F440020

General Info

Members Datasets Scaffolds Average Seq Length
421 262 414 188

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10677160|Ga0207652_106771601
Length 190
Sequence MSSSRLEGCRIAILATDGFEQSELTEPKRLLEEAGAKTDVIAPGDATQIKGWKHKEWGEPVPVDVALDDAQVADYDALVLPGGVMNPDRLRTHDDVLAFVRAFFDQHKPVGAICHGPWTLINAGVIKGRHVTSWPSLRQDLVNAGARWTDEEVVAENGLVTSRKPDDIPAFNRAMIELFSAGAKQKRPAA

Samples

Sample ID Description Type Environment
1 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
2 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
3 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
4 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
5 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
6 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
7 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
72 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
79 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
80 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
123 3300029280 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 Metatranscriptome Rhizosphere
124 3300029283 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 Metatranscriptome Rhizosphere
125 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
126 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
145 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
146 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
147 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
198 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
199 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
200 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
201 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
202 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
205 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
206 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
207 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059602 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 15R_AD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 65.8
Metatranscriptomes 32.54
Isolates 1.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.6
Nodule 0
Rhizoplane 2.85
Rhizosphere 81
Stem 0
Stem Tuber 0
Unclassified 8.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10014586 3300003316 Bacteria 4848
2 rootH2_10085053 3300003320 Bacteria 1628
3 rootL2_10002906 3300003322 Bacteria 12743
4 rootL2_10237526 3300003322 Bacteria 1867
5 rootH1_10177314 3300003323 Bacteria 6301
6 Ga0055535_1004538 3300003761 Bacteria 3338
7 Ga0055542_1001495 3300003762 Bacteria 11422
8 Ga0055537_1000017 3300003773 Bacteria 123856
9 Ga0055524_1030923 3300003775 Bacteria 1551
10 Ga0055534_1000867 3300003784 Bacteria 13856
11 Ga0055528_1000365 3300003790 Bacteria 36744
12 Ga0055530_10009508 3300003791 Bacteria 3726
13 Ga0055531_10000080 3300003794 Bacteria 103922
14 Ga0058861_10040801 3300004800 Bacteria 1081
15 Ga0058862_10002388 3300004803 Bacteria 1198
16 Ga0070658_10088568 3300005327 Bacteria 2549
17 Ga0070683_100055081 3300005329 Bacteria 3689
18 Ga0070683_100112431 3300005329 Bacteria 2570
19 Ga0070680_100107787 3300005336 Bacteria 2317
20 Ga0068868_100097107 3300005338 Unclassified 2380
21 Ga0070660_100008380 3300005339 Bacteria 7226
22 Ga0070661_100009847 3300005344 Bacteria 6630
23 Ga0070661_100105136 3300005344 Bacteria 2104
24 Ga0070659_100191462 3300005366 Bacteria 1681
25 Ga0070714_100010045 3300005435 Bacteria 7467
26 Ga0070714_101392923 3300005435 Bacteria 685
27 Ga0070713_100146352 3300005436 Bacteria 2097
28 Ga0070713_100288880 3300005436 Bacteria 1506
29 Ga0070713_100327812 3300005436 Bacteria 1415
30 Ga0070713_100763481 3300005436 Bacteria 925
31 Ga0070710_10074214 3300005437 Bacteria 1968
32 Ga0070710_10143885 3300005437 Bacteria 1465
33 Ga0070710_10295803 3300005437 Bacteria 1055
34 Ga0070708_100049299 3300005445 Bacteria 3725
35 Ga0070681_10055667 3300005458 Bacteria 3937
36 Ga0070681_10122959 3300005458 Bacteria 2528
37 Ga0070706_100009037 3300005467 Bacteria 9278
38 Ga0070706_100157596 3300005467 Bacteria 2119
39 Ga0070707_100068963 3300005468 Bacteria 3404
40 Ga0070698_100011924 3300005471 Bacteria 9223
41 Ga0070698_100870284 3300005471 Bacteria 846
42 Ga0070679_100082156 3300005530 Bacteria 3212
43 Ga0070684_100006723 3300005535 Bacteria 8917
44 Ga0070684_100629210 3300005535 Bacteria 998
45 Ga0070697_100051418 3300005536 Bacteria 3347
46 Ga0068853_100023905 3300005539 Bacteria 5121
47 Ga0068853_100036217 3300005539 Bacteria 4194
48 Ga0070672_100433743 3300005543 Bacteria 1130
49 Ga0070693_100022433 3300005547 Bacteria 3357
50 Ga0070693_100580797 3300005547 Unclassified 806
51 Ga0068855_100003104 3300005563 Bacteria 20331
52 Ga0068855_100030671 3300005563 Bacteria 6428
53 Ga0068855_100046436 3300005563 Bacteria 5134
54 Ga0068855_100727804 3300005563 Bacteria 1060
55 Ga0070664_100000385 3300005564 Bacteria 32897
56 Ga0070664_100058995 3300005564 Bacteria 3265
57 Ga0070664_100390073 3300005564 Bacteria 1272
58 Ga0070664_101316502 3300005564 Bacteria 682
59 Ga0068857_100001867 3300005577 Bacteria 16954
60 Ga0068857_100140240 3300005577 Bacteria 2185
61 Ga0068857_100308435 3300005577 Bacteria 1460
62 Ga0068857_100556155 3300005577 Bacteria 1081
63 Ga0068854_100024763 3300005578 Bacteria 4113
64 Ga0068856_100016222 3300005614 Bacteria 7207
65 Ga0068856_100367606 3300005614 Bacteria 1457
66 Ga0068852_100003682 3300005616 Bacteria 10744
67 Ga0068852_100646742 3300005616 Bacteria 1064
68 Ga0068852_100872997 3300005616 Bacteria 916
69 Ga0068851_10020392 3300005834 Bacteria 3210
70 Ga0068863_100836283 3300005841 Bacteria 919
71 Ga0070717_10098514 3300006028 Bacteria 2478
72 Ga0070717_10127893 3300006028 Bacteria 2182
73 Ga0070717_10350415 3300006028 Bacteria 1320
74 Ga0070717_10546477 3300006028 Bacteria 1049
75 Ga0070716_100387782 3300006173 Bacteria 1000
76 Ga0070712_100064184 3300006175 Bacteria 2603
77 Ga0070712_100131604 3300006175 Bacteria 1896
78 Ga0075431_100289898 3300006847 Bacteria 1656
79 Ga0075431_100564932 3300006847 Bacteria 1124
80 Ga0099795_10185776 3300007788 Bacteria 870
81 Ga0105244_10016630 3300009036 Bacteria 4184
82 Ga0105240_10004898 3300009093 Bacteria 20155
83 Ga0105240_10009917 3300009093 Bacteria 13430
84 Ga0105240_10101532 3300009093 Bacteria 3498
85 Ga0105240_10104863 3300009093 Bacteria 3433
86 Ga0105248_11184290 3300009177 Bacteria 864
87 Ga0105237_10080895 3300009545 Unclassified 3239
88 Ga0105237_10127331 3300009545 Bacteria 2541
89 Ga0105238_10151517 3300009551 Bacteria 2294
90 Ga0105238_10172063 3300009551 Unclassified 2142
91 Ga0105239_10000200 3300010375 Bacteria 87728
92 Ga0105239_10011378 3300010375 Bacteria 9926
93 Ga0105239_10013370 3300010375 Bacteria 9120
94 Ga0105239_10083985 3300010375 Bacteria 3507
95 Ga0157371_10030276 3300013102 Bacteria 3905
96 Ga0157369_10000432 3300013105 Bacteria 55626
97 Ga0163162_10005346 3300013306 Bacteria 12396
98 Ga0163162_10288739 3300013306 Bacteria 1772
99 Ga0163162_11218919 3300013306 Bacteria 854
100 Ga0157375_10628395 3300013308 Bacteria 1231
101 Ga0182005_1000097 3300015265 Bacteria 66720
102 Ga0182005_1000961 3300015265 Bacteria 12529
103 Ga0163161_10172282 3300017792 Bacteria 1655
104 Ga0197907_10067554 3300020069 Bacteria 1514
105 Ga0197907_10400009 3300020069 Bacteria 911
106 Ga0197907_10479407 3300020069 Bacteria 1436
107 Ga0197907_10694918 3300020069 Unclassified 803
108 Ga0197907_10899383 3300020069 Unclassified 1433
109 Ga0197907_10962719 3300020069 Bacteria 1156
110 Ga0206356_10351039 3300020070 Bacteria 1241
111 Ga0206356_10647516 3300020070 Unclassified 2726
112 Ga0206356_10952821 3300020070 Bacteria 1060
113 Ga0206356_11800127 3300020070 Bacteria 614
114 Ga0206349_1210370 3300020075 Bacteria 1366
115 Ga0206349_1351583 3300020075 Unclassified 871
116 Ga0206349_1916708 3300020075 Bacteria 667
117 Ga0206355_1012082 3300020076 Bacteria 2835
118 Ga0206355_1176028 3300020076 Bacteria 608
119 Ga0206355_1264990 3300020076 Bacteria 1181
120 Ga0206355_1585707 3300020076 Bacteria 1445
121 Ga0206351_10116184 3300020077 Bacteria 608
122 Ga0206351_10207571 3300020077 Bacteria 916
123 Ga0206352_10052357 3300020078 Bacteria 674
124 Ga0206352_10769193 3300020078 Bacteria 1284
125 Ga0206350_10329323 3300020080 Bacteria 1936
126 Ga0206350_10552382 3300020080 Bacteria 984
127 Ga0206350_11552788 3300020080 Bacteria 678
128 Ga0206354_10033616 3300020081 Unclassified 1567
129 Ga0206354_11301584 3300020081 Bacteria 1238
130 Ga0206353_11519395 3300020082 Unclassified 679
131 Ga0224712_10073660 3300022467 Bacteria 1393
132 Ga0224712_10179961 3300022467 Unclassified 952
133 Ga0224712_10214059 3300022467 Bacteria 880
134 Ga0256743_118345 3300023436 Unclassified 717
135 Ga0256720_112228 3300023438 Bacteria 1184
136 Ga0256720_149412 3300023438 Unclassified 755
137 Ga0256720_153030 3300023438 Unclassified 839
138 Ga0209436_101465 3300025208 Bacteria 8203
139 Ga0209258_100116 3300025242 Bacteria 190317
140 Ga0209646_1002440 3300025246 Bacteria 4125
141 Ga0209148_1000251 3300025254 Bacteria 85638
142 Ga0209565_1000031 3300025263 Bacteria 320341
143 Ga0209673_1000164 3300025273 Bacteria 138082
144 Ga0209675_1000015 3300025291 Bacteria 403517
145 Ga0209564_1000037 3300025295 Bacteria 414794
146 Ga0209050_1000674 3300025298 Bacteria 51506
147 Ga0209050_1059348 3300025298 Bacteria 913
148 Ga0209256_1045148 3300025299 Bacteria 1097
149 Ga0207426_1041579 3300025302 Bacteria 1424
150 Ga0209257_1000004 3300025304 Bacteria 1678347
151 Ga0209257_1039711 3300025304 Bacteria 1412
152 Ga0207656_10004926 3300025321 Bacteria 4689
153 Ga0207692_10422712 3300025898 Bacteria 835
154 Ga0207699_10090675 3300025906 Bacteria 1918
155 Ga0207699_10361059 3300025906 Bacteria 1027
156 Ga0207705_10435876 3300025909 Bacteria 1015
157 Ga0207684_10005077 3300025910 Bacteria 12273
158 Ga0207707_10058642 3300025912 Bacteria 3350
159 Ga0207707_10131287 3300025912 Bacteria 2191
160 Ga0207707_10739216 3300025912 Bacteria 823
161 Ga0207695_10007306 3300025913 Bacteria 14103
162 Ga0207695_10030838 3300025913 Bacteria 5898
163 Ga0207695_10180884 3300025913 Bacteria 2029
164 Ga0207695_10193896 3300025913 Bacteria 1948
165 Ga0207695_10238905 3300025913 Bacteria 1719
166 Ga0207671_10020534 3300025914 Bacteria 5027
167 Ga0207671_10141453 3300025914 Bacteria 1854
168 Ga0207671_10524981 3300025914 Bacteria 944
169 Ga0207693_10035423 3300025915 Bacteria 3935
170 Ga0207693_10118849 3300025915 Bacteria 2076
171 Ga0207660_10079477 3300025917 Bacteria 2406
172 Ga0207657_10015990 3300025919 Bacteria 7245
173 Ga0207657_10383632 3300025919 Bacteria 1106
174 Ga0207649_10007164 3300025920 Bacteria 6062
175 Ga0207652_10677160 3300025921 Bacteria 921
176 Ga0207652_10820340 3300025921 Bacteria 825
177 Ga0207694_10001955 3300025924 Bacteria 17056
178 Ga0207694_10021878 3300025924 Bacteria 4848
179 Ga0207694_10165482 3300025924 Bacteria 1788
180 Ga0207694_10450244 3300025924 Bacteria 1075
181 Ga0207650_10246920 3300025925 Bacteria 1444
182 Ga0207687_10014797 3300025927 Bacteria 5110
183 Ga0207700_10010634 3300025928 Bacteria 5820
184 Ga0207700_10061895 3300025928 Bacteria 2840
185 Ga0207700_10129210 3300025928 Bacteria 2060
186 Ga0207700_10559803 3300025928 Bacteria 1015
187 Ga0207664_10066932 3300025929 Bacteria 2881
188 Ga0207664_10130396 3300025929 Bacteria 2116
189 Ga0207664_10259328 3300025929 Bacteria 1520
190 Ga0207690_10153556 3300025932 Bacteria 1709
191 Ga0207665_10303143 3300025939 Unclassified 1195
192 Ga0207665_10470995 3300025939 Bacteria 967
193 Ga0207661_10009037 3300025944 Bacteria 7139
194 Ga0207679_10023902 3300025945 Bacteria 4185
195 Ga0207679_10030583 3300025945 Bacteria 3761
196 Ga0207667_10013858 3300025949 Bacteria 9209
197 Ga0207667_10029228 3300025949 Bacteria 5979
198 Ga0207667_10099429 3300025949 Bacteria 3001
199 Ga0207667_10481453 3300025949 Bacteria 1260
200 Ga0207640_10021050 3300025981 Bacteria 3880
201 Ga0207677_10049473 3300026023 Unclassified 2837
202 Ga0207639_10056466 3300026041 Bacteria 3009
203 Ga0207639_11014036 3300026041 Bacteria 778
204 Ga0207702_10009003 3300026078 Bacteria 8405
205 Ga0207674_10000087 3300026116 Bacteria 100668
206 Ga0207674_10349886 3300026116 Bacteria 1429
207 Ga0207698_10028656 3300026142 Bacteria 3975
208 Ga0207698_10289114 3300026142 Bacteria 1520
209 Ga0307515_10000009 3300028794 Bacteria 653206
210 Ga0311001_1065456 3300029277 Bacteria 980
211 Ga0311001_1088242 3300029277 Bacteria 1156
212 Ga0311011_104398 3300029280 Unclassified 1168
213 Ga0310982_126846 3300029283 Unclassified 1185
214 Ga0310981_1000859 3300029285 Unclassified 1249
215 Ga0310981_1079655 3300029285 Unclassified 1268
216 Ga0307514_10304738 3300031649 Bacteria 889
217 Ga0307405_10686900 3300031731 Bacteria 846
218 Ga0307413_10054918 3300031824 Bacteria 2420
219 Ga0307406_11173052 3300031901 Bacteria 666
220 Ga0307407_10070434 3300031903 Bacteria 2079
221 Ga0307415_100103323 3300032126 Bacteria 2096
222 Ga0373945_0067060 3300035116 Bacteria 1350
223 Ga0373946_0066324 3300035171 Bacteria 1547
224 Ga0373935_0040522 3300035692 Bacteria 2924
225 Ga0373935_0268413 3300035692 Bacteria 1198
226 Ga0373927_0011435 3300035695 Bacteria 5911
227 Ga0373947_0294171 3300035725 Bacteria 1081
228 Ga0373937_0000046 3300036401 Bacteria 107501
229 Ga0373937_0032420 3300036401 Bacteria 4739
230 Ga0373925_0089742 3300037068 Bacteria 2348
231 Ga0395899_0000397 3300037312 Bacteria 51693
232 Ga0395900_0115956 3300037418 Bacteria 2749
233 Ga0395900_0123729 3300037418 Bacteria 2653
234 Ga0395898_0011003 3300037466 Bacteria 9428
235 Ga0395898_0019000 3300037466 Bacteria 6999
236 Ga0395898_0273439 3300037466 Bacteria 1611
237 Ga0436361_0441464 3300039447 Bacteria 750
238 Ga0439465_0129668 3300041413 Bacteria 889
239 Ga0451837_1644157 3300041494 Bacteria 2345
240 Ga0439431_0036565 3300041997 Bacteria 1237
241 Ga0439449_0014057 3300042007 Bacteria 3011
242 Ga0439457_045477 3300042014 Bacteria 981
243 Ga0466969_0016483 3300044656 Bacteria 3867
244 Ga0466957_0341908 3300044842 Bacteria 1014
245 Ga0466959_0122313 3300045049 Bacteria 1849
246 Ga0466959_0411366 3300045049 Bacteria 919
247 Ga0466959_0632427 3300045049 Bacteria 719
248 Ga0466958_0175597 3300045836 Bacteria 1358
249 Ga0466958_0232279 3300045836 Bacteria 1178
250 Ga0466958_0239121 3300045836 Bacteria 1160
251 Ga0495651_0187162 3300046462 Bacteria 1460
252 Ga0495580_0233133 3300046472 Bacteria 1263
253 Ga0495582_0050474 3300046473 Bacteria 2292
254 Ga0495643_0003957 3300046522 Bacteria 10599
255 Ga0495665_0390387 3300046531 Bacteria 706
256 Ga0495645_0193303 3300046543 Unclassified 1385
257 Ga0495625_0201142 3300046660 Bacteria 1315
258 Ga0495635_0078433 3300046663 Bacteria 2261
259 Ga0495599_0044231 3300046678 Unclassified 2793
260 Ga0495658_0097222 3300046683 Bacteria 1752
261 Ga0495624_0479102 3300046690 Bacteria 745
262 Ga0495581_0021311 3300047315 Bacteria 3758
263 Ga0496102_0141821 3300048905 Bacteria 2253
264 Ga0496104_0297670 3300048907 Bacteria 1526
265 Ga0496105_0004591 3300048908 Bacteria 10404
266 Ga0496105_0030802 3300048908 Bacteria 4397
267 Ga0496106_0182519 3300048909 Bacteria 1666
268 Ga0496107_0159121 3300048910 Bacteria 1673
269 Ga0496108_1057839 3300048911 Bacteria 691
270 Ga0496109_0876808 3300048912 Bacteria 835
271 Ga0496110_0529882 3300048913 Bacteria 1071
272 Ga0496111_0444196 3300048914 Bacteria 957
273 Ga0496112_0122116 3300048915 Bacteria 2575
274 Ga0496113_0448628 3300048916 Bacteria 1036
275 Ga0496116_0009779 3300048919 Bacteria 8134
276 Ga0496116_0140046 3300048919 Bacteria 1362
277 Ga0496116_0142088 3300048919 Bacteria 1348
278 Ga0496118_0067833 3300048921 Bacteria 2594
279 Ga0496118_0240617 3300048921 Bacteria 1036
280 Ga0496118_0249708 3300048921 Bacteria 1009
281 Ga0496119_0000596 3300048922 Bacteria 48957
282 Ga0496120_0001039 3300048923 Bacteria 37114
283 Ga0496121_0000081 3300048924 Bacteria 229506
284 Ga0496121_0043915 3300048924 Bacteria 3863
285 Ga0496121_0052139 3300048924 Bacteria 3439
286 Ga0496122_0016655 3300048925 Bacteria 6932
287 Ga0496123_0051752 3300048926 Bacteria 2732
288 Ga0496123_0204764 3300048926 Bacteria 1008
289 Ga0496123_0251386 3300048926 Bacteria 872
290 Ga0496124_0035419 3300048927 Bacteria 4367
291 Ga0496124_0050025 3300048927 Bacteria 3562
292 Ga0496124_0057723 3300048927 Bacteria 3269
293 Ga0496125_0046562 3300048928 Bacteria 3637
294 Ga0496125_0072804 3300048928 Bacteria 2675
295 Ga0496125_0153883 3300048928 Bacteria 1574
296 Ga0496126_0047327 3300048929 Bacteria 3937
297 Ga0496126_0131305 3300048929 Bacteria 2164
298 Ga0501037_0402478 3300049573 Bacteria 939
299 Ga0501041_0200789 3300049577 Unclassified 1250
300 Ga0501046_0789024 3300049580 Bacteria 666
301 Ga0501070_0075249 3300049586 Bacteria 2795
302 Ga0501075_0057099 3300049591 Unclassified 2939
303 Ga0501079_0193249 3300049741 Unclassified 1589
304 Ga0501080_0048203 3300049742 Bacteria 3966
305 Ga0501241_000217 3300049758 Bacteria 13023
306 Ga0501044_0263047 3300049823 Unclassified 1663
307 Ga0501045_0164108 3300049824 Unclassified 1654
308 nmdc:mga00v17_388742_c1 3300050491 Bacteria 907
309 nmdc:mga08x19_609203_c1 3300050514 Bacteria 774
310 Ga0500583_0004356 3300053092 Bacteria 4601
311 Ga0500641_0000554 3300053096 Bacteria 13497
312 Ga0500569_000835 3300053109 Bacteria 5462
313 Ga0500658_0024184 3300053134 Bacteria 2325
314 Ga0500577_0001396 3300053142 Bacteria 6180
315 Ga0500589_000077 3300053147 Bacteria 15331
316 Ga0500616_0004658 3300053153 Bacteria 9670
317 Ga0500622_0003031 3300053156 Bacteria 11602
318 Ga0500627_0181512 3300053158 Bacteria 947
319 Ga0500661_000084 3300055283 Bacteria 14952
320 Ga0587093_000271 3300059478 Bacteria 3263
321 Ga0587093_003186 3300059478 Unclassified 1590
322 Ga0587066_000188 3300059490 Bacteria 4123
323 Ga0587066_025478 3300059490 Bacteria 1015
324 Ga0587070_000777 3300059491 Bacteria 2935
325 Ga0587073_0001274 3300059492 Bacteria 2866
326 Ga0587073_0001586 3300059492 Bacteria 2704
327 Ga0587073_0002025 3300059492 Bacteria 2518
328 Ga0587073_0012589 3300059492 Bacteria 1470
329 Ga0587077_001054 3300059493 Bacteria 2794
330 Ga0587077_001695 3300059493 Bacteria 2431
331 Ga0587077_035254 3300059493 Bacteria 977
332 Ga0587080_000302 3300059503 Bacteria 3812
333 Ga0587080_000871 3300059503 Bacteria 2942
334 Ga0587080_018796 3300059503 Bacteria 1113
335 Ga0587080_031378 3300059503 Unclassified 928
336 Ga0587082_004244 3300059504 Unclassified 1781
337 Ga0587083_0000517 3300059505 Bacteria 3505
338 Ga0587083_0044070 3300059505 Bacteria 947
339 Ga0587085_000235 3300059506 Bacteria 3581
340 Ga0587085_000390 3300059506 Bacteria 3149
341 Ga0587085_025244 3300059506 Bacteria 938
342 Ga0587086_000335 3300059507 Bacteria 3190
343 Ga0587086_000345 3300059507 Bacteria 3162
344 Ga0587086_010319 3300059507 Bacteria 1128
345 Ga0587088_001329 3300059508 Bacteria 2531
346 Ga0587088_006671 3300059508 Unclassified 1568
347 Ga0587089_000301 3300059509 Bacteria 3553
348 Ga0587089_000380 3300059509 Bacteria 3305
349 Ga0587090_000447 3300059510 Bacteria 3416
350 Ga0587091_001532 3300059511 Bacteria 2530
351 Ga0587091_002580 3300059511 Bacteria 2170
352 Ga0587092_000257 3300059512 Bacteria 3812
353 Ga0587092_001616 3300059512 Bacteria 2245
354 Ga0587094_000761 3300059513 Bacteria 2738
355 Ga0587094_004436 3300059513 Bacteria 1594
356 Ga0587095_000089 3300059514 Bacteria 3493
357 Ga0587095_000197 3300059514 Bacteria 2709
358 Ga0587095_006627 3300059514 Bacteria 903
359 Ga0587074_00031 3300059602 Bacteria 2932
360 Ga0587098_001509 3300059604 Unclassified 1802
361 Ga0587106_000210 3300059605 Bacteria 3446
362 Ga0587125_000143 3300059607 Bacteria 3275
363 Ga0587129_000718 3300059608 Unclassified 1587
364 Ga0587131_000320 3300059609 Bacteria 1824
365 Ga0587099_000108 3300059622 Bacteria 3400
366 Ga0587101_002737 3300059623 Unclassified 1719
367 Ga0587109_007795 3300059624 Unclassified 1631
368 Ga0587109_059894 3300059624 Bacteria 800
369 Ga0587113_001166 3300059625 Bacteria 1675
370 Ga0587113_004952 3300059625 Bacteria 1080
371 Ga0587115_000358 3300059626 Bacteria 3223
372 Ga0587115_000372 3300059626 Bacteria 3171
373 Ga0587115_011254 3300059626 Unclassified 1126
374 Ga0587117_002200 3300059627 Unclassified 1784
375 Ga0587122_000937 3300059628 Unclassified 1759
376 Ga0587127_000914 3300059629 Bacteria 1531
377 Ga0587127_000982 3300059629 Bacteria 1498
378 Ga0587128_002831 3300059630 Unclassified 1853
379 Ga0587128_040987 3300059630 Unclassified 810
380 Ga0587130_000756 3300059631 Unclassified 2180
381 Ga0587062_000694 3300059639 Bacteria 2531
382 Ga0587067_004912 3300059640 Unclassified 1776
383 Ga0587067_007976 3300059640 Bacteria 1532
384 Ga0587068_006498 3300059641 Unclassified 1639
385 Ga0587069_002854 3300059642 Bacteria 1801
386 Ga0587072_007276 3300059643 Unclassified 1715
387 Ga0587075_002660 3300059644 Bacteria 1912
388 Ga0587076_004249 3300059645 Bacteria 1776
389 Ga0587076_005998 3300059645 Unclassified 1598
390 Ga0587078_000540 3300059646 Bacteria 2898
391 Ga0587078_003482 3300059646 Bacteria 1598
392 Ga0587079_006649 3300059647 Bacteria 1695
393 Ga0587079_008266 3300059647 Bacteria 1586
394 Ga0587100_000190 3300059648 Bacteria 2557
395 Ga0587102_001097 3300059649 Unclassified 1797
396 Ga0587102_001843 3300059649 Unclassified 1559
397 Ga0587104_000128 3300059650 Bacteria 2420
398 Ga0587105_000293 3300059651 Bacteria 1899
399 Ga0587107_000170 3300059652 Bacteria 3516
400 Ga0587107_000184 3300059652 Bacteria 3445
401 Ga0587110_000208 3300059654 Bacteria 3004
402 Ga0587110_004881 3300059654 Unclassified 1185
403 Ga0587114_000146 3300059655 Bacteria 3677
404 Ga0587114_000153 3300059655 Bacteria 3654
405 Ga0587114_000200 3300059655 Bacteria 3382
406 Ga0587118_01544 3300059657 Bacteria 1406
407 Ga0587119_001027 3300059658 Unclassified 2145
408 Ga0587119_008835 3300059658 Bacteria 1115
409 Ga0587120_000244 3300059659 Bacteria 2506
410 Ga0587120_003650 3300059659 Bacteria 1118
411 Ga0587060_000095 3300060243 Bacteria 3385
412 Ga0587096_00125 3300060247 Unclassified 1573
413 Ga0587071_000455 3300060344 Bacteria 4002
414 Ga0587111_0003638 3300060346 Bacteria 2216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003791 Ga0055530_10009508 Ga0055530_100095083 160
2 3300025298 Ga0209050_1000674 Ga0209050_100067434 160
3 3300020078 Ga0206352_10052357 Ga0206352_100523571 165
4 3300046678 Ga0495599_0044231 Ga0495599_0044231_1111_1773 167
5 3300048924 Ga0496121_0052139 Ga0496121_0052139_2175_2717 167
6 3300048928 Ga0496125_0046562 Ga0496125_0046562_590_1132 167
7 3300009036 Ga0105244_10016630 Ga0105244_100166304 168
8 3300013102 Ga0157371_10030276 Ga0157371_100302764 168
9 3300015265 Ga0182005_1000961 Ga0182005_10009614 168
10 3300017792 Ga0163161_10172282 Ga0163161_101722821 168
11 3300048908 Ga0496105_0030802 Ga0496105_0030802_1310_1852 168
12 3300048919 Ga0496116_0009779 Ga0496116_0009779_6079_6621 168
13 3300048919 Ga0496116_0140046 Ga0496116_0140046_399_941 168
14 3300048919 Ga0496116_0142088 Ga0496116_0142088_470_1012 168
15 3300048921 Ga0496118_0240617 Ga0496118_0240617_470_1012 168
16 3300048921 Ga0496118_0249708 Ga0496118_0249708_143_685 168
17 3300048922 Ga0496119_0000596 Ga0496119_0000596_1425_1967 168
18 3300048923 Ga0496120_0001039 Ga0496120_0001039_1418_1960 168
19 3300048924 Ga0496121_0043915 Ga0496121_0043915_1414_1956 168
20 3300048925 Ga0496122_0016655 Ga0496122_0016655_6106_6648 168
21 3300048926 Ga0496123_0051752 Ga0496123_0051752_1205_1747 168
22 3300048926 Ga0496123_0204764 Ga0496123_0204764_70_612 168
23 3300048927 Ga0496124_0050025 Ga0496124_0050025_1809_2351 168
24 3300048927 Ga0496124_0057723 Ga0496124_0057723_804_1346 168
25 3300048928 Ga0496125_0072804 Ga0496125_0072804_1543_2085 168
26 3300048928 Ga0496125_0153883 Ga0496125_0153883_551_1093 168
27 3300048929 Ga0496126_0047327 Ga0496126_0047327_1412_1954 168
28 3300005543 Ga0070672_100433743 Ga0070672_1004337432 174
29 3300025913 Ga0207695_10030838 Ga0207695_100308385 175
30 iso_pu_bacteria 2852649853 2852653317 175
31 iso_pu_bacteria 2941475908 2941477049 175
32 iso_pu_bacteria 2977247770 2977250464 175
33 3300037418 Ga0395900_0115956 Ga0395900_0115956_749_1330 176
34 3300037466 Ga0395898_0273439 Ga0395898_0273439_447_1028 176
35 3300045049 Ga0466959_0411366 Ga0466959_0411366_149_730 176
36 3300009093 Ga0105240_10009917 Ga0105240_1000991712 177
37 3300010375 Ga0105239_10013370 Ga0105239_100133707 177
38 3300041494 Ga0451837_1644157 Ga0451837_1644157_1184_1741 177
39 3300013306 Ga0163162_10005346 Ga0163162_1000534610 178
40 3300013306 Ga0163162_11218919 Ga0163162_112189191 178
41 3300044656 Ga0466969_0016483 Ga0466969_0016483_1186_1734 178
42 3300045049 Ga0466959_0122313 Ga0466959_0122313_505_1053 178
43 3300045836 Ga0466958_0239121 Ga0466958_0239121_147_695 178
44 3300046660 Ga0495625_0201142 Ga0495625_0201142_688_1236 178
45 3300048905 Ga0496102_0141821 Ga0496102_0141821_191_760 178
46 3300053096 Ga0500641_0000554 Ga0500641_0000554_5680_6228 178
47 3300003773 Ga0055537_1000017 Ga0055537_1000017137 179
48 3300003775 Ga0055524_1030923 Ga0055524_10309232 179
49 3300003784 Ga0055534_1000867 Ga0055534_100086712 179
50 3300003790 Ga0055528_1000365 Ga0055528_100036536 179
51 3300009551 Ga0105238_10151517 Ga0105238_101515174 179
52 3300010375 Ga0105239_10000200 Ga0105239_1000020039 179
53 3300025263 Ga0209565_1000031 Ga0209565_1000031200 179
54 3300025273 Ga0209673_1000164 Ga0209673_100016419 179
55 3300025291 Ga0209675_1000015 Ga0209675_1000015299 179
56 3300025295 Ga0209564_1000037 Ga0209564_100003770 179
57 3300025298 Ga0209050_1059348 Ga0209050_10593482 179
58 3300025299 Ga0209256_1045148 Ga0209256_10451482 179
59 3300025304 Ga0209257_1039711 Ga0209257_10397112 179
60 3300025924 Ga0207694_10450244 Ga0207694_104502442 179
61 3300048921 Ga0496118_0067833 Ga0496118_0067833_1786_2328 179
62 3300048926 Ga0496123_0251386 Ga0496123_0251386_59_601 179
63 3300048927 Ga0496124_0035419 Ga0496124_0035419_1229_1771 179
64 3300050491 nmdc:mga00v17_388742_c1 nmdc:mga00v17_388742_c1_272_814 179
65 iso_pu_bacteria 2818991442 2819574959 179
66 iso_pu_bacteria 2821136567 2821141055 179
67 iso_pu_bacteria 2904467357 2904471556 179
68 iso_pu_bacteria 2928115317 2928120126 179
69 3300025912 Ga0207707_10131287 Ga0207707_101312874 180
70 3300039447 Ga0436361_0441464 Ga0436361_0441464_75_719 180
71 3300005327 Ga0070658_10088568 Ga0070658_100885684 181
72 3300005329 Ga0070683_100112431 Ga0070683_1001124313 181
73 3300005336 Ga0070680_100107787 Ga0070680_1001077872 181
74 3300005339 Ga0070660_100008380 Ga0070660_1000083807 181
75 3300005344 Ga0070661_100009847 Ga0070661_1000098474 181
76 3300005344 Ga0070661_100105136 Ga0070661_1001051362 181
77 3300005366 Ga0070659_100191462 Ga0070659_1001914622 181
78 3300005435 Ga0070714_100010045 Ga0070714_1000100454 181
79 3300005437 Ga0070710_10295803 Ga0070710_102958032 181
80 3300005458 Ga0070681_10055667 Ga0070681_100556673 181
81 3300005530 Ga0070679_100082156 Ga0070679_1000821563 181
82 3300005535 Ga0070684_100006723 Ga0070684_1000067237 181
83 3300005539 Ga0068853_100023905 Ga0068853_1000239057 181
84 3300005547 Ga0070693_100022433 Ga0070693_1000224333 181
85 3300005563 Ga0068855_100003104 Ga0068855_10000310411 181
86 3300005563 Ga0068855_100727804 Ga0068855_1007278041 181
87 3300005564 Ga0070664_100000385 Ga0070664_10000038525 181
88 3300005564 Ga0070664_100058995 Ga0070664_1000589953 181
89 3300005577 Ga0068857_100001867 Ga0068857_10000186713 181
90 3300005577 Ga0068857_100140240 Ga0068857_1001402402 181
91 3300005578 Ga0068854_100024763 Ga0068854_1000247634 181
92 3300005614 Ga0068856_100016222 Ga0068856_1000162224 181
93 3300005616 Ga0068852_100003682 Ga0068852_1000036822 181
94 3300005834 Ga0068851_10020392 Ga0068851_100203924 181
95 3300005841 Ga0068863_100836283 Ga0068863_1008362832 181
96 3300009545 Ga0105237_10127331 Ga0105237_101273312 181
97 3300020070 Ga0206356_10952821 Ga0206356_109528212 181
98 3300020075 Ga0206349_1916708 Ga0206349_19167081 181
99 3300020076 Ga0206355_1176028 Ga0206355_11760281 181
100 3300020077 Ga0206351_10116184 Ga0206351_101161841 181
101 3300020080 Ga0206350_11552788 Ga0206350_115527881 181
102 3300020081 Ga0206354_11301584 Ga0206354_113015842 181
103 3300022467 Ga0224712_10073660 Ga0224712_100736602 181
104 3300025321 Ga0207656_10004926 Ga0207656_100049264 181
105 3300025898 Ga0207692_10422712 Ga0207692_104227121 181
106 3300025909 Ga0207705_10435876 Ga0207705_104358762 181
107 3300025912 Ga0207707_10058642 Ga0207707_100586423 181
108 3300025913 Ga0207695_10007306 Ga0207695_100073065 181
109 3300025914 Ga0207671_10020534 Ga0207671_100205343 181
110 3300025917 Ga0207660_10079477 Ga0207660_100794772 181
111 3300025919 Ga0207657_10015990 Ga0207657_100159907 181
112 3300025919 Ga0207657_10383632 Ga0207657_103836322 181
113 3300025920 Ga0207649_10007164 Ga0207649_100071645 181
114 3300025921 Ga0207652_10820340 Ga0207652_108203401 181
115 3300025924 Ga0207694_10001955 Ga0207694_100019558 181
116 3300025929 Ga0207664_10130396 Ga0207664_101303962 181
117 3300025932 Ga0207690_10153556 Ga0207690_101535562 181
118 3300025944 Ga0207661_10009037 Ga0207661_100090375 181
119 3300025945 Ga0207679_10023902 Ga0207679_100239023 181
120 3300025945 Ga0207679_10030583 Ga0207679_100305834 181
121 3300025949 Ga0207667_10029228 Ga0207667_100292283 181
122 3300025949 Ga0207667_10481453 Ga0207667_104814531 181
123 3300025981 Ga0207640_10021050 Ga0207640_100210502 181
124 3300026041 Ga0207639_10056466 Ga0207639_100564663 181
125 3300026041 Ga0207639_11014036 Ga0207639_110140361 181
126 3300026078 Ga0207702_10009003 Ga0207702_100090038 181
127 3300026116 Ga0207674_10000087 Ga0207674_1000008731 181
128 3300026142 Ga0207698_10028656 Ga0207698_100286562 181
129 3300045836 Ga0466958_0232279 Ga0466958_0232279_255_809 181
130 3300048911 Ga0496108_1057839 Ga0496108_1057839_48_608 181
131 3300048912 Ga0496109_0876808 Ga0496109_0876808_76_636 181
132 3300048913 Ga0496110_0529882 Ga0496110_0529882_150_704 181
133 3300048914 Ga0496111_0444196 Ga0496111_0444196_361_915 181
134 3300048915 Ga0496112_0122116 Ga0496112_0122116_1199_1753 181
135 3300048916 Ga0496113_0448628 Ga0496113_0448628_114_668 181
136 3300004800 Ga0058861_10040801 Ga0058861_100408011 182
137 3300004803 Ga0058862_10002388 Ga0058862_100023881 182
138 3300005563 Ga0068855_100030671 Ga0068855_1000306714 182
139 3300009093 Ga0105240_10004898 Ga0105240_1000489815 182
140 3300009177 Ga0105248_11184290 Ga0105248_111842901 182
141 3300013105 Ga0157369_10000432 Ga0157369_1000043226 182
142 3300020069 Ga0197907_10400009 Ga0197907_104000091 182
143 3300020075 Ga0206349_1210370 Ga0206349_12103702 182
144 3300020076 Ga0206355_1585707 Ga0206355_15857072 182
145 3300022467 Ga0224712_10179961 Ga0224712_101799611 182
146 3300022467 Ga0224712_10214059 Ga0224712_102140591 182
147 3300023438 Ga0256720_149412 Ga0256720_1494121 182
148 3300023438 Ga0256720_153030 Ga0256720_1530301 182
149 3300025913 Ga0207695_10180884 Ga0207695_101808842 182
150 3300025925 Ga0207650_10246920 Ga0207650_102469202 182
151 3300025928 Ga0207700_10559803 Ga0207700_105598032 182
152 3300025929 Ga0207664_10066932 Ga0207664_100669324 182
153 3300025949 Ga0207667_10013858 Ga0207667_100138583 182
154 3300028794 Ga0307515_10000009 Ga0307515_10000009425 182
155 3300029277 Ga0311001_1065456 Ga0311001_10654561 182
156 3300029285 Ga0310981_1000859 Ga0310981_10008592 182
157 3300029285 Ga0310981_1079655 Ga0310981_10796551 182
158 3300031649 Ga0307514_10304738 Ga0307514_103047381 182
159 3300037418 Ga0395900_0123729 Ga0395900_0123729_1472_2071 182
160 3300037466 Ga0395898_0011003 Ga0395898_0011003_1577_2176 182
161 3300037466 Ga0395898_0019000 Ga0395898_0019000_1732_2331 182
162 3300045836 Ga0466958_0175597 Ga0466958_0175597_583_1182 182
163 3300049586 Ga0501070_0075249 Ga0501070_0075249_1968_2522 182
164 3300059478 Ga0587093_003186 Ga0587093_003186_420_986 182
165 3300059490 Ga0587066_000188 Ga0587066_000188_1452_2018 182
166 3300059491 Ga0587070_000777 Ga0587070_000777_1672_2238 182
167 3300059492 Ga0587073_0001586 Ga0587073_0001586_37_603 182
168 3300059492 Ga0587073_0002025 Ga0587073_0002025_1559_2125 182
169 3300059492 Ga0587073_0012589 Ga0587073_0012589_726_1292 182
170 3300059493 Ga0587077_001695 Ga0587077_001695_370_936 182
171 3300059493 Ga0587077_035254 Ga0587077_035254_13_579 182
172 3300059503 Ga0587080_000871 Ga0587080_000871_703_1269 182
173 3300059503 Ga0587080_018796 Ga0587080_018796_371_937 182
174 3300059504 Ga0587082_004244 Ga0587082_004244_724_1290 182
175 3300059505 Ga0587083_0000517 Ga0587083_0000517_2124_2690 182
176 3300059505 Ga0587083_0044070 Ga0587083_0044070_369_935 182
177 3300059506 Ga0587085_000235 Ga0587085_000235_917_1483 182
178 3300059507 Ga0587086_000335 Ga0587086_000335_953_1519 182
179 3300059507 Ga0587086_010319 Ga0587086_010319_79_645 182
180 3300059508 Ga0587088_001329 Ga0587088_001329_1565_2131 182
181 3300059508 Ga0587088_006671 Ga0587088_006671_483_1049 182
182 3300059509 Ga0587089_000301 Ga0587089_000301_893_1459 182
183 3300059509 Ga0587089_000380 Ga0587089_000380_634_1200 182
184 3300059510 Ga0587090_000447 Ga0587090_000447_2102_2668 182
185 3300059511 Ga0587091_001532 Ga0587091_001532_1485_2051 182
186 3300059511 Ga0587091_002580 Ga0587091_002580_600_1166 182
187 3300059512 Ga0587092_000257 Ga0587092_000257_1571_2137 182
188 3300059513 Ga0587094_000761 Ga0587094_000761_864_1430 182
189 3300059513 Ga0587094_004436 Ga0587094_004436_562_1128 182
190 3300059514 Ga0587095_000089 Ga0587095_000089_828_1394 182
191 3300059514 Ga0587095_006627 Ga0587095_006627_175_741 182
192 3300059602 Ga0587074_00031 Ga0587074_00031_1884_2450 182
193 3300059604 Ga0587098_001509 Ga0587098_001509_787_1353 182
194 3300059605 Ga0587106_000210 Ga0587106_000210_2101_2667 182
195 3300059608 Ga0587129_000718 Ga0587129_000718_421_987 182
196 3300059609 Ga0587131_000320 Ga0587131_000320_602_1168 182
197 3300059622 Ga0587099_000108 Ga0587099_000108_730_1296 182
198 3300059623 Ga0587101_002737 Ga0587101_002737_554_1120 182
199 3300059624 Ga0587109_007795 Ga0587109_007795_600_1166 182
200 3300059624 Ga0587109_059894 Ga0587109_059894_107_673 182
201 3300059625 Ga0587113_001166 Ga0587113_001166_368_934 182
202 3300059626 Ga0587115_000358 Ga0587115_000358_2002_2568 182
203 3300059626 Ga0587115_000372 Ga0587115_000372_1981_2547 182
204 3300059627 Ga0587117_002200 Ga0587117_002200_805_1371 182
205 3300059628 Ga0587122_000937 Ga0587122_000937_709_1275 182
206 3300059629 Ga0587127_000914 Ga0587127_000914_284_850 182
207 3300059629 Ga0587127_000982 Ga0587127_000982_534_1100 182
208 3300059630 Ga0587128_002831 Ga0587128_002831_729_1295 182
209 3300059631 Ga0587130_000756 Ga0587130_000756_368_934 182
210 3300059639 Ga0587062_000694 Ga0587062_000694_604_1170 182
211 3300059640 Ga0587067_004912 Ga0587067_004912_448_1014 182
212 3300059640 Ga0587067_007976 Ga0587067_007976_396_962 182
213 3300059641 Ga0587068_006498 Ga0587068_006498_600_1166 182
214 3300059642 Ga0587069_002854 Ga0587069_002854_370_936 182
215 3300059643 Ga0587072_007276 Ga0587072_007276_457_1023 182
216 3300059644 Ga0587075_002660 Ga0587075_002660_370_936 182
217 3300059645 Ga0587076_004249 Ga0587076_004249_750_1316 182
218 3300059645 Ga0587076_005998 Ga0587076_005998_430_996 182
219 3300059646 Ga0587078_003482 Ga0587078_003482_368_934 182
220 3300059647 Ga0587079_006649 Ga0587079_006649_368_934 182
221 3300059647 Ga0587079_008266 Ga0587079_008266_383_949 182
222 3300059648 Ga0587100_000190 Ga0587100_000190_1341_1907 182
223 3300059649 Ga0587102_001843 Ga0587102_001843_605_1171 182
224 3300059650 Ga0587104_000128 Ga0587104_000128_472_1038 182
225 3300059651 Ga0587105_000293 Ga0587105_000293_456_1022 182
226 3300059652 Ga0587107_000184 Ga0587107_000184_777_1343 182
227 3300059654 Ga0587110_000208 Ga0587110_000208_1120_1686 182
228 3300059655 Ga0587114_000146 Ga0587114_000146_904_1470 182
229 3300059655 Ga0587114_000200 Ga0587114_000200_711_1277 182
230 3300059657 Ga0587118_01544 Ga0587118_01544_483_1049 182
231 3300059658 Ga0587119_001027 Ga0587119_001027_702_1268 182
232 3300059658 Ga0587119_008835 Ga0587119_008835_155_721 182
233 3300059659 Ga0587120_000244 Ga0587120_000244_1341_1907 182
234 3300059659 Ga0587120_003650 Ga0587120_003650_478_1044 182
235 3300060243 Ga0587060_000095 Ga0587060_000095_2106_2672 182
236 3300060247 Ga0587096_00125 Ga0587096_00125_412_978 182
237 3300060344 Ga0587071_000455 Ga0587071_000455_1318_1884 182
238 3300060346 Ga0587111_0003638 Ga0587111_0003638_978_1544 182
239 3300003316 rootH1_10014586 rootH1_100145865 183
240 3300003320 rootH2_10085053 rootH2_100850531 183
241 3300003322 rootL2_10002906 rootL2_1000290612 183
242 3300003322 rootL2_10237526 rootL2_102375263 183
243 3300003323 rootH1_10177314 rootH1_101773144 183
244 3300003761 Ga0055535_1004538 Ga0055535_10045383 183
245 3300003762 Ga0055542_1001495 Ga0055542_100149511 183
246 3300003794 Ga0055531_10000080 Ga0055531_1000008011 183
247 3300005329 Ga0070683_100055081 Ga0070683_1000550813 183
248 3300005338 Ga0068868_100097107 Ga0068868_1000971072 183
249 3300005435 Ga0070714_101392923 Ga0070714_1013929231 183
250 3300005436 Ga0070713_100146352 Ga0070713_1001463521 183
251 3300005436 Ga0070713_100288880 Ga0070713_1002888802 183
252 3300005436 Ga0070713_100327812 Ga0070713_1003278122 183
253 3300005436 Ga0070713_100763481 Ga0070713_1007634811 183
254 3300005437 Ga0070710_10074214 Ga0070710_100742142 183
255 3300005437 Ga0070710_10143885 Ga0070710_101438852 183
256 3300005445 Ga0070708_100049299 Ga0070708_1000492993 183
257 3300005458 Ga0070681_10122959 Ga0070681_101229592 183
258 3300005467 Ga0070706_100009037 Ga0070706_1000090376 183
259 3300005467 Ga0070706_100157596 Ga0070706_1001575962 183
260 3300005468 Ga0070707_100068963 Ga0070707_1000689633 183
261 3300005471 Ga0070698_100011924 Ga0070698_1000119246 183
262 3300005471 Ga0070698_100870284 Ga0070698_1008702841 183
263 3300005535 Ga0070684_100629210 Ga0070684_1006292102 183
264 3300005536 Ga0070697_100051418 Ga0070697_1000514184 183
265 3300005539 Ga0068853_100036217 Ga0068853_1000362174 183
266 3300005547 Ga0070693_100580797 Ga0070693_1005807971 183
267 3300005563 Ga0068855_100046436 Ga0068855_1000464363 183
268 3300005564 Ga0070664_100390073 Ga0070664_1003900732 183
269 3300005564 Ga0070664_101316502 Ga0070664_1013165021 183
270 3300005577 Ga0068857_100308435 Ga0068857_1003084352 183
271 3300005577 Ga0068857_100556155 Ga0068857_1005561552 183
272 3300005614 Ga0068856_100367606 Ga0068856_1003676062 183
273 3300005616 Ga0068852_100646742 Ga0068852_1006467422 183
274 3300005616 Ga0068852_100872997 Ga0068852_1008729972 183
275 3300006028 Ga0070717_10098514 Ga0070717_100985143 183
276 3300006028 Ga0070717_10127893 Ga0070717_101278932 183
277 3300006028 Ga0070717_10350415 Ga0070717_103504152 183
278 3300006028 Ga0070717_10546477 Ga0070717_105464773 183
279 3300006173 Ga0070716_100387782 Ga0070716_1003877821 183
280 3300006175 Ga0070712_100064184 Ga0070712_1000641842 183
281 3300006175 Ga0070712_100131604 Ga0070712_1001316041 183
282 3300006847 Ga0075431_100289898 Ga0075431_1002898982 183
283 3300006847 Ga0075431_100564932 Ga0075431_1005649323 183
284 3300007788 Ga0099795_10185776 Ga0099795_101857761 183
285 3300009093 Ga0105240_10101532 Ga0105240_101015326 183
286 3300009093 Ga0105240_10104863 Ga0105240_101048632 183
287 3300009545 Ga0105237_10080895 Ga0105237_100808954 183
288 3300009551 Ga0105238_10172063 Ga0105238_101720632 183
289 3300010375 Ga0105239_10011378 Ga0105239_100113786 183
290 3300010375 Ga0105239_10083985 Ga0105239_100839854 183
291 3300013306 Ga0163162_10288739 Ga0163162_102887392 183
292 3300013308 Ga0157375_10628395 Ga0157375_106283952 183
293 3300015265 Ga0182005_1000097 Ga0182005_10000974 183
294 3300020069 Ga0197907_10067554 Ga0197907_100675542 183
295 3300020069 Ga0197907_10479407 Ga0197907_104794071 183
296 3300020069 Ga0197907_10694918 Ga0197907_106949182 183
297 3300020069 Ga0197907_10899383 Ga0197907_108993832 183
298 3300020069 Ga0197907_10962719 Ga0197907_109627191 183
299 3300020070 Ga0206356_10351039 Ga0206356_103510392 183
300 3300020070 Ga0206356_10647516 Ga0206356_106475163 183
301 3300020070 Ga0206356_11800127 Ga0206356_118001271 183
302 3300020075 Ga0206349_1351583 Ga0206349_13515832 183
303 3300020076 Ga0206355_1012082 Ga0206355_10120821 183
304 3300020076 Ga0206355_1264990 Ga0206355_12649902 183
305 3300020077 Ga0206351_10207571 Ga0206351_102075711 183
306 3300020078 Ga0206352_10769193 Ga0206352_107691932 183
307 3300020080 Ga0206350_10329323 Ga0206350_103293232 183
308 3300020080 Ga0206350_10552382 Ga0206350_105523821 183
309 3300020081 Ga0206354_10033616 Ga0206354_100336162 183
310 3300020082 Ga0206353_11519395 Ga0206353_115193951 183
311 3300023436 Ga0256743_118345 Ga0256743_1183451 183
312 3300023438 Ga0256720_112228 Ga0256720_1122282 183
313 3300025208 Ga0209436_101465 Ga0209436_1014654 183
314 3300025242 Ga0209258_100116 Ga0209258_10011630 183
315 3300025246 Ga0209646_1002440 Ga0209646_10024404 183
316 3300025254 Ga0209148_1000251 Ga0209148_100025130 183
317 3300025302 Ga0207426_1041579 Ga0207426_10415791 183
318 3300025304 Ga0209257_1000004 Ga0209257_10000049 183
319 3300025906 Ga0207699_10090675 Ga0207699_100906752 183
320 3300025906 Ga0207699_10361059 Ga0207699_103610592 183
321 3300025910 Ga0207684_10005077 Ga0207684_100050773 183
322 3300025912 Ga0207707_10739216 Ga0207707_107392161 183
323 3300025913 Ga0207695_10193896 Ga0207695_101938962 183
324 3300025913 Ga0207695_10238905 Ga0207695_102389052 183
325 3300025914 Ga0207671_10141453 Ga0207671_101414532 183
326 3300025914 Ga0207671_10524981 Ga0207671_105249812 183
327 3300025915 Ga0207693_10035423 Ga0207693_100354232 183
328 3300025915 Ga0207693_10118849 Ga0207693_101188492 183
329 3300025921 Ga0207652_10677160 Ga0207652_106771601 183
330 3300025924 Ga0207694_10021878 Ga0207694_100218783 183
331 3300025924 Ga0207694_10165482 Ga0207694_101654821 183
332 3300025927 Ga0207687_10014797 Ga0207687_100147975 183
333 3300025928 Ga0207700_10010634 Ga0207700_100106343 183
334 3300025928 Ga0207700_10061895 Ga0207700_100618951 183
335 3300025928 Ga0207700_10129210 Ga0207700_101292102 183
336 3300025929 Ga0207664_10259328 Ga0207664_102593282 183
337 3300025939 Ga0207665_10303143 Ga0207665_103031431 183
338 3300025939 Ga0207665_10470995 Ga0207665_104709951 183
339 3300025949 Ga0207667_10099429 Ga0207667_100994292 183
340 3300026023 Ga0207677_10049473 Ga0207677_100494733 183
341 3300026116 Ga0207674_10349886 Ga0207674_103498862 183
342 3300026142 Ga0207698_10289114 Ga0207698_102891142 183
343 3300029277 Ga0311001_1088242 Ga0311001_10882422 183
344 3300029280 Ga0311011_104398 Ga0311011_1043982 183
345 3300029283 Ga0310982_126846 Ga0310982_1268462 183
346 3300031731 Ga0307405_10686900 Ga0307405_106869002 183
347 3300031824 Ga0307413_10054918 Ga0307413_100549181 183
348 3300031901 Ga0307406_11173052 Ga0307406_111730521 183
349 3300031903 Ga0307407_10070434 Ga0307407_100704342 183
350 3300032126 Ga0307415_100103323 Ga0307415_1001033232 183
351 3300035116 Ga0373945_0067060 Ga0373945_0067060_479_1108 183
352 3300035171 Ga0373946_0066324 Ga0373946_0066324_270_899 183
353 3300035692 Ga0373935_0040522 Ga0373935_0040522_1089_1658 183
354 3300035692 Ga0373935_0268413 Ga0373935_0268413_309_938 183
355 3300035695 Ga0373927_0011435 Ga0373927_0011435_1545_2174 183
356 3300035725 Ga0373947_0294171 Ga0373947_0294171_205_834 183
357 3300036401 Ga0373937_0000046 Ga0373937_0000046_46599_47168 183
358 3300036401 Ga0373937_0032420 Ga0373937_0032420_3587_4156 183
359 3300037068 Ga0373925_0089742 Ga0373925_0089742_421_1050 183
360 3300037312 Ga0395899_0000397 Ga0395899_0000397_37184_37783 183
361 3300041413 Ga0439465_0129668 Ga0439465_0129668_166_717 183
362 3300041997 Ga0439431_0036565 Ga0439431_0036565_270_821 183
363 3300042007 Ga0439449_0014057 Ga0439449_0014057_2346_2897 183
364 3300042014 Ga0439457_045477 Ga0439457_045477_109_660 183
365 3300044842 Ga0466957_0341908 Ga0466957_0341908_356_907 183
366 3300045049 Ga0466959_0632427 Ga0466959_0632427_36_599 183
367 3300046462 Ga0495651_0187162 Ga0495651_0187162_43_648 183
368 3300046472 Ga0495580_0233133 Ga0495580_0233133_90_719 183
369 3300046473 Ga0495582_0050474 Ga0495582_0050474_1217_1846 183
370 3300046522 Ga0495643_0003957 Ga0495643_0003957_6421_7029 183
371 3300046531 Ga0495665_0390387 Ga0495665_0390387_61_690 183
372 3300046543 Ga0495645_0193303 Ga0495645_0193303_363_968 183
373 3300046663 Ga0495635_0078433 Ga0495635_0078433_482_1111 183
374 3300046683 Ga0495658_0097222 Ga0495658_0097222_289_918 183
375 3300046690 Ga0495624_0479102 Ga0495624_0479102_37_666 183
376 3300047315 Ga0495581_0021311 Ga0495581_0021311_3086_3715 183
377 3300048907 Ga0496104_0297670 Ga0496104_0297670_184_771 183
378 3300048908 Ga0496105_0004591 Ga0496105_0004591_32_619 183
379 3300048909 Ga0496106_0182519 Ga0496106_0182519_375_944 183
380 3300048910 Ga0496107_0159121 Ga0496107_0159121_521_1090 183
381 3300048924 Ga0496121_0000081 Ga0496121_0000081_108995_109546 183
382 3300048929 Ga0496126_0131305 Ga0496126_0131305_1452_2003 183
383 3300049573 Ga0501037_0402478 Ga0501037_0402478_173_739 183
384 3300049577 Ga0501041_0200789 Ga0501041_0200789_70_666 183
385 3300049580 Ga0501046_0789024 Ga0501046_0789024_20_616 183
386 3300049591 Ga0501075_0057099 Ga0501075_0057099_42_638 183
387 3300049741 Ga0501079_0193249 Ga0501079_0193249_71_667 183
388 3300049742 Ga0501080_0048203 Ga0501080_0048203_688_1284 183
389 3300049758 Ga0501241_000217 Ga0501241_000217_8567_9118 183
390 3300049823 Ga0501044_0263047 Ga0501044_0263047_478_1059 183
391 3300049824 Ga0501045_0164108 Ga0501045_0164108_71_667 183
392 3300050514 nmdc:mga08x19_609203_c1 nmdc:mga08x19_609203_c1_118_690 183
393 3300053092 Ga0500583_0004356 Ga0500583_0004356_273_824 183
394 3300053109 Ga0500569_000835 Ga0500569_000835_1522_2073 183
395 3300053134 Ga0500658_0024184 Ga0500658_0024184_921_1472 183
396 3300053142 Ga0500577_0001396 Ga0500577_0001396_1007_1558 183
397 3300053147 Ga0500589_000077 Ga0500589_000077_14754_15305 183
398 3300053153 Ga0500616_0004658 Ga0500616_0004658_1649_2200 183
399 3300053156 Ga0500622_0003031 Ga0500622_0003031_7484_8035 183
400 3300053158 Ga0500627_0181512 Ga0500627_0181512_34_621 183
401 3300055283 Ga0500661_000084 Ga0500661_000084_13592_14143 183
402 3300059478 Ga0587093_000271 Ga0587093_000271_589_1158 183
403 3300059490 Ga0587066_025478 Ga0587066_025478_387_956 183
404 3300059492 Ga0587073_0001274 Ga0587073_0001274_1386_2090 183
405 3300059493 Ga0587077_001054 Ga0587077_001054_125_694 183
406 3300059503 Ga0587080_000302 Ga0587080_000302_1138_1707 183
407 3300059503 Ga0587080_031378 Ga0587080_031378_120_689 183
408 3300059506 Ga0587085_000390 Ga0587085_000390_474_1178 183
409 3300059506 Ga0587085_025244 Ga0587085_025244_109_678 183
410 3300059507 Ga0587086_000345 Ga0587086_000345_1969_2673 183
411 3300059512 Ga0587092_001616 Ga0587092_001616_933_1637 183
412 3300059514 Ga0587095_000197 Ga0587095_000197_34_738 183
413 3300059607 Ga0587125_000143 Ga0587125_000143_600_1304 183
414 3300059625 Ga0587113_004952 Ga0587113_004952_28_597 183
415 3300059626 Ga0587115_011254 Ga0587115_011254_545_1114 183
416 3300059630 Ga0587128_040987 Ga0587128_040987_211_780 183
417 3300059646 Ga0587078_000540 Ga0587078_000540_223_927 183
418 3300059649 Ga0587102_001097 Ga0587102_001097_858_1427 183
419 3300059652 Ga0587107_000170 Ga0587107_000170_2103_2672 183
420 3300059654 Ga0587110_004881 Ga0587110_004881_536_1105 183
421 3300059655 Ga0587114_000153 Ga0587114_000153_977_1681 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

9

178

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vrn-assembly1.cif.gz_B the structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily 0.985 5 182
6q3t-assembly1.cif.gz_A structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device 0.9825 9 175
6f2f-assembly1.cif.gz_A crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. 0.9815 9 177
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9811 7 177
7r66-assembly1.cif.gz_A structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution 0.9771 9 177
ID Description Score Start End Superfamily
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9815 9 177 3.40.50.880
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9777 5 182 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9641 9 177 3.40.50.880
3fseB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9585 7 178 3.40.50.880
1oi4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9574 8 177 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A3C0B766-F1-model_v4 Protease 1.001 95 183 GO:0006508
GO:0008233
AF-A0A7V9QL38-F1-model_v4 DJ-1/PfpI family protein 0.9974 88 182
AF-A0A3N1PQS0-F1-model_v4 Protease I 0.9967 1 182 GO:0006508
GO:0008233
AF-A0A3R8PL51-F1-model_v4 deleted 0.9965 61 182
AF-A0A520A5Y9-F1-model_v4 Type 1 glutamine amidotransferase 0.9959 3 182 GO:0016740

Feature Viewer

pLDDT pTM Quality
95.99 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map