F439994

General Info

Members Datasets Scaffolds Average Seq Length
421 376 842 136

Family's Representative Sequence

Representative Sequence 3300013249|Ga0171463_1004|Ga0171463_100460
Length 141
Sequence MMTAQPNRKARWQLPFAAVLVVYAAVAGLLISMLPIKDGARDWFAPLVAGGWMAWSFPSAMFFLTIFALLSMMAVWEYASPGGNPRVGILRFETTRGDRLFVSLLGSAFIHLAWLGFVGGQNLWWALTLSLVYAVGVFRYV

Samples

Sample ID Description Type Environment
1 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
21 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
22 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
23 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
24 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
25 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
26 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
27 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
28 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
29 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
31 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
33 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
40 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
42 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
44 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
45 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
46 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
47 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
48 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
52 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
55 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
56 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
57 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
61 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
62 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
63 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
64 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
65 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
66 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
67 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
68 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
69 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
70 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
71 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
72 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
73 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
74 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
75 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
76 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
77 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
78 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
79 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
80 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
81 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
82 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
83 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
84 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
85 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
86 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
100 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
101 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
107 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
108 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
109 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
110 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
111 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
112 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
113 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
114 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
115 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
116 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
117 2509276019 Ensifer aridi TW10 Isolate Nodule
118 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
119 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
120 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
121 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
122 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
123 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
124 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
125 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
126 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
127 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
128 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
129 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
130 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
131 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
132 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
133 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
134 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
135 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
136 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
137 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
138 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
139 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
140 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
141 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
142 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
143 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
144 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
145 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
146 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
147 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
148 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
149 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
150 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
151 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
152 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
153 2643221557 Ensifer sp. Root558 Isolate Unclassified
154 2643221607 Rhizobium sp. Root73 Isolate Unclassified
155 2643221610 Ensifer sp. Root74 Isolate Unclassified
156 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
157 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
158 2643221668 Ensifer sp. Root423 Isolate Unclassified
159 2643221675 Ensifer sp. Root1298 Isolate Unclassified
160 2643221680 Ensifer sp. Root1312 Isolate Unclassified
161 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
162 2643221688 Rhizobium sp. Root482 Isolate Unclassified
163 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
164 2643221718 Rhizobium sp. Root268 Isolate Unclassified
165 2643221723 Ensifer sp. Root278 Isolate Unclassified
166 2643221726 Ensifer sp. Root954 Isolate Unclassified
167 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
168 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
169 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
170 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
171 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
172 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
173 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
174 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
175 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
176 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
177 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
178 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
179 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
180 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
181 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
182 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
183 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
184 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
185 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
186 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
187 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
188 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
189 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
190 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
191 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
192 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
193 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
194 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
195 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
196 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
197 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
198 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
199 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
200 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
201 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
202 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
203 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
204 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
205 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
206 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
207 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
208 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
209 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
210 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
211 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
212 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
213 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
214 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
215 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
216 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
217 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
218 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
219 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
220 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
221 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
222 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
223 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
224 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
225 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
226 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
227 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
228 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
229 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
230 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
231 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
232 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
233 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
234 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
235 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
236 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
237 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
238 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
239 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
240 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
241 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
242 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
243 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
244 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
245 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
246 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
247 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
248 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
249 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
250 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
251 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
252 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
253 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
254 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
255 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
256 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
257 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
258 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
259 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
260 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
261 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
262 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
263 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
264 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
265 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
266 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
267 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
268 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
269 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
270 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
271 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
272 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
273 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
274 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
275 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
276 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
277 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
278 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
279 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
280 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
281 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
282 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
283 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
284 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
285 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
286 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
287 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
288 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
289 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
290 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
291 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
292 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
293 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
294 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
295 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
296 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
297 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
298 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
299 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
300 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
301 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
302 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
303 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
304 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
305 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
306 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
307 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
308 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
309 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
310 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
311 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
312 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
313 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
314 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
315 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
316 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
317 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
318 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
319 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
320 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
321 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
322 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
323 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
324 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
325 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
326 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
327 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
328 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
329 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
330 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
331 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
332 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
333 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
334 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
335 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
336 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
337 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
338 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
339 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
340 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
341 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
342 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
343 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
344 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
345 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
346 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
347 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
348 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
349 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
350 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
351 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
352 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
353 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
354 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
355 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
356 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
357 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
358 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
359 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
360 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
361 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
362 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
363 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
364 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
365 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
366 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
367 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
368 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
369 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
370 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
371 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
372 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
373 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
374 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
375 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
376 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 37.29
Metatranscriptomes 0
Isolates 62.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.5
Nodule 53.21
Rhizoplane 1.19
Rhizosphere 23.28
Stem 0
Stem Tuber 0.24
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0171463_1004 3300013249 Bacteria 437207
2 JGI25159J45721_1000170 3300002987 Bacteria 30378
3 JGI25151J46595_10010914 3300003187 Bacteria 4199
4 JGI25151J46595_10017275 3300003187 Bacteria 3133
5 JGI25160J50197_1000097 3300003354 Bacteria 87619
6 JGI25161J50226_1001144 3300003374 Bacteria 8848
7 Ga0055526_1003114 3300003771 Bacteria 10751
8 Ga0055526_1007558 3300003771 Bacteria 5616
9 Ga0055524_1007807 3300003775 Bacteria 4511
10 Ga0055524_1041078 3300003775 Bacteria 1170
11 Ga0055536_1001637 3300003781 Bacteria 13323
12 Ga0055531_10012663 3300003794 Bacteria 3950
13 Ga0055543_1000229 3300004625 Bacteria 44446
14 Ga0065165_1000133 3300005262 Bacteria 128540
15 Ga0070693_101353308 3300005547 Bacteria 552
16 Ga0070665_100071758 3300005548 Bacteria 3469
17 Ga0068854_100458493 3300005578 Bacteria 1066
18 Ga0070702_100349794 3300005615 Bacteria 1040
19 Ga0075365_10713695 3300006038 Bacteria 708
20 Ga0075365_11154921 3300006038 Bacteria 545
21 Ga0075430_101418281 3300006846 Bacteria 571
22 Ga0079104_1002285 3300006946 Bacteria 10611
23 Ga0079104_1002496 3300006946 Bacteria 9795
24 Ga0105242_11894999 3300009176 Bacteria 636
25 Ga0157373_10192779 3300013100 Bacteria 1436
26 Ga0183363_1164 3300015690 Bacteria 15347
27 Ga0214544_1028303 3300021320 Bacteria 2210
28 Ga0214542_1000008 3300021321 Bacteria 278895
29 Ga0214543_1000031 3300021327 Bacteria 206436
30 Ga0214543_1000053 3300021327 Bacteria 141797
31 Ga0228711_1000050 3300022739 Bacteria 81399
32 Ga0228710_1000063 3300022740 Bacteria 81399
33 Ga0209436_100733 3300025208 Bacteria 13681
34 Ga0209130_1000027 3300025284 Bacteria 327700
35 Ga0209676_1002257 3300025292 Bacteria 14191
36 Ga0209025_1000245 3300025294 Bacteria 127801
37 Ga0209025_1000706 3300025294 Bacteria 56897
38 Ga0209025_1061667 3300025294 Bacteria 1398
39 Ga0209564_1000111 3300025295 Bacteria 212210
40 Ga0209758_1038501 3300025297 Bacteria 1833
41 Ga0209758_1117890 3300025297 Bacteria 722
42 Ga0209050_1002214 3300025298 Bacteria 17440
43 Ga0209256_1000132 3300025299 Bacteria 160806
44 Ga0209256_1013037 3300025299 Bacteria 3116
45 Ga0207426_1000072 3300025302 Bacteria 327700
46 Ga0209051_1012699 3300025303 Bacteria 4057
47 Ga0209257_1002146 3300025304 Bacteria 20536
48 Ga0209257_1013949 3300025304 Bacteria 3508
49 Ga0207640_10383403 3300025981 Bacteria 1140
50 Ga0209281_1000030 3300027111 Bacteria 425931
51 Ga0209281_1000821 3300027111 Bacteria 28054
52 Ga0209371_1045495 3300027312 Bacteria 867
53 Ga0209282_1000004 3300027666 Bacteria 425931
54 Ga0268266_10095122 3300028379 Bacteria 2616
55 Ga0307515_10000377 3300028794 Bacteria 109082
56 Ga0307515_10002180 3300028794 Bacteria 42989
57 Ga0307515_10252899 3300028794 Bacteria 1511
58 Ga0268256_1051453 3300030500 Bacteria 866
59 Ga0307513_10002147 3300031456 Bacteria 27587
60 Ga0307408_100013601 3300031548 Bacteria 5403
61 Ga0307408_100692994 3300031548 Bacteria 915
62 Ga0307408_101212043 3300031548 Bacteria 704
63 Ga0307405_10816961 3300031731 Bacteria 782
64 Ga0307413_10503153 3300031824 Bacteria 973
65 Ga0307410_10115869 3300031852 Bacteria 1946
66 Ga0307406_11383873 3300031901 Bacteria 616
67 Ga0307406_11499077 3300031901 Bacteria 593
68 Ga0307412_10054803 3300031911 Bacteria 2649
69 Ga0307412_10411391 3300031911 Bacteria 1104
70 Ga0307412_10436854 3300031911 Bacteria 1075
71 Ga0307412_10885733 3300031911 Bacteria 781
72 Ga0307412_11196884 3300031911 Bacteria 680
73 Ga0315914_1000001 3300031967 Bacteria 416633
74 Ga0307409_100143549 3300031995 Bacteria 2061
75 Ga0307414_10038202 3300032004 Bacteria 3221
76 Ga0307414_10973299 3300032004 Bacteria 780
77 Ga0307411_10391068 3300032005 Bacteria 1147
78 Ga0307411_10778422 3300032005 Bacteria 841
79 Ga0307411_11011293 3300032005 Bacteria 745
80 Ga0315913_1000024 3300033430 Bacteria 90863
81 Ga0315915_1000002 3300033464 Bacteria 425854
82 Ga0395900_0350716 3300037418 Bacteria 1449
83 Ga0395905_0001848 3300037471 Bacteria 24427
84 Ga0395905_0017674 3300037471 Bacteria 6769
85 Ga0395905_0141307 3300037471 Bacteria 2264
86 Ga0439436_0051526 3300041404 Bacteria 1162
87 Ga0439436_0074545 3300041404 Bacteria 945
88 Ga0439436_0134117 3300041404 Bacteria 695
89 Ga0439436_0224443 3300041404 Bacteria 541
90 Ga0439439_0036563 3300041406 Bacteria 1264
91 Ga0439453_0021061 3300041408 Bacteria 1173
92 Ga0439465_0027825 3300041413 Bacteria 1791
93 Ga0439465_0131685 3300041413 Bacteria 883
94 Ga0451789_1184699 3300041443 Bacteria 1055
95 Ga0451847_0522125 3300041503 Bacteria 554
96 Ga0439433_0136457 3300041999 Bacteria 626
97 Ga0439449_0030838 3300042007 Bacteria 1998
98 Ga0439449_0117117 3300042007 Bacteria 988
99 Ga0439462_0006172 3300042015 Bacteria 2973
100 Ga0450920_002904 3300042122 Bacteria 2947
101 Ga0450906_004268 3300042145 Bacteria 3002
102 Ga0450910_010136 3300042147 Bacteria 1339
103 Ga0439446_0126272 3300042156 Bacteria 827
104 Ga0450909_032955 3300042185 Bacteria 788
105 Ga0439434_0019847 3300042435 Bacteria 2016
106 Ga0450918_005103 3300042531 Bacteria 2366
107 Ga0495625_0145968 3300046660 Bacteria 1593
108 Ga0496113_0433452 3300048916 Bacteria 1056
109 Ga0496116_0296638 3300048919 Bacteria 772
110 Ga0496117_0104419 3300048920 Bacteria 1783
111 Ga0496117_0334263 3300048920 Bacteria 788
112 Ga0496119_0043658 3300048922 Bacteria 2831
113 Ga0496120_0250150 3300048923 Bacteria 832
114 Ga0496122_0127145 3300048925 Bacteria 1628
115 Ga0496123_0000519 3300048926 Bacteria 66923
116 Ga0496124_0357498 3300048927 Bacteria 1030
117 Ga0496125_0135828 3300048928 Bacteria 1720
118 Ga0496126_0009052 3300048929 Bacteria 10644
119 Ga0496126_0017014 3300048929 Bacteria 7255
120 Ga0501031_0009457 3300049568 Bacteria 6337
121 Ga0501031_0257679 3300049568 Bacteria 1133
122 Ga0501032_0105332 3300049569 Bacteria 1868
123 Ga0501032_0954884 3300049569 Bacteria 539
124 Ga0501034_0055183 3300049571 Bacteria 3999
125 Ga0501036_0103634 3300049572 Bacteria 2406
126 Ga0501036_0571710 3300049572 Bacteria 938
127 Ga0501037_0085509 3300049573 Bacteria 2283
128 Ga0501038_0091080 3300049574 Bacteria 2555
129 Ga0501038_0154605 3300049574 Bacteria 1868
130 Ga0501038_0573124 3300049574 Bacteria 856
131 Ga0501039_1277349 3300049575 Bacteria 567
132 Ga0501040_0261188 3300049576 Bacteria 1236
133 Ga0501042_0083546 3300049578 Bacteria 2289
134 Ga0501043_0044868 3300049579 Bacteria 3476
135 Ga0501046_0022355 3300049580 Bacteria 5209
136 Ga0501048_0020879 3300049582 Bacteria 4797
137 Ga0501068_0190305 3300049584 Bacteria 1299
138 Ga0501069_0089817 3300049585 Bacteria 1737
139 Ga0501071_0385298 3300049587 Bacteria 1069
140 Ga0501073_0059170 3300049589 Bacteria 2677
141 Ga0501074_0212182 3300049590 Bacteria 1379
142 Ga0501035_0113667 3300049822 Bacteria 2371
143 Ga0501044_0020484 3300049823 Bacteria 7062
144 Ga0501044_0848900 3300049823 Bacteria 790
145 nmdc:mga0qj67_1337273_c1 3300050509 Bacteria 554
146 Ga0495655_0306567 3300053083 Bacteria 547
147 Ga0500562_041539 3300053108 Bacteria 1223
148 Ga0500559_0011307 3300053136 Bacteria 3814
149 Ga0500568_0000262 3300053139 Bacteria 44734
150 Ga0500568_0189381 3300053139 Bacteria 755
151 Ga0500604_0149609 3300053151 Bacteria 792
152 Ga0500616_0038597 3300053153 Bacteria 2579
153 Ga0500616_0382267 3300053153 Bacteria 566
154 Ga0500627_0192059 3300053158 Bacteria 917
155 Ga0500627_0327931 3300053158 Bacteria 664
156 Ga0590075_071645 3300059424 Bacteria 896
157 Ga0501082_1917726 3300060353 Bacteria 517
158 2509109438 2508501122 Bacteria 6292184
159 2509378252 2509276019 Bacteria 6802256
160 2510306931 2510065057 Bacteria 6649661
161 2511392116 2511231027 Bacteria 5013807
162 2511503169 2511231052 Bacteria 6974333
163 2512534447 2512047086 Bacteria 6850303
164 2512973748 2512875026 Bacteria 6861065
165 2513585221 2513237086 Bacteria 7265287
166 2513601735 2513237089 Bacteria 6553624
167 2513616920 2513237091 Bacteria 6900273
168 2513884134 2513237140 Bacteria 7076289
169 2513903463 2513237143 Bacteria 6664116
170 2513984008 2513237156 Bacteria 6402557
171 2513998601 2513237159 Bacteria 6810126
172 2514003682 2513237160 Bacteria 6650282
173 2515610911 2515154107 Bacteria 6795637
174 2516894602 2516653046 Bacteria 6989037
175 2517571250 2517487022 Bacteria 7227575
176 2524453302 2524023207 Bacteria 6813453
177 2551682803 2551306084 Bacteria 8942552
178 2551687415 2551306085 Bacteria 7347181
179 2551692740 2551306086 Bacteria 6843938
180 2551703555 2551306087 Bacteria 7351905
181 2551713182 2551306089 Bacteria 7162724
182 2551719944 2551306090 Bacteria 7953713
183 2551729458 2551306091 Bacteria 7086830
184 2551736422 2551306092 Bacteria 6992595
185 2551746582 2551306093 Bacteria 7064773
186 2558867264 2558860100 Bacteria 8458965
187 2585166841 2582581283 Bacteria 6030556
188 2585266808 2582581306 Bacteria 6450535
189 2585387850 2582581865 Bacteria 6644329
190 2585395950 2582581866 Bacteria 6859583
191 2600193514 2599185352 Bacteria 7228948
192 2643773735 2643221550 Bacteria 4619371
193 2643775559 2643221551 Bacteria 3750538
194 2643794005 2643221555 Bacteria 3749717
195 2643808205 2643221557 Bacteria 7184309
196 2644051923 2643221607 Bacteria 6314006
197 2644068606 2643221610 Bacteria 7480339
198 2644201521 2643221636 Bacteria 6583769
199 2644209366 2643221637 Bacteria 5345260
200 2644379639 2643221668 Bacteria 7306521
201 2644419675 2643221675 Bacteria 7473456
202 2644453032 2643221680 Bacteria 7473610
203 2644484375 2643221686 Bacteria 6310811
204 2644492391 2643221688 Bacteria 5260751
205 2644499896 2643221689 Bacteria 6042950
206 2644652894 2643221718 Bacteria 5345506
207 2644677231 2643221723 Bacteria 7095460
208 2644688939 2643221726 Bacteria 7455827
209 2657682553 2657244999 Bacteria 5946535
210 2715499373 2713897090 Bacteria 3353799
211 2765465978 2765235802 Bacteria 5618596
212 2770196614 2767802442 Bacteria 5747986
213 2776267863 2775506902 Bacteria 6208009
214 2776269276 2775506902 Bacteria 6208009
215 2776281834 2775506904 Bacteria 5954060
216 2776283585 2775506904 Bacteria 5954060
217 2792582092 2791355082 Bacteria 5973319
218 2792641372 2791355094 Bacteria 7011481
219 2802717384 2802428858 Bacteria 6636079
220 2802724628 2802428859 Bacteria 6667919
221 2802729379 2802428860 Bacteria 6525526
222 2802736725 2802428861 Bacteria 6534206
223 2802743130 2802428862 Bacteria 6633353
224 2802749744 2802428863 Bacteria 6410669
225 2804753556 2802429268 Bacteria 6094027
226 2838078316 2838074704 Bacteria 6785777
227 2839993611 2839993093 Bacteria 5512535
228 2840766632 2840764183 Bacteria 6358399
229 2842524368 2842521101 Bacteria 6569494
230 2842874909 2842871566 Bacteria 4827117
231 2850082498 2850079185 Bacteria 6848280
232 2855023527 2855020534 Bacteria 3204685
233 2855827225 2855825444 Bacteria 6785811
234 2855842610 2855839649 Bacteria 7135830
235 2858803421 2858800743 Bacteria 6603254
236 2891376152 2891373044 Bacteria 5202277
237 2896388019 2896384573 Bacteria 7700774
238 2899260465 2899259804 Bacteria 3320927
239 2904579691 2904578770 Bacteria 5302906
240 2913300031 2913295892 Bacteria 6333755
241 2915982600 2915980308 Bacteria 6624279
242 2915993206 2915986958 Bacteria 6739310
243 2915999600 2915993759 Bacteria 7016183
244 2916004029 2916000859 Bacteria 6865702
245 2916012326 2916007675 Bacteria 6898660
246 2916021110 2916014648 Bacteria 6946486
247 2916027841 2916021584 Bacteria 6854472
248 2916033578 2916028427 Bacteria 6748433
249 2916039569 2916035215 Bacteria 6755766
250 2916045520 2916041962 Bacteria 6820487
251 2916051189 2916048683 Bacteria 6543552
252 2916057500 2916055098 Bacteria 6758838
253 2916065113 2916061851 Bacteria 6737736
254 2916070106 2916068649 Bacteria 6943657
255 2916079687 2916076590 Bacteria 6596108
256 2919120642 2919119836 Bacteria 5208557
257 2919124365 2919119836 Bacteria 5208557
258 2920760498 2920760137 Bacteria 7427611
259 2920825795 2920822456 Bacteria 6897201
260 2921207308 2921201388 Bacteria 6926299
261 2921212453 2921208531 Bacteria 6745326
262 2921241098 2921237296 Bacteria 6876710
263 2921249921 2921244191 Bacteria 6568419
264 2921254639 2921250672 Bacteria 6677771
265 2921262086 2921257292 Bacteria 6808382
266 2921270634 2921263974 Bacteria 6864552
267 2921288934 2921282425 Bacteria 6826397
268 2921291286 2921289301 Bacteria 7316391
269 2921300681 2921296804 Bacteria 7176999
270 2924150686 2924144063 Bacteria 6883928
271 2924154152 2924150972 Bacteria 7169444
272 2924160225 2924158325 Bacteria 7188855
273 2924172448 2924165586 Bacteria 7260590
274 2924178369 2924172951 Bacteria 6749356
275 2924181632 2924179722 Bacteria 6843264
276 2924192899 2924186466 Bacteria 6876637
277 2924195280 2924193448 Bacteria 6955718
278 2924205936 2924200457 Bacteria 6757188
279 2924209397 2924207177 Bacteria 6917007
280 2924220261 2924214083 Bacteria 7080103
281 2924228641 2924221636 Bacteria 7113495
282 2924233138 2924228884 Bacteria 6633132
283 2928522490 2928521798 Bacteria 4960112
284 2936997611 2936996657 Bacteria 6298727
285 2937008884 2937002841 Bacteria 6934057
286 2937013428 2937009748 Bacteria 6746052
287 2937020294 2937016420 Bacteria 6782579
288 2937024725 2937023124 Bacteria 6815156
289 2937033345 2937029754 Bacteria 6424026
290 2937036042 2937036028 Bacteria 6846469
291 2937049320 2937042894 Bacteria 6741576
292 2937054348 2937049772 Bacteria 6757901
293 2937061482 2937056579 Bacteria 7107896
294 2937067885 2937063883 Bacteria 7199456
295 2937075638 2937071275 Bacteria 6984483
296 2937082397 2937078374 Bacteria 6610289
297 2937085839 2937084907 Bacteria 6618516
298 2937097810 2937091812 Bacteria 6979387
299 2937103261 2937098957 Bacteria 7249374
300 2937107741 2937106411 Bacteria 6947143
301 2937116451 2937113482 Bacteria 6505872
302 2937121784 2937119839 Bacteria 6597547
303 2937127879 2937126314 Bacteria 6771275
304 2954014115 2954011201 Bacteria 4762601
305 2957378848 2957375807 Bacteria 6425588
306 2957383811 2957382221 Bacteria 6737050
307 2957391521 2957388812 Bacteria 6778072
308 2957398214 2957395598 Bacteria 6822399
309 2957403986 2957402308 Bacteria 6741770
310 2957409895 2957408893 Bacteria 6558585
311 2957417962 2957415311 Bacteria 6991633
312 2957423255 2957422303 Bacteria 7172205
313 2957431573 2957430029 Bacteria 7022557
314 2957438701 2957437181 Bacteria 6568994
315 2957447521 2957443900 Bacteria 6869977
316 2957455424 2957450854 Bacteria 6765715
317 2957464140 2957457609 Bacteria 6967680
318 2957467542 2957464669 Bacteria 6568877
319 2957476606 2957471148 Bacteria 6797643
320 2957480093 2957478035 Bacteria 6756658
321 2957485631 2957484790 Bacteria 6703082
322 2957493688 2957491536 Bacteria 6695180
323 2957502121 2957498199 Bacteria 7126688
324 2957512581 2957505466 Bacteria 7253085
325 2960586824 2960584000 Bacteria 6864594
326 2960594926 2960591022 Bacteria 6622873
327 2960599347 2960597568 Bacteria 6550735
328 2960608043 2960603979 Bacteria 6898737
329 2960612128 2960610863 Bacteria 6691244
330 2960618218 2960617483 Bacteria 6727748
331 2960627427 2960624210 Bacteria 6875384
332 2960634712 2960631154 Bacteria 6732508
333 2960643319 2960637947 Bacteria 7296468
334 2960649583 2960645483 Bacteria 7211087
335 2960655443 2960652885 Bacteria 7083688
336 2960663545 2960660292 Bacteria 7041660
337 2960671856 2960667422 Bacteria 6763020
338 2960678950 2960674078 Bacteria 6609048
339 2960684328 2960680706 Bacteria 6624464
340 2960693724 2960687367 Bacteria 6535474
341 2960696638 2960693952 Bacteria 6749742
342 2964609680 2964607997 Bacteria 7101408
343 2964619439 2964615318 Bacteria 6809089
344 2964628397 2964621998 Bacteria 6834995
345 2964630501 2964628898 Bacteria 7083044
346 2964641144 2964636051 Bacteria 7091832
347 2964645295 2964643177 Bacteria 6820887
348 2964652736 2964649959 Bacteria 6675118
349 2964657234 2964656573 Bacteria 7100150
350 2964667915 2964663802 Bacteria 7019362
351 2964671047 2964670856 Bacteria 6851364
352 2964678304 2964678106 Bacteria 6792020
353 2964691318 2964685014 Bacteria 6839111
354 2964695340 2964691889 Bacteria 6802758
355 2964702542 2964698721 Bacteria 6765331
356 2964709306 2964705432 Bacteria 7114648
357 2964717911 2964712639 Bacteria 6695970
358 2964725517 2964719344 Bacteria 7286602
359 2967668920 2967664464 Bacteria 6948836
360 2967673584 2967671571 Bacteria 7021409
361 2967682755 2967678726 Bacteria 7264382
362 2967689120 2967686174 Bacteria 6678622
363 2967695530 2967693043 Bacteria 6804451
364 2967703075 2967699805 Bacteria 6854538
365 2967709987 2967706974 Bacteria 7186053
366 2967718245 2967714385 Bacteria 7000047
367 2967725367 2967721400 Bacteria 7073753
368 2967731981 2967728569 Bacteria 6641507
369 2967736756 2967735183 Bacteria 6827012
370 2967748933 2967742019 Bacteria 6794534
371 2967749928 2967748971 Bacteria 6733771
372 2967757940 2967755722 Bacteria 6814706
373 2967768160 2967762386 Bacteria 6923502
374 2967774716 2967769361 Bacteria 6587838
375 2967778489 2967775926 Bacteria 6738189
376 2970023448 2970019648 Bacteria 7072033
377 2970029977 2970026789 Bacteria 6785236
378 2970038297 2970033650 Bacteria 7118744
379 2970045920 2970040964 Bacteria 6731123
380 2970048562 2970047711 Bacteria 7088379
381 2970059875 2970054988 Bacteria 6611507
382 2970064897 2970061556 Bacteria 7099761
383 2970073100 2970068827 Bacteria 7123112
384 2970079739 2970076120 Bacteria 6697332
385 2970086425 2970082768 Bacteria 6183754
386 2970091269 2970088815 Bacteria 6933825
387 2970099463 2970095765 Bacteria 6936963
388 2970106832 2970102677 Bacteria 6812532
389 2970111485 2970109326 Bacteria 6863976
390 2970120941 2970116247 Bacteria 6501857
391 2970125907 2970122695 Bacteria 6625855
392 2970131939 2970129317 Bacteria 6806560
393 2970141629 2970136068 Bacteria 7207982
394 2970143772 2970143518 Bacteria 6446480
395 2970155014 2970149975 Bacteria 6779706
396 2970157095 2970156795 Bacteria 7168044
397 2970167949 2970164137 Bacteria 6861252
398 2970176799 2970170962 Bacteria 6876229
399 2970180177 2970177841 Bacteria 6768001
400 2970185737 2970184632 Bacteria 7054431
401 2970197795 2970191845 Bacteria 7032787
402 2977520285 2977516862 Bacteria 6940108
403 2977524556 2977523885 Bacteria 6960446
404 2977534625 2977530762 Bacteria 6951399
405 2977541479 2977537788 Bacteria 6929320
406 2977549120 2977544691 Bacteria 6875412
407 2977553352 2977551784 Bacteria 7125765
408 2977564903 2977558990 Bacteria 6863948
409 2977569253 2977565890 Bacteria 6901543
410 2977576496 2977572785 Bacteria 6763888
411 2977585436 2977579622 Bacteria 6772100
412 2989350742 2989349275 Bacteria 6349068
413 2989771454 2989771324 Bacteria 5605128
414 2996337779 2996336353 Bacteria 5511628
415 3003930770 3003930520 Bacteria 5667563
416 648737050 648276728 Bacteria 6968865
417 8003995192 8003992118 Bacteria 7266902
418 8004002909 8003999396 Bacteria 7063185
419 8049296120 8049293176 Bacteria 6128433
420 8054558833 8054558443 Bacteria 5204801
421 8056876435 8056875544 Bacteria 4355797
422 Ga0171463_1004
423 JGI25159J45721_1000170
424 JGI25151J46595_10010914
425 JGI25151J46595_10017275
426 JGI25160J50197_1000097
427 JGI25161J50226_1001144
428 Ga0055526_1003114
429 Ga0055526_1007558
430 Ga0055524_1007807
431 Ga0055524_1041078
432 Ga0055536_1001637
433 Ga0055531_10012663
434 Ga0055543_1000229
435 Ga0065165_1000133
436 Ga0070693_101353308
437 Ga0070665_100071758
438 Ga0068854_100458493
439 Ga0070702_100349794
440 Ga0075365_10713695
441 Ga0075365_11154921
442 Ga0075430_101418281
443 Ga0079104_1002285
444 Ga0079104_1002496
445 Ga0105242_11894999
446 Ga0157373_10192779
447 Ga0183363_1164
448 Ga0214544_1028303
449 Ga0214542_1000008
450 Ga0214543_1000031
451 Ga0214543_1000053
452 Ga0228711_1000050
453 Ga0228710_1000063
454 Ga0209436_100733
455 Ga0209130_1000027
456 Ga0209676_1002257
457 Ga0209025_1000245
458 Ga0209025_1000706
459 Ga0209025_1061667
460 Ga0209564_1000111
461 Ga0209758_1038501
462 Ga0209758_1117890
463 Ga0209050_1002214
464 Ga0209256_1000132
465 Ga0209256_1013037
466 Ga0207426_1000072
467 Ga0209051_1012699
468 Ga0209257_1002146
469 Ga0209257_1013949
470 Ga0207640_10383403
471 Ga0209281_1000030
472 Ga0209281_1000821
473 Ga0209371_1045495
474 Ga0209282_1000004
475 Ga0268266_10095122
476 Ga0307515_10000377
477 Ga0307515_10002180
478 Ga0307515_10252899
479 Ga0268256_1051453
480 Ga0307513_10002147
481 Ga0307408_100013601
482 Ga0307408_100692994
483 Ga0307408_101212043
484 Ga0307405_10816961
485 Ga0307413_10503153
486 Ga0307410_10115869
487 Ga0307406_11383873
488 Ga0307406_11499077
489 Ga0307412_10054803
490 Ga0307412_10411391
491 Ga0307412_10436854
492 Ga0307412_10885733
493 Ga0307412_11196884
494 Ga0315914_1000001
495 Ga0307409_100143549
496 Ga0307414_10038202
497 Ga0307414_10973299
498 Ga0307411_10391068
499 Ga0307411_10778422
500 Ga0307411_11011293
501 Ga0315913_1000024
502 Ga0315915_1000002
503 Ga0395900_0350716
504 Ga0395905_0001848
505 Ga0395905_0017674
506 Ga0395905_0141307
507 Ga0439436_0051526
508 Ga0439436_0074545
509 Ga0439436_0134117
510 Ga0439436_0224443
511 Ga0439439_0036563
512 Ga0439453_0021061
513 Ga0439465_0027825
514 Ga0439465_0131685
515 Ga0451789_1184699
516 Ga0451847_0522125
517 Ga0439433_0136457
518 Ga0439449_0030838
519 Ga0439449_0117117
520 Ga0439462_0006172
521 Ga0450920_002904
522 Ga0450906_004268
523 Ga0450910_010136
524 Ga0439446_0126272
525 Ga0450909_032955
526 Ga0439434_0019847
527 Ga0450918_005103
528 Ga0495625_0145968
529 Ga0496113_0433452
530 Ga0496116_0296638
531 Ga0496117_0104419
532 Ga0496117_0334263
533 Ga0496119_0043658
534 Ga0496120_0250150
535 Ga0496122_0127145
536 Ga0496123_0000519
537 Ga0496124_0357498
538 Ga0496125_0135828
539 Ga0496126_0009052
540 Ga0496126_0017014
541 Ga0501031_0009457
542 Ga0501031_0257679
543 Ga0501032_0105332
544 Ga0501032_0954884
545 Ga0501034_0055183
546 Ga0501036_0103634
547 Ga0501036_0571710
548 Ga0501037_0085509
549 Ga0501038_0091080
550 Ga0501038_0154605
551 Ga0501038_0573124
552 Ga0501039_1277349
553 Ga0501040_0261188
554 Ga0501042_0083546
555 Ga0501043_0044868
556 Ga0501046_0022355
557 Ga0501048_0020879
558 Ga0501068_0190305
559 Ga0501069_0089817
560 Ga0501071_0385298
561 Ga0501073_0059170
562 Ga0501074_0212182
563 Ga0501035_0113667
564 Ga0501044_0020484
565 Ga0501044_0848900
566 nmdc:mga0qj67_1337273_c1
567 Ga0495655_0306567
568 Ga0500562_041539
569 Ga0500559_0011307
570 Ga0500568_0000262
571 Ga0500568_0189381
572 Ga0500604_0149609
573 Ga0500616_0038597
574 Ga0500616_0382267
575 Ga0500627_0192059
576 Ga0500627_0327931
577 Ga0590075_071645
578 Ga0501082_1917726
579 2509109438
580 2509378252
581 2510306931
582 2511392116
583 2511503169
584 2512534447
585 2512973748
586 2513585221
587 2513601735
588 2513616920
589 2513884134
590 2513903463
591 2513984008
592 2513998601
593 2514003682
594 2515610911
595 2516894602
596 2517571250
597 2524453302
598 2551682803
599 2551687415
600 2551692740
601 2551703555
602 2551713182
603 2551719944
604 2551729458
605 2551736422
606 2551746582
607 2558867264
608 2585166841
609 2585266808
610 2585387850
611 2585395950
612 2600193514
613 2643773735
614 2643775559
615 2643794005
616 2643808205
617 2644051923
618 2644068606
619 2644201521
620 2644209366
621 2644379639
622 2644419675
623 2644453032
624 2644484375
625 2644492391
626 2644499896
627 2644652894
628 2644677231
629 2644688939
630 2657682553
631 2715499373
632 2765465978
633 2770196614
634 2776267863
635 2776269276
636 2776281834
637 2776283585
638 2792582092
639 2792641372
640 2802717384
641 2802724628
642 2802729379
643 2802736725
644 2802743130
645 2802749744
646 2804753556
647 2838078316
648 2839993611
649 2840766632
650 2842524368
651 2842874909
652 2850082498
653 2855023527
654 2855827225
655 2855842610
656 2858803421
657 2891376152
658 2896388019
659 2899260465
660 2904579691
661 2913300031
662 2915982600
663 2915993206
664 2915999600
665 2916004029
666 2916012326
667 2916021110
668 2916027841
669 2916033578
670 2916039569
671 2916045520
672 2916051189
673 2916057500
674 2916065113
675 2916070106
676 2916079687
677 2919120642
678 2919124365
679 2920760498
680 2920825795
681 2921207308
682 2921212453
683 2921241098
684 2921249921
685 2921254639
686 2921262086
687 2921270634
688 2921288934
689 2921291286
690 2921300681
691 2924150686
692 2924154152
693 2924160225
694 2924172448
695 2924178369
696 2924181632
697 2924192899
698 2924195280
699 2924205936
700 2924209397
701 2924220261
702 2924228641
703 2924233138
704 2928522490
705 2936997611
706 2937008884
707 2937013428
708 2937020294
709 2937024725
710 2937033345
711 2937036042
712 2937049320
713 2937054348
714 2937061482
715 2937067885
716 2937075638
717 2937082397
718 2937085839
719 2937097810
720 2937103261
721 2937107741
722 2937116451
723 2937121784
724 2937127879
725 2954014115
726 2957378848
727 2957383811
728 2957391521
729 2957398214
730 2957403986
731 2957409895
732 2957417962
733 2957423255
734 2957431573
735 2957438701
736 2957447521
737 2957455424
738 2957464140
739 2957467542
740 2957476606
741 2957480093
742 2957485631
743 2957493688
744 2957502121
745 2957512581
746 2960586824
747 2960594926
748 2960599347
749 2960608043
750 2960612128
751 2960618218
752 2960627427
753 2960634712
754 2960643319
755 2960649583
756 2960655443
757 2960663545
758 2960671856
759 2960678950
760 2960684328
761 2960693724
762 2960696638
763 2964609680
764 2964619439
765 2964628397
766 2964630501
767 2964641144
768 2964645295
769 2964652736
770 2964657234
771 2964667915
772 2964671047
773 2964678304
774 2964691318
775 2964695340
776 2964702542
777 2964709306
778 2964717911
779 2964725517
780 2967668920
781 2967673584
782 2967682755
783 2967689120
784 2967695530
785 2967703075
786 2967709987
787 2967718245
788 2967725367
789 2967731981
790 2967736756
791 2967748933
792 2967749928
793 2967757940
794 2967768160
795 2967774716
796 2967778489
797 2970023448
798 2970029977
799 2970038297
800 2970045920
801 2970048562
802 2970059875
803 2970064897
804 2970073100
805 2970079739
806 2970086425
807 2970091269
808 2970099463
809 2970106832
810 2970111485
811 2970120941
812 2970125907
813 2970131939
814 2970141629
815 2970143772
816 2970155014
817 2970157095
818 2970167949
819 2970176799
820 2970180177
821 2970185737
822 2970197795
823 2977520285
824 2977524556
825 2977534625
826 2977541479
827 2977549120
828 2977553352
829 2977564903
830 2977569253
831 2977576496
832 2977585436
833 2989350742
834 2989771454
835 2996337779
836 3003930770
837 648737050
838 8003995192
839 8004002909
840 8049296120
841 8054558833
842 8056876435

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09928

DUF2160

Predicted small integral membrane protein (DUF2160)

52

141

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v49-assembly1.cif.gz_AO crystal structure of a streptomycin dependent ribosome from e. coli 70s ribosome. 0.5361 27 129
4v4a-assembly1.cif.gz_AO crystal structure of the wild type ribosome from e. coli 70s ribosome. 0.5361 27 129
4yy3-assembly1.cif.gz_O 30s ribosomal subunit- higb complex 0.5361 27 129
6spc-assembly1.cif.gz_o pseudomonas aeruginosa 30s ribosome from an aminoglycoside resistant clinical isolate 0.5326 24 127
4v5a-assembly1.cif.gz_AO structure of the ribosome recycling factor bound to the thermus thermophilus 70s ribosome with mrna, asl-phe and trna-fmet 0.5303 24 129
ID Description Score Start End Superfamily
af_Q9NAP9_125_216_1.10.287.10 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.5558 21 131 1.10.287.10
af_Q9WUP4_168_330_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5553 2 113 1.20.120.550
af_Q9NAP9_125_216_1.10.287.10 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.5422 21 131 1.10.287.10
4ej9O00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.5378 23 129 1.10.287.10
2v46O00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.5303 24 129 1.10.287.10
ID Description Score Start End GO Terms
AF-A0A7V8QG27-F1-model_v4 DUF2160 domain-containing protein 0.6492 7 140 GO:0016020
AF-A0A7V8QG27-F1-model_v4 DUF2160 domain-containing protein 0.6374 7 140 GO:0016020
AF-A0A2D8X1Q5-F1-model_v4 Glycerol-3-phosphate ABC transporter 0.6273 9 140 GO:0016020
AF-A0A017HKU7-F1-model_v4 Putative transmembrane protein 0.6165 2 140 GO:0016020
AF-A0A2D8X1Q5-F1-model_v4 Glycerol-3-phosphate ABC transporter 0.6146 9 140 GO:0016020

Map