106 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
107 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
108 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
113 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
114 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
133 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
134 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
137 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
140 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
143 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
154 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
155 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
158 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
161 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
162 2884411467 Dyella sp. AD56 Isolate Rhizosphere
163 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
164 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
165 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
166 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
167 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
168 2928963466 Dyella japonica 1073 Isolate Unclassified
169 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.65
Metatranscriptomes 10.21
Isolates 2.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.9
Nodule 0
Rhizoplane 0.95
Rhizosphere 81
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10000784 3300031727 Bacteria 15942
2 Ga0070666_10008407 3300005335 Bacteria 6409
3 Ga0070680_100075184 3300005336 Bacteria 2781
4 Ga0070680_100188539 3300005336 Bacteria 1738
5 Ga0070661_100118270 3300005344 Bacteria 1983
6 Ga0070671_100001122 3300005355 Bacteria 19877
7 Ga0070671_100100730 3300005355 Bacteria 2424
8 Ga0070688_100212464 3300005365 Bacteria 1359
9 Ga0070667_100013591 3300005367 Bacteria 6728
10 Ga0070709_10014821 3300005434 Bacteria 4419
11 Ga0070714_100110845 3300005435 Bacteria 2430
12 Ga0070713_100201681 3300005436 Bacteria 1797
13 Ga0070713_100340157 3300005436 Bacteria 1390
14 Ga0070681_10003088 3300005458 Bacteria 15465
15 Ga0070681_10029515 3300005458 Bacteria 5508
16 Ga0070681_10039559 3300005458 Bacteria 4726
17 Ga0070681_10096797 3300005458 Bacteria 2899
18 Ga0070679_100087606 3300005530 Bacteria 3100
19 Ga0070679_100137749 3300005530 Bacteria 2422
20 Ga0070679_100171042 3300005530 Bacteria 2145
21 Ga0070684_100040170 3300005535 Bacteria 4027
22 Ga0070672_100118714 3300005543 Bacteria 2163
23 Ga0070665_100005998 3300005548 Bacteria 12428
24 Ga0070665_100007162 3300005548 Bacteria 11341
25 Ga0070665_100011984 3300005548 Bacteria 8752
26 Ga0070665_100068789 3300005548 Bacteria 3549
27 Ga0070665_100081279 3300005548 Bacteria 3246
28 Ga0068855_100000562 3300005563 Bacteria 45523
29 Ga0068855_100039949 3300005563 Bacteria 5569
30 Ga0068855_100208140 3300005563 Bacteria 2200
31 Ga0068852_100153132 3300005616 Bacteria 2146
32 Ga0068859_100020772 3300005617 Bacteria 6590
33 Ga0068863_100002743 3300005841 Bacteria 17423
34 Ga0068863_100031991 3300005841 Bacteria 5017
35 Ga0068863_100335982 3300005841 Bacteria 1469
36 Ga0068858_100001412 3300005842 Bacteria 24662
37 Ga0068862_100038998 3300005844 Bacteria 4033
38 Ga0068862_100063373 3300005844 Bacteria 3181
39 Ga0081539_10000058 3300005985 Bacteria 256212
40 Ga0097621_100141057 3300006237 Bacteria 2059
41 Ga0097620_100020772 3300006931 Bacteria 6590
42 Ga0105240_10005427 3300009093 Bacteria 19004
43 Ga0105240_10014209 3300009093 Bacteria 10875
44 Ga0105240_10014372 3300009093 Bacteria 10810
45 Ga0105240_10059826 3300009093 Bacteria 4752
46 Ga0105240_10077496 3300009093 Bacteria 4095
47 Ga0105247_10000270 3300009101 Bacteria 48109
48 Ga0105248_10094162 3300009177 Bacteria 3373
49 Ga0105237_10071764 3300009545 Bacteria 3457
50 Ga0105237_10084698 3300009545 Bacteria 3160
51 Ga0105237_10092971 3300009545 Bacteria 3006
52 Ga0105238_10064663 3300009551 Bacteria 3657
53 Ga0105238_10075769 3300009551 Bacteria 3356
54 Ga0105238_10103942 3300009551 Bacteria 2822
55 Ga0105238_10111740 3300009551 Bacteria 2712
56 Ga0105238_10289391 3300009551 Bacteria 1620
57 Ga0105238_10303174 3300009551 Bacteria 1581
58 Ga0105238_10318830 3300009551 Bacteria 1540
59 Ga0105249_10004587 3300009553 Bacteria 11939
60 Ga0105239_10091469 3300010375 Bacteria 3357
61 Ga0105239_10242162 3300010375 Bacteria 2024
62 Ga0157370_10184790 3300013104 Bacteria 1936
63 Ga0157370_10386362 3300013104 Bacteria 1289
64 Ga0157369_10357573 3300013105 Bacteria 1516
65 Ga0163162_10054974 3300013306 Bacteria 4006
66 Ga0163162_10277951 3300013306 Bacteria 1806
67 Ga0157372_10109608 3300013307 Bacteria 3162
68 Ga0157372_10191224 3300013307 Bacteria 2371
69 Ga0163163_10016222 3300014325 Bacteria 6916
70 Ga0163163_10370898 3300014325 Bacteria 1488
71 Ga0157380_10020663 3300014326 Bacteria 4923
72 Ga0157379_10006321 3300014968 Bacteria 10199
73 Ga0157379_10068874 3300014968 Bacteria 3164
74 Ga0157379_10113909 3300014968 Bacteria 2431
75 Ga0157379_10409115 3300014968 Bacteria 1248
76 Ga0206356_10909673 3300020070 Bacteria 1527
77 Ga0209233_1017789 3300025261 Bacteria 1928
78 Ga0207710_10000691 3300025900 Bacteria 18916
79 Ga0207680_10069734 3300025903 Bacteria 2173
80 Ga0207699_10022791 3300025906 Bacteria 3399
81 Ga0207654_10407263 3300025911 Bacteria 947
82 Ga0207707_10037158 3300025912 Bacteria 4255
83 Ga0207707_10057108 3300025912 Bacteria 3397
84 Ga0207707_10493774 3300025912 Bacteria 1044
85 Ga0207695_10013277 3300025913 Bacteria 9826
86 Ga0207695_10029766 3300025913 Bacteria 6024
87 Ga0207695_10081913 3300025913 Bacteria 3265
88 Ga0207695_10162182 3300025913 Bacteria 2166
89 Ga0207671_10040305 3300025914 Bacteria 3457
90 Ga0207671_10043274 3300025914 Bacteria 3330
91 Ga0207671_10452332 3300025914 Bacteria 1023
92 Ga0207660_10271142 3300025917 Bacteria 1344
93 Ga0207652_10032313 3300025921 Bacteria 4398
94 Ga0207652_10210061 3300025921 Bacteria 1752
95 Ga0207681_10241433 3300025923 Bacteria 1406
96 Ga0207694_10050235 3300025924 Bacteria 3229
97 Ga0207694_10069773 3300025924 Bacteria 2746
98 Ga0207694_10071438 3300025924 Bacteria 2712
99 Ga0207694_10462953 3300025924 Bacteria 1059
100 Ga0207650_10010278 3300025925 Bacteria 6416
101 Ga0207700_10187786 3300025928 Bacteria 1735
102 Ga0207700_10190292 3300025928 Bacteria 1724
103 Ga0207664_10227776 3300025929 Bacteria 1619
104 Ga0207644_10006913 3300025931 Bacteria 7389
105 Ga0207711_10342148 3300025941 Bacteria 1384
106 Ga0207661_10033771 3300025944 Bacteria 3974
107 Ga0207661_10176213 3300025944 Bacteria 1864
108 Ga0207679_10483551 3300025945 Bacteria 1103
109 Ga0207667_10232845 3300025949 Bacteria 1886
110 Ga0207667_10354474 3300025949 Bacteria 1496
111 Ga0207712_10183461 3300025961 Bacteria 1646
112 Ga0207658_10028753 3300025986 Bacteria 3918
113 Ga0207703_10002741 3300026035 Bacteria 15088
114 Ga0207703_10006124 3300026035 Bacteria 9627
115 Ga0207639_10037412 3300026041 Bacteria 3604
116 Ga0207678_10394761 3300026067 Bacteria 1197
117 Ga0207641_10000258 3300026088 Bacteria 67414
118 Ga0207641_10003170 3300026088 Bacteria 14718
119 Ga0207641_10149823 3300026088 Bacteria 2112
120 Ga0207641_10167659 3300026088 Bacteria 2002
121 Ga0207698_10216204 3300026142 Bacteria 1728
122 Ga0268266_10000434 3300028379 Bacteria 62882
123 Ga0268266_10010117 3300028379 Bacteria 8271
124 Ga0268266_10029208 3300028379 Bacteria 4687
125 Ga0268266_10058243 3300028379 Bacteria 3326
126 Ga0268266_10127400 3300028379 Bacteria 2273
127 Ga0268265_10055139 3300028380 Bacteria 3019
128 Ga0268265_10168850 3300028380 Bacteria 1867
129 Ga0268265_10479653 3300028380 Bacteria 1168
130 Ga0265334_10000080 3300028573 Bacteria 69185
131 Ga0265338_10038875 3300028800 Bacteria 4499
132 Ga0265338_10133908 3300028800 Bacteria 1952
133 Ga0307511_10000260 3300030521 Bacteria 54540
134 Ga0307511_10002901 3300030521 Bacteria 17765
135 Ga0265340_10038644 3300031247 Bacteria 2359
136 Ga0265331_10003187 3300031250 Bacteria 10708
137 Ga0307509_10000230 3300031507 Bacteria 90240
138 Ga0316575_10000465 3300031665 Bacteria 11619
139 Ga0316575_10000701 3300031665 Bacteria 9998
140 Ga0316575_10005868 3300031665 Bacteria 4394
141 Ga0316575_10010083 3300031665 Bacteria 3465
142 Ga0316575_10016587 3300031665 Bacteria 2789
143 Ga0316575_10025296 3300031665 Bacteria 2302
144 Ga0316575_10042995 3300031665 Bacteria 1790
145 Ga0316579_10000170 3300031691 Bacteria 18884
146 Ga0316579_10000483 3300031691 Bacteria 12950
147 Ga0316579_10003259 3300031691 Bacteria 6296
148 Ga0316579_10009834 3300031691 Bacteria 4028
149 Ga0316579_10018022 3300031691 Bacteria 3103
150 Ga0316579_10018886 3300031691 Bacteria 3039
151 Ga0316579_10031699 3300031691 Bacteria 2421
152 Ga0316576_10000087 3300031727 Bacteria 32443
153 Ga0316576_10002120 3300031727 Bacteria 11159
154 Ga0316576_10002280 3300031727 Bacteria 10864
155 Ga0316576_10003891 3300031727 Bacteria 8846
156 Ga0316576_10009450 3300031727 Bacteria 6294
157 Ga0316576_10009648 3300031727 Bacteria 6243
158 Ga0316576_10010927 3300031727 Bacteria 5921
159 Ga0316576_10015960 3300031727 Bacteria 5058
160 Ga0316576_10021325 3300031727 Bacteria 4479
161 Ga0316576_10029667 3300031727 Bacteria 3869
162 Ga0316576_10049852 3300031727 Bacteria 3042
163 Ga0316576_10123383 3300031727 Bacteria 1946
164 Ga0316576_10427353 3300031727 Bacteria 980
165 Ga0316578_10000630 3300031728 Bacteria 12447
166 Ga0316578_10001892 3300031728 Bacteria 8842
167 Ga0316578_10002155 3300031728 Bacteria 8481
168 Ga0316578_10004505 3300031728 Bacteria 6588
169 Ga0316578_10019365 3300031728 Bacteria 3745
170 Ga0316578_10022353 3300031728 Bacteria 3525
171 Ga0316578_10024042 3300031728 Bacteria 3416
172 Ga0316578_10030412 3300031728 Bacteria 3070
173 Ga0316578_10030963 3300031728 Bacteria 3045
174 Ga0316578_10042548 3300031728 Bacteria 2634
175 Ga0316578_10050732 3300031728 Bacteria 2428
176 Ga0316578_10058364 3300031728 Bacteria 2269
177 Ga0316578_10068259 3300031728 Bacteria 2102
178 Ga0316578_10103402 3300031728 Bacteria 1708
179 Ga0316578_10106010 3300031728 Bacteria 1687
180 Ga0316578_10131893 3300031728 Bacteria 1503
181 Ga0307516_10004733 3300031730 Bacteria 16636
182 Ga0316577_10000133 3300031733 Bacteria 21962
183 Ga0316577_10001211 3300031733 Bacteria 11967
184 Ga0316577_10002705 3300031733 Bacteria 8822
185 Ga0316577_10003838 3300031733 Bacteria 7658
186 Ga0316577_10012010 3300031733 Bacteria 4708
187 Ga0316577_10073377 3300031733 Bacteria 1910
188 Ga0316577_10092714 3300031733 Bacteria 1691
189 Ga0316577_10151841 3300031733 Bacteria 1306
190 Ga0316577_10168891 3300031733 Bacteria 1234
191 Ga0307412_10231826 3300031911 Bacteria 1422
192 Ga0307415_100161795 3300032126 Bacteria 1736
193 Ga0316583_10002016 3300032133 Bacteria 6957
194 Ga0316583_10003253 3300032133 Bacteria 5708
195 Ga0316583_10014116 3300032133 Bacteria 2881
196 Ga0316583_10041121 3300032133 Bacteria 1636
197 Ga0316583_10072025 3300032133 Bacteria 1209
198 Ga0316585_10000347 3300032137 Bacteria 10551
199 Ga0316585_10000365 3300032137 Bacteria 10403
200 Ga0316585_10009755 3300032137 Bacteria 2810
201 Ga0316585_10026300 3300032137 Bacteria 1809
202 Ga0316585_10063820 3300032137 Bacteria 1191
203 Ga0316580_10000107 3300032139 Bacteria 15287
204 Ga0316580_10000400 3300032139 Bacteria 9778
205 Ga0316580_10002004 3300032139 Bacteria 5505
206 Ga0316580_10008852 3300032139 Bacteria 3022
207 Ga0316580_10012060 3300032139 Bacteria 2629
208 Ga0316580_10013327 3300032139 Bacteria 2506
209 Ga0316580_10025136 3300032139 Bacteria 1841
210 Ga0316580_10037305 3300032139 Bacteria 1503
211 Ga0316593_10000394 3300032168 Bacteria 7810
212 Ga0316593_10000921 3300032168 Bacteria 6026
213 Ga0316593_10001334 3300032168 Bacteria 5386
214 Ga0316593_10001926 3300032168 Bacteria 4761
215 Ga0316593_10002879 3300032168 Bacteria 4176
216 Ga0316593_10003364 3300032168 Bacteria 3958
217 Ga0316593_10003852 3300032168 Bacteria 3776
218 Ga0316593_10003924 3300032168 Bacteria 3754
219 Ga0316593_10004635 3300032168 Bacteria 3546
220 Ga0316593_10008864 3300032168 Bacteria 2823
221 Ga0316593_10010405 3300032168 Bacteria 2667
222 Ga0316593_10016775 3300032168 Bacteria 2225
223 Ga0316593_10018165 3300032168 Bacteria 2157
224 Ga0316593_10026521 3300032168 Bacteria 1853
225 Ga0316593_10039083 3300032168 Bacteria 1573
226 Ga0316593_10048422 3300032168 Bacteria 1430
227 Ga0307507_10142009 3300033179 Bacteria 1838
228 Ga0307510_10000005 3300033180 Bacteria 633068
229 Ga0307510_10013973 3300033180 Bacteria 9504
230 Ga0316592_1000034 3300033524 Bacteria 10807
231 Ga0316592_1000202 3300033524 Bacteria 7222
232 Ga0316592_1001215 3300033524 Bacteria 4061
233 Ga0316592_1001306 3300033524 Bacteria 3968
234 Ga0316592_1001512 3300033524 Bacteria 3766
235 Ga0316592_1001516 3300033524 Bacteria 3765
236 Ga0316592_1016556 3300033524 Bacteria 1541
237 Ga0316586_1000450 3300033527 Bacteria 3983
238 Ga0316588_1001440 3300033528 Bacteria 3894
239 Ga0316588_1001862 3300033528 Bacteria 3579
240 Ga0316588_1004017 3300033528 Bacteria 2744
241 Ga0316588_1039815 3300033528 Bacteria 1122
242 Ga0316587_1001747 3300033529 Bacteria 2763
243 Ga0316587_1009240 3300033529 Bacteria 1561
244 Ga0316596_1000150 3300033541 Bacteria 9690
245 Ga0316596_1000200 3300033541 Bacteria 8792
246 Ga0316596_1000350 3300033541 Bacteria 7556
247 Ga0316596_1000411 3300033541 Bacteria 7126
248 Ga0316596_1001027 3300033541 Bacteria 5383
249 Ga0316596_1001904 3300033541 Bacteria 4368
250 Ga0316596_1002253 3300033541 Bacteria 4090
251 Ga0316596_1002370 3300033541 Bacteria 4014
252 Ga0316596_1003610 3300033541 Bacteria 3409
253 Ga0316596_1009984 3300033541 Bacteria 2288
254 Ga0316596_1027761 3300033541 Bacteria 1461
255 Ga0316596_1028389 3300033541 Bacteria 1446
256 Ga0373932_0038904 3300035112 Bacteria 1362
257 Ga0373936_0012698 3300035113 Bacteria 3207
258 Ga0316574_0000159 3300035398 Bacteria 22018
259 Ga0316574_0001191 3300035398 Bacteria 12069
260 Ga0316574_0002660 3300035398 Bacteria 9019
261 Ga0316574_0005882 3300035398 Bacteria 6581
262 Ga0316574_0006932 3300035398 Bacteria 6169
263 Ga0316574_0010060 3300035398 Bacteria 5325
264 Ga0316574_0017630 3300035398 Bacteria 4183
265 Ga0316574_0027550 3300035398 Bacteria 3423
266 Ga0316574_0070926 3300035398 Bacteria 2200
267 Ga0316574_0071491 3300035398 Bacteria 2192
268 Ga0316574_0115329 3300035398 Bacteria 1723
269 Ga0316574_0158983 3300035398 Bacteria 1456
270 Ga0316574_0198640 3300035398 Bacteria 1289
271 Ga0316574_0209340 3300035398 Bacteria 1251
272 Ga0373927_0244466 3300035695 Bacteria 1179
273 Ga0316582_0004614 3300036647 Bacteria 6988
274 Ga0316582_0004666 3300036647 Bacteria 6959
275 Ga0316582_0004765 3300036647 Bacteria 6911
276 Ga0316582_0005238 3300036647 Bacteria 6647
277 Ga0316582_0009362 3300036647 Bacteria 5314
278 Ga0316582_0015325 3300036647 Bacteria 4379
279 Ga0316582_0018163 3300036647 Bacteria 4086
280 Ga0316582_0019643 3300036647 Bacteria 3960
281 Ga0316582_0023958 3300036647 Bacteria 3644
282 Ga0316582_0026634 3300036647 Bacteria 3482
283 Ga0316582_0027935 3300036647 Bacteria 3414
284 Ga0316582_0036321 3300036647 Bacteria 3049
285 Ga0316582_0037062 3300036647 Bacteria 3021
286 Ga0316582_0039769 3300036647 Bacteria 2930
287 Ga0316582_0098395 3300036647 Bacteria 1935
288 Ga0316582_0148374 3300036647 Bacteria 1584
289 Ga0316582_0178511 3300036647 Bacteria 1444
290 Ga0316582_0196501 3300036647 Bacteria 1375
291 Ga0316584_0001413 3300036712 Bacteria 14365
292 Ga0316584_0001799 3300036712 Bacteria 13230
293 Ga0316584_0003875 3300036712 Bacteria 9816
294 Ga0316584_0009900 3300036712 Bacteria 6639
295 Ga0316584_0012846 3300036712 Bacteria 5913
296 Ga0316584_0014703 3300036712 Bacteria 5583
297 Ga0316584_0019608 3300036712 Bacteria 4890
298 Ga0316584_0042025 3300036712 Bacteria 3408
299 Ga0316584_0051313 3300036712 Bacteria 3084
300 Ga0316584_0171933 3300036712 Bacteria 1606
301 Ga0316584_0238671 3300036712 Bacteria 1331
302 Ga0316584_0254468 3300036712 Bacteria 1282
303 Ga0395898_0058864 3300037466 Bacteria 3740
304 Ga0395898_0222175 3300037466 Bacteria 1802
305 Ga0316581_0000494 3300037588 Bacteria 7616
306 Ga0316581_0003122 3300037588 Bacteria 4086
307 Ga0400484_39316 3300038725 Bacteria 39081
308 Ga0400484_44802 3300038725 Bacteria 5411
309 Ga0400490_12170 3300038726 Bacteria 70825
310 Ga0400490_34077 3300038726 Bacteria 12810
311 Ga0400491_12199 3300038727 Bacteria 1810
312 Ga0400485_17594 3300038735 Bacteria 16483
313 Ga0400488_25304 3300038741 Bacteria 5252
314 Ga0400488_29125 3300038741 Bacteria 1729
315 Ga0400488_40041 3300038741 Bacteria 27128
316 Ga0400488_41513 3300038741 Bacteria 1033
317 Ga0400488_52924 3300038741 Bacteria 3071
318 Ga0400488_54042 3300038741 Bacteria 1566
319 Ga0400486_00116 3300038742 Bacteria 16104
320 Ga0400486_14758 3300038742 Bacteria 1695
321 Ga0400486_24397 3300038742 Bacteria 28696
322 Ga0400486_31801 3300038742 Bacteria 23450
323 Ga0400483_017444 3300039062 Bacteria 2756
324 Ga0400483_035709 3300039062 Bacteria 16380
325 Ga0400483_050628 3300039062 Bacteria 3963
326 Ga0400483_072400 3300039062 Bacteria 15624
327 Ga0400483_126828 3300039062 Unclassified 1872
328 Ga0400483_136211 3300039062 Bacteria 16457
329 Ga0400483_145182 3300039062 Bacteria 1570
330 Ga0400483_155991 3300039062 Bacteria 1747
331 Ga0400483_156159 3300039062 Bacteria 2120
332 Ga0400483_160846 3300039062 Bacteria 5988
333 Ga0400483_169740 3300039062 Bacteria 2295
334 Ga0400483_285179 3300039062 Bacteria 2026
335 Ga0400483_289224 3300039062 Bacteria 44357
336 Ga0400487_01301 3300039110 Bacteria 43520
337 Ga0400487_06222 3300039110 Bacteria 16089
338 Ga0400487_10510 3300039110 Bacteria 18428
339 Ga0400487_13042 3300039110 Bacteria 1669
340 Ga0400487_48530 3300039110 Bacteria 8995
341 Ga0400487_55173 3300039110 Bacteria 2677
342 Ga0436365_1500334 3300039437 Bacteria 6379
343 Ga0436360_0038716 3300039438 Bacteria 4027
344 Ga0436360_1229850 3300039438 Bacteria 3737
345 Ga0436363_0171223 3300039450 Bacteria 1177
346 Ga0451793_0120543 3300041452 Bacteria 2450
347 Ga0451797_0075966 3300041453 Bacteria 981
348 Ga0451802_1259434 3300041460 Bacteria 3881
349 Ga0451577_0059845 3300042876 Bacteria 3396
350 Ga0451577_0234158 3300042876 Bacteria 1661
351 Ga0466969_0031820 3300044656 Bacteria 2684
352 Ga0466969_0108068 3300044656 Bacteria 1304
353 Ga0466966_0065807 3300044684 Bacteria 2278
354 Ga0466966_0078865 3300044684 Bacteria 2053
355 Ga0466966_0166124 3300044684 Bacteria 1342
356 Ga0466961_0029299 3300044693 Bacteria 3539
357 Ga0466964_0022561 3300044706 Bacteria 2443
358 Ga0453684_0002348 3300044712 Bacteria 46286
359 Ga0453684_0004082 3300044712 Bacteria 31712
360 Ga0453684_0006761 3300044712 Bacteria 21583
361 Ga0466971_0043070 3300044719 Bacteria 2028
362 Ga0466970_0010773 3300044765 Bacteria 4648
363 Ga0466959_0017936 3300045049 Bacteria 5192
364 Ga0466959_0039587 3300045049 Bacteria 3484
365 Ga0466959_0045761 3300045049 Bacteria 3222
366 Ga0466958_0016639 3300045836 Bacteria 4238
367 Ga0495590_0003158 3300046457 Bacteria 6738
368 Ga0495638_0000007 3300046460 Bacteria 602783
369 Ga0495650_0066059 3300046471 Bacteria 1433
370 Ga0495606_0058220 3300046507 Bacteria 2485
371 Ga0495616_0066401 3300046513 Bacteria 1755
372 Ga0495632_0040719 3300046519 Bacteria 2338
373 Ga0495649_0198746 3300046694 Bacteria 1042
374 Ga0495687_066919 3300047443 Bacteria 1456
375 Ga0495677_0013042 3300047445 Bacteria 3025
376 Ga0495681_0094581 3300047470 Bacteria 1315
377 Ga0496102_0086435 3300048905 Bacteria 2896
378 Ga0496116_0033050 3300048919 Bacteria 3677
379 Ga0496117_0000012 3300048920 Bacteria 608530
380 Ga0496118_0000003 3300048921 Bacteria 773148
381 Ga0496118_0136059 3300048921 Bacteria 1568
382 Ga0496119_0012102 3300048922 Bacteria 7047
383 Ga0496119_0021198 3300048922 Bacteria 4706
384 Ga0496120_0000796 3300048923 Bacteria 45524
385 Ga0496120_0016560 3300048923 Bacteria 4815
386 Ga0496121_0005660 3300048924 Bacteria 15896
387 Ga0496121_0058040 3300048924 Bacteria 3203
388 Ga0496121_0058655 3300048924 Bacteria 3180
389 Ga0496124_0033790 3300048927 Bacteria 4495
390 Ga0496125_0003375 3300048928 Bacteria 19450
391 Ga0496125_0019752 3300048928 Bacteria 6342
392 Ga0496125_0155878 3300048928 Bacteria 1560
393 Ga0496126_0016997 3300048929 Bacteria 7258
394 Ga0496126_0116631 3300048929 Bacteria 2320
395 Ga0501039_0542444 3300049575 Bacteria 913
396 Ga0501047_0005491 3300049581 Bacteria 11928
397 Ga0501074_0031664 3300049590 Bacteria 3831
398 Ga0501076_0481394 3300049592 Bacteria 1023
399 Ga0501080_0039935 3300049742 Bacteria 4379
400 Ga0501035_0015039 3300049822 Bacteria 7141
401 Ga0501035_0059004 3300049822 Bacteria 3418
402 Ga0501044_0003519 3300049823 Bacteria 17628
403 nmdc:mga0a205_289650_c1 3300050515 Bacteria 1512
404 Ga0500583_0019760 3300053092 Bacteria 2768
405 Ga0500556_0018286 3300053104 Bacteria 2210
406 Ga0500655_035808 3300053133 Bacteria 965
407 Ga0500616_0000425 3300053153 Bacteria 56265
408 Ga0500637_0008320 3300053178 Bacteria 5223
409 Ga0500637_0071159 3300053178 Bacteria 2000
410 Ga0500656_002307 3300053732 Bacteria 1717
411 Ga0501082_0213476 3300060353 Bacteria 1679
412 Ga0466962_0011309 3300061719 Bacteria 4297
413 2691330054 2690315857 Bacteria 4396207
414 2884411910 2884411467 Bacteria 5246714
415 2895398785 2895395659 Bacteria 3983269
416 2919493645 2919493220 Bacteria 4598500
417 2919537715 2919534386 Bacteria 4577686
418 2919544956 2919543075 Bacteria 4728703
419 2923528936 2923525760 Bacteria 4472324
420 2928964250 2928963466 Bacteria 5165703
421 8002872537 8002869464 Bacteria 3588529
422 Ga0316576_10000784
423 Ga0070666_10008407
424 Ga0070680_100075184
425 Ga0070680_100188539
426 Ga0070661_100118270
427 Ga0070671_100001122
428 Ga0070671_100100730
429 Ga0070688_100212464
430 Ga0070667_100013591
431 Ga0070709_10014821
432 Ga0070714_100110845
433 Ga0070713_100201681
434 Ga0070713_100340157
435 Ga0070681_10003088
436 Ga0070681_10029515
437 Ga0070681_10039559
438 Ga0070681_10096797
439 Ga0070679_100087606
440 Ga0070679_100137749
441 Ga0070679_100171042
442 Ga0070684_100040170
443 Ga0070672_100118714
444 Ga0070665_100005998
445 Ga0070665_100007162
446 Ga0070665_100011984
447 Ga0070665_100068789
448 Ga0070665_100081279
449 Ga0068855_100000562
450 Ga0068855_100039949
451 Ga0068855_100208140
452 Ga0068852_100153132
453 Ga0068859_100020772
454 Ga0068863_100002743
455 Ga0068863_100031991
456 Ga0068863_100335982
457 Ga0068858_100001412
458 Ga0068862_100038998
459 Ga0068862_100063373
460 Ga0081539_10000058
461 Ga0097621_100141057
462 Ga0097620_100020772
463 Ga0105240_10005427
464 Ga0105240_10014209
465 Ga0105240_10014372
466 Ga0105240_10059826
467 Ga0105240_10077496
468 Ga0105247_10000270
469 Ga0105248_10094162
470 Ga0105237_10071764
471 Ga0105237_10084698
472 Ga0105237_10092971
473 Ga0105238_10064663
474 Ga0105238_10075769
475 Ga0105238_10103942
476 Ga0105238_10111740
477 Ga0105238_10289391
478 Ga0105238_10303174
479 Ga0105238_10318830
480 Ga0105249_10004587
481 Ga0105239_10091469
482 Ga0105239_10242162
483 Ga0157370_10184790
484 Ga0157370_10386362
485 Ga0157369_10357573
486 Ga0163162_10054974
487 Ga0163162_10277951
488 Ga0157372_10109608
489 Ga0157372_10191224
490 Ga0163163_10016222
491 Ga0163163_10370898
492 Ga0157380_10020663
493 Ga0157379_10006321
494 Ga0157379_10068874
495 Ga0157379_10113909
496 Ga0157379_10409115
497 Ga0206356_10909673
498 Ga0209233_1017789
499 Ga0207710_10000691
500 Ga0207680_10069734
501 Ga0207699_10022791
502 Ga0207654_10407263
503 Ga0207707_10037158
504 Ga0207707_10057108
505 Ga0207707_10493774
506 Ga0207695_10013277
507 Ga0207695_10029766
508 Ga0207695_10081913
509 Ga0207695_10162182
510 Ga0207671_10040305
511 Ga0207671_10043274
512 Ga0207671_10452332
513 Ga0207660_10271142
514 Ga0207652_10032313
515 Ga0207652_10210061
516 Ga0207681_10241433
517 Ga0207694_10050235
518 Ga0207694_10069773
519 Ga0207694_10071438
520 Ga0207694_10462953
521 Ga0207650_10010278
522 Ga0207700_10187786
523 Ga0207700_10190292
524 Ga0207664_10227776
525 Ga0207644_10006913
526 Ga0207711_10342148
527 Ga0207661_10033771
528 Ga0207661_10176213
529 Ga0207679_10483551
530 Ga0207667_10232845
531 Ga0207667_10354474
532 Ga0207712_10183461
533 Ga0207658_10028753
534 Ga0207703_10002741
535 Ga0207703_10006124
536 Ga0207639_10037412
537 Ga0207678_10394761
538 Ga0207641_10000258
539 Ga0207641_10003170
540 Ga0207641_10149823
541 Ga0207641_10167659
542 Ga0207698_10216204
543 Ga0268266_10000434
544 Ga0268266_10010117
545 Ga0268266_10029208
546 Ga0268266_10058243
547 Ga0268266_10127400
548 Ga0268265_10055139
549 Ga0268265_10168850
550 Ga0268265_10479653
551 Ga0265334_10000080
552 Ga0265338_10038875
553 Ga0265338_10133908
554 Ga0307511_10000260
555 Ga0307511_10002901
556 Ga0265340_10038644
557 Ga0265331_10003187
558 Ga0307509_10000230
559 Ga0316575_10000465
560 Ga0316575_10000701
561 Ga0316575_10005868
562 Ga0316575_10010083
563 Ga0316575_10016587
564 Ga0316575_10025296
565 Ga0316575_10042995
566 Ga0316579_10000170
567 Ga0316579_10000483
568 Ga0316579_10003259
569 Ga0316579_10009834
570 Ga0316579_10018022
571 Ga0316579_10018886
572 Ga0316579_10031699
573 Ga0316576_10000087
574 Ga0316576_10002120
575 Ga0316576_10002280
576 Ga0316576_10003891
577 Ga0316576_10009450
578 Ga0316576_10009648
579 Ga0316576_10010927
580 Ga0316576_10015960
581 Ga0316576_10021325
582 Ga0316576_10029667
583 Ga0316576_10049852
584 Ga0316576_10123383
585 Ga0316576_10427353
586 Ga0316578_10000630
587 Ga0316578_10001892
588 Ga0316578_10002155
589 Ga0316578_10004505
590 Ga0316578_10019365
591 Ga0316578_10022353
592 Ga0316578_10024042
593 Ga0316578_10030412
594 Ga0316578_10030963
595 Ga0316578_10042548
596 Ga0316578_10050732
597 Ga0316578_10058364
598 Ga0316578_10068259
599 Ga0316578_10103402
600 Ga0316578_10106010
601 Ga0316578_10131893
602 Ga0307516_10004733
603 Ga0316577_10000133
604 Ga0316577_10001211
605 Ga0316577_10002705
606 Ga0316577_10003838
607 Ga0316577_10012010
608 Ga0316577_10073377
609 Ga0316577_10092714
610 Ga0316577_10151841
611 Ga0316577_10168891
612 Ga0307412_10231826
613 Ga0307415_100161795
614 Ga0316583_10002016
615 Ga0316583_10003253
616 Ga0316583_10014116
617 Ga0316583_10041121
618 Ga0316583_10072025
619 Ga0316585_10000347
620 Ga0316585_10000365
621 Ga0316585_10009755
622 Ga0316585_10026300
623 Ga0316585_10063820
624 Ga0316580_10000107
625 Ga0316580_10000400
626 Ga0316580_10002004
627 Ga0316580_10008852
628 Ga0316580_10012060
629 Ga0316580_10013327
630 Ga0316580_10025136
631 Ga0316580_10037305
632 Ga0316593_10000394
633 Ga0316593_10000921
634 Ga0316593_10001334
635 Ga0316593_10001926
636 Ga0316593_10002879
637 Ga0316593_10003364
638 Ga0316593_10003852
639 Ga0316593_10003924
640 Ga0316593_10004635
641 Ga0316593_10008864
642 Ga0316593_10010405
643 Ga0316593_10016775
644 Ga0316593_10018165
645 Ga0316593_10026521
646 Ga0316593_10039083
647 Ga0316593_10048422
648 Ga0307507_10142009
649 Ga0307510_10000005
650 Ga0307510_10013973
651 Ga0316592_1000034
652 Ga0316592_1000202
653 Ga0316592_1001215
654 Ga0316592_1001306
655 Ga0316592_1001512
656 Ga0316592_1001516
657 Ga0316592_1016556
658 Ga0316586_1000450
659 Ga0316588_1001440
660 Ga0316588_1001862
661 Ga0316588_1004017
662 Ga0316588_1039815
663 Ga0316587_1001747
664 Ga0316587_1009240
665 Ga0316596_1000150
666 Ga0316596_1000200
667 Ga0316596_1000350
668 Ga0316596_1000411
669 Ga0316596_1001027
670 Ga0316596_1001904
671 Ga0316596_1002253
672 Ga0316596_1002370
673 Ga0316596_1003610
674 Ga0316596_1009984
675 Ga0316596_1027761
676 Ga0316596_1028389
677 Ga0373932_0038904
678 Ga0373936_0012698
679 Ga0316574_0000159
680 Ga0316574_0001191
681 Ga0316574_0002660
682 Ga0316574_0005882
683 Ga0316574_0006932
684 Ga0316574_0010060
685 Ga0316574_0017630
686 Ga0316574_0027550
687 Ga0316574_0070926
688 Ga0316574_0071491
689 Ga0316574_0115329
690 Ga0316574_0158983
691 Ga0316574_0198640
692 Ga0316574_0209340
693 Ga0373927_0244466
694 Ga0316582_0004614
695 Ga0316582_0004666
696 Ga0316582_0004765
697 Ga0316582_0005238
698 Ga0316582_0009362
699 Ga0316582_0015325
700 Ga0316582_0018163
701 Ga0316582_0019643
702 Ga0316582_0023958
703 Ga0316582_0026634
704 Ga0316582_0027935
705 Ga0316582_0036321
706 Ga0316582_0037062
707 Ga0316582_0039769
708 Ga0316582_0098395
709 Ga0316582_0148374
710 Ga0316582_0178511
711 Ga0316582_0196501
712 Ga0316584_0001413
713 Ga0316584_0001799
714 Ga0316584_0003875
715 Ga0316584_0009900
716 Ga0316584_0012846
717 Ga0316584_0014703
718 Ga0316584_0019608
719 Ga0316584_0042025
720 Ga0316584_0051313
721 Ga0316584_0171933
722 Ga0316584_0238671
723 Ga0316584_0254468
724 Ga0395898_0058864
725 Ga0395898_0222175
726 Ga0316581_0000494
727 Ga0316581_0003122
728 Ga0400484_39316
729 Ga0400484_44802
730 Ga0400490_12170
731 Ga0400490_34077
732 Ga0400491_12199
733 Ga0400485_17594
734 Ga0400488_25304
735 Ga0400488_29125
736 Ga0400488_40041
737 Ga0400488_41513
738 Ga0400488_52924
739 Ga0400488_54042
740 Ga0400486_00116
741 Ga0400486_14758
742 Ga0400486_24397
743 Ga0400486_31801
744 Ga0400483_017444
745 Ga0400483_035709
746 Ga0400483_050628
747 Ga0400483_072400
748 Ga0400483_126828
749 Ga0400483_136211
750 Ga0400483_145182
751 Ga0400483_155991
752 Ga0400483_156159
753 Ga0400483_160846
754 Ga0400483_169740
755 Ga0400483_285179
756 Ga0400483_289224
757 Ga0400487_01301
758 Ga0400487_06222
759 Ga0400487_10510
760 Ga0400487_13042
761 Ga0400487_48530
762 Ga0400487_55173
763 Ga0436365_1500334
764 Ga0436360_0038716
765 Ga0436360_1229850
766 Ga0436363_0171223
767 Ga0451793_0120543
768 Ga0451797_0075966
769 Ga0451802_1259434
770 Ga0451577_0059845
771 Ga0451577_0234158
772 Ga0466969_0031820
773 Ga0466969_0108068
774 Ga0466966_0065807
775 Ga0466966_0078865
776 Ga0466966_0166124
777 Ga0466961_0029299
778 Ga0466964_0022561
779 Ga0453684_0002348
780 Ga0453684_0004082
781 Ga0453684_0006761
782 Ga0466971_0043070
783 Ga0466970_0010773
784 Ga0466959_0017936
785 Ga0466959_0039587
786 Ga0466959_0045761
787 Ga0466958_0016639
788 Ga0495590_0003158
789 Ga0495638_0000007
790 Ga0495650_0066059
791 Ga0495606_0058220
792 Ga0495616_0066401
793 Ga0495632_0040719
794 Ga0495649_0198746
795 Ga0495687_066919
796 Ga0495677_0013042
797 Ga0495681_0094581
798 Ga0496102_0086435
799 Ga0496116_0033050
800 Ga0496117_0000012
801 Ga0496118_0000003
802 Ga0496118_0136059
803 Ga0496119_0012102
804 Ga0496119_0021198
805 Ga0496120_0000796
806 Ga0496120_0016560
807 Ga0496121_0005660
808 Ga0496121_0058040
809 Ga0496121_0058655
810 Ga0496124_0033790
811 Ga0496125_0003375
812 Ga0496125_0019752
813 Ga0496125_0155878
814 Ga0496126_0016997
815 Ga0496126_0116631
816 Ga0501039_0542444
817 Ga0501047_0005491
818 Ga0501074_0031664
819 Ga0501076_0481394
820 Ga0501080_0039935
821 Ga0501035_0015039
822 Ga0501035_0059004
823 Ga0501044_0003519
824 nmdc:mga0a205_289650_c1
825 Ga0500583_0019760
826 Ga0500556_0018286
827 Ga0500655_035808
828 Ga0500616_0000425
829 Ga0500637_0008320
830 Ga0500637_0071159
831 Ga0500656_002307
832 Ga0501082_0213476
833 Ga0466962_0011309
834 2691330054
835 2884411910
836 2895398785
837 2919493645
838 2919537715
839 2919544956
840 2923528936
841 2928964250
842 8002872537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17848

zf-ACC

Acetyl-CoA carboxylase zinc finger domain

66

91

0.99

PF01039

Carboxyl_trans

Carboxyl transferase domain

111

286

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9i-assembly1.cif.gz_D crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.8831 26 278
2f9y-assembly1.cif.gz_B-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.874 26 283
2f9i-assembly1.cif.gz_D crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.8637 26 278
5kdr-assembly1.cif.gz_B-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.8586 26 278
2f9y-assembly1.cif.gz_B-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.8554 26 283
ID Description Score Start End Superfamily
2f9yB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.874 26 283 3.90.226.10
5kdrB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8586 26 278 3.90.226.10
2f9yB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8554 26 283 3.90.226.10
af_P49158_165_424_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8539 25 278 3.90.226.10
5kdrB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8394 26 278 3.90.226.10
ID Description Score Start End GO Terms
AF-W1XSV4-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta 0.9045 54 164 GO:0003989
GO:0006633
GO:0009329
GO:0016740
GO:2001295
AF-A0A3P6HIQ1-F1-model_v4 CoA carboxyltransferase N-terminal domain-containing protein 0.9045 63 168 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0009507
GO:0016740
GO:0046872
GO:2001295
AF-A0A090QYR6-F1-model_v4 Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2) 0.8869 55 164 GO:0003989
GO:0006633
GO:0009329
GO:0016740
GO:2001295
AF-A0A377CC89-F1-model_v4 AcetylCoA carboxylase (EC 6.4.1.2) 0.8842 55 150 GO:0003989
GO:0006633
GO:0009329
GO:2001295
AF-X0ZD72-F1-model_v4 CoA carboxyltransferase N-terminal domain-containing protein 0.8818 26 129 GO:0003989
GO:0006633
GO:2001295

Map