metagRoot

F439917

General Info

Members	Datasets	Scaffolds	Average Seq Length
421	245	421	223

Family's Representative Sequence

Representative Sequence	3300005347\|Ga0070668_100013247\|Ga0070668_1000132476
Length	231
Sequence	VNVGVAGSRAVPGGKLKLAVPRGALFGETLDVLDAAGVDTAELRGNSRSLIFETDELTLVTMRPSDVPTYVESGAAEVGITGKDVLLEQGDRAVYELLDLGFGRCRMVLAGRRGDTRLGESQRRLGMMRIATKYPRIAADYFEGTGRQVDLIEVKGSVELAPLIGLGDGIVDLVATGRTLADNDLEVREEIVVCTARFVANRVAHKLRAAEVDDLTARLREASRTLGAAAS

Samples

	Sample ID	Description	Type	Environment
1	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
2	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
3	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
4	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
5	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
6	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
7	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
8	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
9	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
10	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
11	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
12	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
13	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
14	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
15	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
16	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
17	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
18	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
19	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
20	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
21	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
22	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
23	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
24	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
25	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
26	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
27	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
28	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
29	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
30	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
31	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
32	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
33	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
34	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
35	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
36	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
37	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
38	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
39	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
40	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
41	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
42	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
43	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
44	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
45	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
46	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
47	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
48	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
49	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
50	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
51	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
52	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
53	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
54	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
55	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
56	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
57	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
58	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
59	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
60	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
61	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
62	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
63	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
64	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
65	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
66	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
67	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
68	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
69	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
70	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
71	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
72	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
73	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
74	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
75	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
76	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
104	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
108	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
109	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
110	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
111	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
112	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
113	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
114	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
115	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
116	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
117	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
118	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
119	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
120	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
121	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
122	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
123	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
124	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
125	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
126	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
127	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
128	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
129	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
130	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
131	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
132	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
133	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
134	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
135	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
136	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
137	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
138	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
139	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
140	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
141	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
142	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
143	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
144	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
145	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
146	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
147	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
148	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
149	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
150	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
151	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
152	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
153	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
154	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
155	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
156	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
157	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
158	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
159	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
160	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
161	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
162	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
163	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
164	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
165	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
166	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
167	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
168	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
169	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
170	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
171	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
172	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
173	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
174	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
175	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
176	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
177	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
178	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
179	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
180	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
181	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
182	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
183	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
184	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
185	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
186	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
187	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
188	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
189	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
190	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
191	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
192	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
193	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
194	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
195	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
196	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
197	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
198	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
199	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
200	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
201	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
202	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
203	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
204	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
205	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
206	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
207	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
208	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
209	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
210	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
211	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
212	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
213	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
214	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
215	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
216	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
217	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
218	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
219	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
220	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
221	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
222	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
223	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
224	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
225	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
226	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
227	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
228	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
229	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
230	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
231	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
232	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
233	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
234	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
235	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
236	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
237	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
238	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
239	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
240	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
241	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
242	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
243	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
244	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
245	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.76
Metatranscriptomes	0.24
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.04
Nodule	0
Rhizoplane	9.98
Rhizosphere	80.76
Stem	0
Stem Tuber	0
Unclassified	5.23

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1000412	3300001977	Bacteria	6346
2	JGI24742J22300_10016245	3300002244	Bacteria	1255
3	Ga0070683_100001863	3300005329	Bacteria	16460
4	Ga0070683_100065402	3300005329	Bacteria	3385
5	Ga0070666_10019920	3300005335	Bacteria	4334
6	Ga0070666_10162018	3300005335	Bacteria	1564
7	Ga0070682_100000398	3300005337	Bacteria	29064
8	Ga0070682_100000578	3300005337	Bacteria	22504
9	Ga0068868_100002153	3300005338	Bacteria	13606
10	Ga0070660_100234957	3300005339	Bacteria	1492
11	Ga0070691_10000021	3300005341	Bacteria	45268
12	Ga0070661_100000616	3300005344	Bacteria	26479
13	Ga0070692_10022865	3300005345	Bacteria	3059
14	Ga0070692_10243805	3300005345	Bacteria	1072
15	Ga0070668_100013247	3300005347	Bacteria	6151
16	Ga0070674_100000235	3300005356	Bacteria	27333
17	Ga0070674_100083094	3300005356	Bacteria	2292
18	Ga0070688_100004986	3300005365	Bacteria	6947
19	Ga0070659_100010883	3300005366	Bacteria	6709
20	Ga0070667_100001908	3300005367	Bacteria	18496
21	Ga0070667_100042334	3300005367	Bacteria	3822
22	Ga0070667_100458124	3300005367	Bacteria	1166
23	Ga0070667_100482583	3300005367	Bacteria	1135
24	Ga0070713_100000010	3300005436	Bacteria	151790
25	Ga0070713_100071429	3300005436	Bacteria	2933
26	Ga0070663_100009051	3300005455	Bacteria	6152
27	Ga0070678_100252583	3300005456	Bacteria	1479
28	Ga0070681_10036375	3300005458	Bacteria	4944
29	Ga0070685_10000665	3300005466	Bacteria	18706
30	Ga0070685_10127780	3300005466	Bacteria	1586
31	Ga0070679_100016435	3300005530	Bacteria	7137
32	Ga0070684_100004796	3300005535	Bacteria	10332
33	Ga0070684_100032534	3300005535	Bacteria	4445
34	Ga0068853_100254035	3300005539	Bacteria	1614
35	Ga0070695_100096572	3300005545	Bacteria	1983
36	Ga0070693_100002911	3300005547	Bacteria	7898
37	Ga0070665_100000135	3300005548	Bacteria	138925
38	Ga0070665_100129478	3300005548	Bacteria	2526
39	Ga0070664_100066983	3300005564	Bacteria	3068
40	Ga0070664_100348224	3300005564	Bacteria	1347
41	Ga0070664_100421932	3300005564	Bacteria	1222
42	Ga0068857_100266659	3300005577	Bacteria	1573
43	Ga0068854_100000116	3300005578	Bacteria	54986
44	Ga0068854_100196766	3300005578	Bacteria	1582
45	Ga0068856_100000336	3300005614	Bacteria	51580
46	Ga0068856_100032534	3300005614	Bacteria	5106
47	Ga0068856_100633444	3300005614	Bacteria	1090
48	Ga0068852_100000056	3300005616	Bacteria	76111
49	Ga0068864_100000704	3300005618	Bacteria	28101
50	Ga0068866_10000008	3300005718	Bacteria	117658
51	Ga0068866_10001267	3300005718	Bacteria	10953
52	Ga0068866_10043414	3300005718	Bacteria	2244
53	Ga0068863_100003052	3300005841	Bacteria	16547
54	Ga0068863_100203289	3300005841	Bacteria	1906
55	Ga0068858_100753870	3300005842	Bacteria	949
56	Ga0068860_100008818	3300005843	Bacteria	10047
57	Ga0068860_100090882	3300005843	Bacteria	2908
58	Ga0068860_100314499	3300005843	Bacteria	1536
59	Ga0081455_10007705	3300005937	Bacteria	11300
60	Ga0081455_10105222	3300005937	Bacteria	2255
61	Ga0081538_10000190	3300005981	Bacteria	67602
62	Ga0081538_10028617	3300005981	Bacteria	3827
63	Ga0081540_1090872	3300005983	Bacteria	1343
64	Ga0081539_10003008	3300005985	Bacteria	21987
65	Ga0081539_10012474	3300005985	Bacteria	6548
66	Ga0075365_10001750	3300006038	Bacteria	10099
67	Ga0075365_10004143	3300006038	Bacteria	7626
68	Ga0075365_10176231	3300006038	Bacteria	1494
69	Ga0075364_10028446	3300006051	Bacteria	3579
70	Ga0075364_10449118	3300006051	Bacteria	881
71	Ga0075432_10017927	3300006058	Bacteria	2414
72	Ga0070715_10000021	3300006163	Bacteria	119283
73	Ga0075431_100008031	3300006847	Bacteria	10528
74	Ga0075433_10102133	3300006852	Bacteria	2539
75	Ga0075429_100748388	3300006880	Bacteria	856
76	Ga0068865_100000856	3300006881	Bacteria	17257
77	Ga0105245_10000141	3300009098	Bacteria	68413
78	Ga0105245_10002008	3300009098	Bacteria	18469
79	Ga0105245_10002406	3300009098	Bacteria	16922
80	Ga0105247_10000278	3300009101	Bacteria	47180
81	Ga0105247_10127498	3300009101	Bacteria	1655
82	Ga0114129_10046061	3300009147	Bacteria	6130
83	Ga0105243_10011687	3300009148	Bacteria	6640
84	Ga0105241_10526399	3300009174	Bacteria	1058
85	Ga0105242_10000533	3300009176	Bacteria	30003
86	Ga0105242_10443088	3300009176	Bacteria	1222
87	Ga0105242_11086934	3300009176	Bacteria	813
88	Ga0105248_10000020	3300009177	Bacteria	284637
89	Ga0105237_10260982	3300009545	Bacteria	1735
90	Ga0105238_10767261	3300009551	Bacteria	979
91	Ga0105249_10000332	3300009553	Bacteria	47770
92	Ga0105249_10012314	3300009553	Bacteria	7537
93	Ga0105249_10875569	3300009553	Bacteria	964
94	Ga0105239_10026587	3300010375	Bacteria	6369
95	Ga0105239_10104009	3300010375	Bacteria	3144
96	Ga0105239_10505927	3300010375	Bacteria	1373
97	Ga0105239_10565821	3300010375	Bacteria	1295
98	Ga0157371_10011110	3300013102	Bacteria	6970
99	Ga0157370_10013982	3300013104	Bacteria	8242
100	Ga0157370_10041744	3300013104	Bacteria	4423
101	Ga0157369_10004884	3300013105	Bacteria	15723
102	Ga0157369_10312488	3300013105	Bacteria	1634
103	Ga0157374_11003345	3300013296	Bacteria	854
104	Ga0157372_10006142	3300013307	Bacteria	12762
105	Ga0157375_10843030	3300013308	Bacteria	1063
106	Ga0163163_10869214	3300014325	Bacteria	965
107	Ga0157379_10003315	3300014968	Bacteria	13639
108	Ga0157376_10013350	3300014969	Bacteria	6127
109	Ga0157376_10049226	3300014969	Bacteria	3489
110	Ga0206353_10578555	3300020082	Bacteria	1442
111	Ga0207682_10000022	3300025893	Bacteria	62630
112	Ga0207642_10000002	3300025899	Bacteria	658166
113	Ga0207642_10001753	3300025899	Bacteria	6702
114	Ga0207642_10011322	3300025899	Bacteria	3177
115	Ga0207710_10000695	3300025900	Bacteria	18840
116	Ga0207680_10093661	3300025903	Bacteria	1917
117	Ga0207685_10000028	3300025905	Bacteria	97935
118	Ga0207707_10241058	3300025912	Bacteria	1572
119	Ga0207649_10000189	3300025920	Bacteria	50504
120	Ga0207652_10001961	3300025921	Bacteria	17798
121	Ga0207652_10008802	3300025921	Bacteria	8129
122	Ga0207687_10000032	3300025927	Bacteria	143196
123	Ga0207687_10000036	3300025927	Bacteria	121934
124	Ga0207687_10000073	3300025927	Bacteria	73917
125	Ga0207687_10002476	3300025927	Bacteria	12542
126	Ga0207700_10000007	3300025928	Bacteria	345720
127	Ga0207690_10004319	3300025932	Bacteria	8392
128	Ga0207686_10000073	3300025934	Bacteria	92009
129	Ga0207686_10054824	3300025934	Bacteria	2499
130	Ga0207709_10013192	3300025935	Bacteria	4558
131	Ga0207669_10000006	3300025937	Bacteria	176348
132	Ga0207669_10000182	3300025937	Bacteria	29102
133	Ga0207669_10045521	3300025937	Bacteria	2586
134	Ga0207704_10000049	3300025938	Bacteria	83173
135	Ga0207711_10000006	3300025941	Bacteria	792692
136	Ga0207689_10206528	3300025942	Bacteria	1622
137	Ga0207661_10000278	3300025944	Bacteria	32703
138	Ga0207661_10002137	3300025944	Bacteria	13604
139	Ga0207679_10047207	3300025945	Bacteria	3127
140	Ga0207679_10601443	3300025945	Bacteria	991
141	Ga0207712_10000058	3300025961	Bacteria	140948
142	Ga0207712_10004957	3300025961	Bacteria	8418
143	Ga0207668_10019658	3300025972	Bacteria	4274
144	Ga0207640_10000134	3300025981	Bacteria	54961
145	Ga0207640_10239603	3300025981	Bacteria	1401
146	Ga0207658_10003595	3300025986	Bacteria	10959
147	Ga0207658_10029416	3300025986	Bacteria	3880
148	Ga0207658_10327321	3300025986	Bacteria	1328
149	Ga0207677_10000374	3300026023	Bacteria	31092
150	Ga0207677_10058516	3300026023	Bacteria	2654
151	Ga0207703_10261386	3300026035	Bacteria	1565
152	Ga0207639_10112946	3300026041	Bacteria	2218
153	Ga0207678_10009806	3300026067	Bacteria	8420
154	Ga0207702_10000368	3300026078	Bacteria	51559
155	Ga0207702_10008029	3300026078	Bacteria	8930
156	Ga0207641_10002193	3300026088	Bacteria	18362
157	Ga0207676_10000632	3300026095	Bacteria	28468
158	Ga0207674_10480270	3300026116	Bacteria	1201
159	Ga0207683_10287266	3300026121	Bacteria	1504
160	Ga0207698_10000101	3300026142	Bacteria	54530
161	Ga0207428_10013763	3300027907	Bacteria	7052
162	Ga0268266_10000056	3300028379	Bacteria	289176
163	Ga0268266_10010879	3300028379	Bacteria	7925
164	Ga0268266_10221755	3300028379	Bacteria	1738
165	Ga0268265_10002439	3300028380	Bacteria	14024
166	Ga0268264_10010770	3300028381	Bacteria	7555
167	Ga0268264_10269936	3300028381	Bacteria	1589
168	Ga0265337_1004058	3300028556	Bacteria	6174
169	Ga0265326_10000514	3300028558	Bacteria	14873
170	Ga0265319_1000105	3300028563	Bacteria	65502
171	Ga0265322_10000029	3300028654	Bacteria	82867
172	Ga0265336_10004915	3300028666	Bacteria	5001
173	Ga0265338_10000507	3300028800	Bacteria	69026
174	Ga0265324_10006934	3300029957	Bacteria	4663
175	Ga0265332_10016434	3300031238	Bacteria	3266
176	Ga0265328_10001443	3300031239	Bacteria	10944
177	Ga0265320_10000011	3300031240	Bacteria	249534
178	Ga0265339_10007254	3300031249	Bacteria	7183
179	Ga0265331_10000839	3300031250	Bacteria	25044
180	Ga0265331_10036845	3300031250	Bacteria	2399
181	Ga0265327_10000015	3300031251	Bacteria	496677
182	Ga0265316_10075180	3300031344	Bacteria	2598
183	Ga0265313_10030293	3300031595	Bacteria	2788
184	Ga0265313_10071401	3300031595	Bacteria	1598
185	Ga0265314_10000361	3300031711	Bacteria	63269
186	Ga0373936_0358043	3300035113	Bacteria	665
187	Ga0373933_0291729	3300035724	Bacteria	1055
188	Ga0373937_0016879	3300036401	Bacteria	6491
189	Ga0373937_0152326	3300036401	Bacteria	2166
190	Ga0373937_0513788	3300036401	Bacteria	1138
191	Ga0395899_0446475	3300037312	Bacteria	848
192	Ga0395901_0396653	3300038443	Bacteria	1418
193	Ga0451800_0574206	3300041459	Bacteria	1230
194	Ga0451833_0886278	3300041491	Bacteria	1338
195	Ga0451839_0658184	3300041496	Bacteria	1419
196	Ga0466963_0068480	3300044694	Bacteria	2384
197	Ga0466957_0016061	3300044842	Bacteria	4376
198	Ga0466958_0091079	3300045836	Bacteria	1887
199	Ga0466967_0000001	3300045976	Bacteria	229823
200	Ga0466967_0132235	3300045976	Bacteria	2317
201	Ga0466967_0271844	3300045976	Bacteria	1624
202	Ga0495592_0161175	3300046454	Bacteria	1543
203	Ga0495603_0003584	3300046455	Bacteria	9243
204	Ga0495603_0007986	3300046455	Bacteria	6388
205	Ga0495629_0004526	3300046459	Bacteria	10402
206	Ga0495629_0007301	3300046459	Bacteria	8140
207	Ga0495629_0197217	3300046459	Bacteria	1392
208	Ga0495641_0000027	3300046461	Bacteria	100420
209	Ga0495641_0021694	3300046461	Bacteria	3226
210	Ga0495651_0045199	3300046462	Bacteria	3412
211	Ga0495662_0000304	3300046476	Bacteria	21364
212	Ga0495664_0280941	3300046477	Bacteria	1006
213	Ga0495594_0000011	3300046499	Bacteria	118444
214	Ga0495608_0000007	3300046511	Bacteria	313495
215	Ga0495608_0024956	3300046511	Bacteria	4084
216	Ga0495608_0265080	3300046511	Bacteria	1069
217	Ga0495608_0287823	3300046511	Bacteria	1019
218	Ga0495618_0273424	3300046514	Bacteria	1055
219	Ga0495628_0001027	3300046516	Bacteria	25537
220	Ga0495628_0326755	3300046516	Bacteria	1131
221	Ga0495630_0000454	3300046517	Bacteria	31035
222	Ga0495630_0004844	3300046517	Bacteria	9443
223	Ga0495630_0057962	3300046517	Bacteria	2903
224	Ga0495630_0101959	3300046517	Bacteria	2171
225	Ga0495632_0053203	3300046519	Bacteria	1989
226	Ga0495652_0000037	3300046529	Bacteria	133232
227	Ga0495652_0014694	3300046529	Bacteria	7021
228	Ga0495640_0019139	3300046533	Bacteria	5059
229	Ga0495640_0397909	3300046533	Bacteria	846
230	Ga0495587_0017335	3300046536	Bacteria	4474
231	Ga0495587_0222018	3300046536	Bacteria	1066
232	Ga0495621_0000973	3300046539	Bacteria	7304
233	Ga0495645_0004950	3300046543	Bacteria	9117
234	Ga0495645_0019494	3300046543	Bacteria	4882
235	Ga0495645_0520829	3300046543	Bacteria	741
236	Ga0495622_0000021	3300046557	Bacteria	162267
237	Ga0495667_0369136	3300046559	Bacteria	906
238	Ga0495634_0006592	3300046642	Bacteria	8806
239	Ga0495625_0001050	3300046660	Bacteria	36223
240	Ga0495657_0000001	3300046675	Bacteria	445641
241	Ga0495599_0013017	3300046678	Bacteria	5134
242	Ga0495669_0000143	3300046684	Bacteria	45428
243	Ga0495613_0000247	3300046689	Bacteria	51008
244	Ga0495613_0354922	3300046689	Bacteria	1006
245	Ga0495649_0000585	3300046694	Bacteria	30585
246	Ga0495600_0003120	3300046809	Bacteria	9706
247	Ga0495600_0238211	3300046809	Bacteria	1160
248	Ga0495604_0000050	3300047317	Bacteria	108094
249	Ga0495604_0000195	3300047317	Bacteria	54789
250	Ga0495604_0101940	3300047317	Bacteria	2107
251	Ga0495604_0198443	3300047317	Bacteria	1394
252	Ga0495674_0000059	3300047319	Bacteria	73353
253	Ga0495672_0189863	3300047320	Bacteria	1034
254	Ga0495676_0004577	3300047321	Bacteria	12659
255	Ga0495676_0025514	3300047321	Bacteria	5102
256	Ga0495680_0025775	3300047322	Bacteria	4862
257	Ga0495680_0155223	3300047322	Bacteria	1666
258	Ga0495680_0190192	3300047322	Bacteria	1477
259	Ga0495675_0003149	3300047444	Bacteria	9899
260	Ga0495679_028114	3300047446	Bacteria	1847
261	Ga0495593_0221111	3300047673	Bacteria	950
262	Ga0495602_0000007	3300048088	Bacteria	273212
263	Ga0495602_0005656	3300048088	Bacteria	13105
264	Ga0496100_0000001	3300048903	Bacteria	530179
265	Ga0496100_0000013	3300048903	Bacteria	177476
266	Ga0496101_0000004	3300048904	Bacteria	331599
267	Ga0496101_0000035	3300048904	Bacteria	177237
268	Ga0496102_0000522	3300048905	Bacteria	41862
269	Ga0496102_0081859	3300048905	Bacteria	2977
270	Ga0496102_0113399	3300048905	Bacteria	2529
271	Ga0496102_0700405	3300048905	Bacteria	936
272	Ga0496103_0000174	3300048906	Bacteria	67124
273	Ga0496103_0007177	3300048906	Bacteria	6644
274	Ga0496104_0001566	3300048907	Bacteria	19685
275	Ga0496104_0015713	3300048907	Bacteria	6866
276	Ga0496105_0000030	3300048908	Bacteria	137325
277	Ga0496105_0001501	3300048908	Bacteria	16486
278	Ga0496105_0284461	3300048908	Bacteria	1332
279	Ga0496106_0000062	3300048909	Bacteria	85769
280	Ga0496106_0000414	3300048909	Bacteria	30298
281	Ga0496106_0280828	3300048909	Bacteria	1334
282	Ga0496107_0000005	3300048910	Bacteria	281747
283	Ga0496107_0000020	3300048910	Bacteria	148990
284	Ga0496108_0000006	3300048911	Bacteria	469473
285	Ga0496108_0000137	3300048911	Bacteria	70783
286	Ga0496108_0589593	3300048911	Bacteria	969
287	Ga0496109_0000009	3300048912	Bacteria	236561
288	Ga0496109_0000088	3300048912	Bacteria	94877
289	Ga0496110_0000242	3300048913	Bacteria	35454
290	Ga0496110_0029251	3300048913	Bacteria	4740
291	Ga0496110_0076759	3300048913	Bacteria	2971
292	Ga0496111_0004875	3300048914	Bacteria	8519
293	Ga0496111_0012923	3300048914	Bacteria	5666
294	Ga0496112_0000025	3300048915	Bacteria	146197
295	Ga0496112_0007945	3300048915	Bacteria	9459
296	Ga0496112_0731786	3300048915	Bacteria	916
297	Ga0496113_0000027	3300048916	Bacteria	63463
298	Ga0496113_0015060	3300048916	Bacteria	5299
299	Ga0496113_0110150	3300048916	Bacteria	2142
300	Ga0496113_0151938	3300048916	Bacteria	1827
301	Ga0496114_0000039	3300048917	Bacteria	138486
302	Ga0496114_0009804	3300048917	Bacteria	7611
303	Ga0496115_0000011	3300048918	Bacteria	222529
304	Ga0496115_0000162	3300048918	Bacteria	62522
305	Ga0496116_0000176	3300048919	Bacteria	128426
306	Ga0496117_0012250	3300048920	Bacteria	7582
307	Ga0496117_0161370	3300048920	Bacteria	1313
308	Ga0496117_0169814	3300048920	Bacteria	1267
309	Ga0496117_0217210	3300048920	Bacteria	1067
310	Ga0496118_0005822	3300048921	Bacteria	13815
311	Ga0496118_0050263	3300048921	Bacteria	3202
312	Ga0496119_0035950	3300048922	Bacteria	3239
313	Ga0496119_0037715	3300048922	Bacteria	3135
314	Ga0496119_0045653	3300048922	Bacteria	2744
315	Ga0496120_0008785	3300048923	Bacteria	7261
316	Ga0496121_0085140	3300048924	Bacteria	2490
317	Ga0496121_0088226	3300048924	Bacteria	2432
318	Ga0496124_0017107	3300048927	Bacteria	6855
319	Ga0496124_0405801	3300048927	Bacteria	944
320	Ga0496125_0024514	3300048928	Bacteria	5547
321	Ga0496125_0079335	3300048928	Bacteria	2519
322	Ga0496126_0036973	3300048929	Bacteria	4561
323	Ga0496126_0110601	3300048929	Bacteria	2393
324	Ga0496126_0272574	3300048929	Bacteria	1404
325	Ga0501031_0017289	3300049568	Bacteria	4685
326	Ga0501032_0002323	3300049569	Bacteria	14908
327	Ga0501033_0001255	3300049570	Bacteria	22735
328	Ga0501034_0016423	3300049571	Bacteria	7598
329	Ga0501036_0004619	3300049572	Bacteria	11128
330	Ga0501037_0002105	3300049573	Bacteria	14423
331	Ga0501038_0003549	3300049574	Bacteria	14517
332	Ga0501039_0015041	3300049575	Bacteria	5920
333	Ga0501039_0048618	3300049575	Bacteria	3279
334	Ga0501040_0051211	3300049576	Bacteria	2824
335	Ga0501040_0182691	3300049576	Bacteria	1487
336	Ga0501042_0006040	3300049578	Bacteria	7842
337	Ga0501042_0033797	3300049578	Bacteria	3626
338	Ga0501042_0168438	3300049578	Bacteria	1581
339	Ga0501043_0002925	3300049579	Bacteria	14258
340	Ga0501043_0235827	3300049579	Bacteria	1412
341	Ga0501046_0003552	3300049580	Bacteria	14279
342	Ga0501047_0002361	3300049581	Bacteria	18047
343	Ga0501047_0026955	3300049581	Bacteria	5533
344	Ga0501048_0002577	3300049582	Bacteria	13867
345	Ga0501048_0362440	3300049582	Bacteria	1034
346	Ga0501067_0045969	3300049583	Bacteria	2423
347	Ga0501068_0073765	3300049584	Bacteria	2085
348	Ga0501068_0080863	3300049584	Bacteria	1994
349	Ga0501069_0003034	3300049585	Bacteria	8625
350	Ga0501069_0012692	3300049585	Bacteria	4483
351	Ga0501070_0000832	3300049586	Bacteria	28030
352	Ga0501070_0025981	3300049586	Bacteria	4912
353	Ga0501070_0179886	3300049586	Bacteria	1740
354	Ga0501071_0046933	3300049587	Bacteria	3103
355	Ga0501071_0137027	3300049587	Bacteria	1822
356	Ga0501071_0177289	3300049587	Bacteria	1596
357	Ga0501071_0227099	3300049587	Bacteria	1406
358	Ga0501071_0246665	3300049587	Bacteria	1347
359	Ga0501072_0008765	3300049588	Bacteria	7679
360	Ga0501072_0016434	3300049588	Bacteria	5682
361	Ga0501073_0007834	3300049589	Bacteria	7930
362	Ga0501074_0007166	3300049590	Bacteria	8051
363	Ga0501074_0151174	3300049590	Bacteria	1660
364	Ga0501075_0053420	3300049591	Bacteria	3039
365	Ga0501076_0040680	3300049592	Bacteria	3654
366	Ga0501079_0009011	3300049741	Bacteria	7557
367	Ga0501079_0027124	3300049741	Bacteria	4391
368	Ga0501079_0041381	3300049741	Bacteria	3556
369	Ga0501079_0323964	3300049741	Bacteria	1206
370	Ga0501080_0042656	3300049742	Bacteria	4223
371	Ga0501081_0074984	3300049743	Bacteria	2361
372	Ga0501081_0085469	3300049743	Bacteria	2214
373	Ga0501083_0002406	3300049744	Bacteria	12801
374	Ga0501083_0027131	3300049744	Bacteria	3953
375	Ga0501083_0057462	3300049744	Bacteria	2604
376	Ga0501035_0004128	3300049822	Bacteria	13802
377	Ga0501044_0000684	3300049823	Bacteria	40967
378	Ga0501044_0022596	3300049823	Bacteria	6702
379	Ga0501044_0064508	3300049823	Bacteria	3739
380	Ga0501044_0113087	3300049823	Bacteria	2722
381	Ga0501045_0114833	3300049824	Bacteria	1997
382	Ga0501045_0217814	3300049824	Bacteria	1422
383	Ga0501045_0306019	3300049824	Bacteria	1183
384	nmdc:mga00v17_243618_c1	3300050491	Unclassified	1166
385	nmdc:mga00v17_244836_c1	3300050491	Bacteria	1163
386	nmdc:mga00v17_353553_c1	3300050491	Bacteria	955
387	nmdc:mga0yw44_1064_c1	3300050492	Bacteria	10534
388	nmdc:mga0yw44_125449_c1	3300050492	Bacteria	1657
389	nmdc:mga0yw44_7751_c1	3300050492	Bacteria	5305
390	nmdc:mga05p37_390048_c1	3300050507	Bacteria	1629
391	nmdc:mga06r32_126232_c1	3300050510	Bacteria	2527
392	nmdc:mga06r32_27570_c1	3300050510	Bacteria	5309
393	nmdc:mga0a205_13148_c1	3300050515	Bacteria	7320
394	nmdc:mga0a205_3456_c1	3300050515	Bacteria	14102
395	nmdc:mga0a205_521_c1	3300050515	Bacteria	18797
396	Ga0495601_0000595	3300053077	Bacteria	19251
397	Ga0495601_0006880	3300053077	Bacteria	6662
398	Ga0495601_0014754	3300053077	Bacteria	4715
399	Ga0495601_0085787	3300053077	Bacteria	2023
400	Ga0495612_0000160	3300053078	Bacteria	28362
401	Ga0495655_0000002	3300053083	Bacteria	312752
402	Ga0495595_0000002	3300053084	Bacteria	445641
403	Ga0495595_0007963	3300053084	Bacteria	4340
404	Ga0495595_0313524	3300053084	Bacteria	790
405	Ga0495619_0000047	3300053085	Bacteria	102152
406	Ga0495619_0000276	3300053085	Bacteria	36931
407	Ga0495619_0000485	3300053085	Bacteria	26622
408	Ga0495619_0000680	3300053085	Bacteria	22263
409	Ga0495619_0009287	3300053085	Bacteria	6208
410	Ga0495619_0142479	3300053085	Bacteria	1651
411	Ga0500566_0007440	3300053094	Bacteria	6490
412	Ga0500641_0026027	3300053096	Bacteria	2268
413	Ga0500572_030115	3300053111	Bacteria	1506
414	Ga0500595_019702	3300053119	Bacteria	2442
415	Ga0500614_000150	3300053123	Bacteria	17505
416	Ga0500628_000001	3300053129	Bacteria	564074
417	Ga0501084_0310542	3300054114	Bacteria	1332
418	Ga0501082_0008369	3300060353	Bacteria	8922
419	Ga0501082_0098175	3300060353	Bacteria	2533
420	Ga0501082_0294647	3300060353	Bacteria	1413
421	Ga0501082_0497583	3300060353	Bacteria	1065

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300045976	Ga0466967_0132235	Ga0466967_0132235_366_974	201
2	3300009098	Ga0105245_10002406	Ga0105245_100024063	202
3	3300037312	Ga0395899_0446475	Ga0395899_0446475_212_829	205
4	3300035113	Ga0373936_0358043	Ga0373936_0358043_21_641	206
5	3300005985	Ga0081539_10012474	Ga0081539_100124744	208
6	3300047321	Ga0495676_0025514	Ga0495676_0025514_440_1117	209
7	3300048903	Ga0496100_0000001	Ga0496100_0000001_525089_525766	209
8	3300048904	Ga0496101_0000004	Ga0496101_0000004_326441_327118	209
9	3300048909	Ga0496106_0000414	Ga0496106_0000414_25206_25883	209
10	3300048910	Ga0496107_0000005	Ga0496107_0000005_4482_5159	209
11	3300048916	Ga0496113_0151938	Ga0496113_0151938_969_1646	209
12	3300009177	Ga0105248_10000020	Ga0105248_100000206	211
13	3300025941	Ga0207711_10000006	Ga0207711_10000006369	211
14	3300038443	Ga0395901_0396653	Ga0395901_0396653_770_1405	211
15	3300025927	Ga0207687_10002476	Ga0207687_100024767	212
16	3300005337	Ga0070682_100000398	Ga0070682_1000003987	213
17	3300005578	Ga0068854_100000116	Ga0068854_10000011658	213
18	3300010375	Ga0105239_10026587	Ga0105239_100265876	213
19	3300013104	Ga0157370_10041744	Ga0157370_100417443	213
20	3300013307	Ga0157372_10006142	Ga0157372_1000614210	213
21	3300020082	Ga0206353_10578555	Ga0206353_105785552	213
22	3300025981	Ga0207640_10000134	Ga0207640_1000013459	213
23	3300053085	Ga0495619_0000047	Ga0495619_0000047_4613_5254	213
24	3300005345	Ga0070692_10022865	Ga0070692_100228653	214
25	3300005365	Ga0070688_100004986	Ga0070688_1000049867	214
26	3300005466	Ga0070685_10000665	Ga0070685_1000066518	214
27	3300005539	Ga0068853_100254035	Ga0068853_1002540352	214
28	3300005616	Ga0068852_100000056	Ga0068852_1000000566	214
29	3300005718	Ga0068866_10043414	Ga0068866_100434142	214
30	3300009098	Ga0105245_10000141	Ga0105245_1000014172	214
31	3300009176	Ga0105242_11086934	Ga0105242_110869342	214
32	3300010375	Ga0105239_10104009	Ga0105239_101040093	214
33	3300013104	Ga0157370_10013982	Ga0157370_100139822	214
34	3300013105	Ga0157369_10004884	Ga0157369_1000488414	214
35	3300025899	Ga0207642_10011322	Ga0207642_100113222	214
36	3300025927	Ga0207687_10000036	Ga0207687_100000366	214
37	3300026142	Ga0207698_10000101	Ga0207698_100001016	214
38	3300045976	Ga0466967_0000001	Ga0466967_0000001_4431_5075	214
39	3300046476	Ga0495662_0000304	Ga0495662_0000304_281_925	214
40	3300048911	Ga0496108_0000137	Ga0496108_0000137_5569_6213	214
41	3300048912	Ga0496109_0000088	Ga0496109_0000088_4370_5014	214
42	3300005329	Ga0070683_100065402	Ga0070683_1000654022	215
43	3300005344	Ga0070661_100000616	Ga0070661_10000061627	215
44	3300005436	Ga0070713_100000010	Ga0070713_100000010144	215
45	3300005436	Ga0070713_100071429	Ga0070713_1000714291	215
46	3300005466	Ga0070685_10127780	Ga0070685_101277802	215
47	3300005564	Ga0070664_100066983	Ga0070664_1000669833	215
48	3300025920	Ga0207649_10000189	Ga0207649_100001895	215
49	3300025928	Ga0207700_10000007	Ga0207700_10000007345	215
50	3300025935	Ga0207709_10013192	Ga0207709_100131923	215
51	3300025945	Ga0207679_10047207	Ga0207679_100472072	215
52	3300046511	Ga0495608_0000007	Ga0495608_0000007_6280_6927	215
53	3300046675	Ga0495657_0000001	Ga0495657_0000001_138426_139073	215
54	3300046689	Ga0495613_0000247	Ga0495613_0000247_49163_49810	215
55	3300046809	Ga0495600_0003120	Ga0495600_0003120_7801_8448	215
56	3300047444	Ga0495675_0003149	Ga0495675_0003149_4998_5645	215
57	3300053084	Ga0495595_0000002	Ga0495595_0000002_306569_307216	215
58	3300053085	Ga0495619_0000276	Ga0495619_0000276_31438_32085	215
59	3300005339	Ga0070660_100234957	Ga0070660_1002349572	217
60	3300005366	Ga0070659_100010883	Ga0070659_1000108835	217
61	3300005843	Ga0068860_100008818	Ga0068860_1000088188	217
62	3300025932	Ga0207690_10004319	Ga0207690_100043196	217
63	3300044842	Ga0466957_0016061	Ga0466957_0016061_205_858	217
64	3300045836	Ga0466958_0091079	Ga0466958_0091079_1077_1730	217
65	3300046461	Ga0495641_0000027	Ga0495641_0000027_56258_56914	217
66	3300046511	Ga0495608_0024956	Ga0495608_0024956_527_1183	217
67	3300046516	Ga0495628_0326755	Ga0495628_0326755_419_1072	217
68	3300046678	Ga0495599_0013017	Ga0495599_0013017_353_1009	217
69	3300047317	Ga0495604_0101940	Ga0495604_0101940_94_747	217
70	3300048088	Ga0495602_0000007	Ga0495602_0000007_267852_268505	217
71	3300053077	Ga0495601_0000595	Ga0495601_0000595_13897_14550	217
72	3300053084	Ga0495595_0007963	Ga0495595_0007963_2812_3465	217
73	3300053123	Ga0500614_000150	Ga0500614_000150_5577_6233	217
74	3300005578	Ga0068854_100196766	Ga0068854_1001967662	218
75	3300005614	Ga0068856_100000336	Ga0068856_1000003366	218
76	3300006038	Ga0075365_10176231	Ga0075365_101762312	218
77	3300006881	Ga0068865_100000856	Ga0068865_10000085617	218
78	3300009553	Ga0105249_10000332	Ga0105249_100003327	218
79	3300013102	Ga0157371_10011110	Ga0157371_100111105	218
80	3300014968	Ga0157379_10003315	Ga0157379_1000331516	218
81	3300025893	Ga0207682_10000022	Ga0207682_100000228	218
82	3300025927	Ga0207687_10000073	Ga0207687_100000738	218
83	3300025938	Ga0207704_10000049	Ga0207704_1000004987	218
84	3300025961	Ga0207712_10000058	Ga0207712_100000587	218
85	3300025981	Ga0207640_10239603	Ga0207640_102396032	218
86	3300026078	Ga0207702_10000368	Ga0207702_1000036856	218
87	3300026078	Ga0207702_10008029	Ga0207702_100080298	218
88	3300044694	Ga0466963_0068480	Ga0466963_0068480_1279_1935	218
89	3300046517	Ga0495630_0004844	Ga0495630_0004844_5484_6143	218
90	3300047317	Ga0495604_0000195	Ga0495604_0000195_49087_49743	218
91	3300047446	Ga0495679_028114	Ga0495679_028114_870_1529	218
92	3300048911	Ga0496108_0000006	Ga0496108_0000006_238245_238904	218
93	3300048912	Ga0496109_0000009	Ga0496109_0000009_5333_5992	218
94	3300048913	Ga0496110_0000242	Ga0496110_0000242_30250_30906	218
95	3300048913	Ga0496110_0029251	Ga0496110_0029251_3472_4131	218
96	3300048914	Ga0496111_0004875	Ga0496111_0004875_4539_5195	218
97	3300048915	Ga0496112_0007945	Ga0496112_0007945_4450_5106	218
98	3300048915	Ga0496112_0731786	Ga0496112_0731786_123_779	218
99	3300048916	Ga0496113_0000027	Ga0496113_0000027_58066_58722	218
100	3300050491	nmdc:mga00v17_243618_c1	nmdc:mga00v17_243618_c1_357_1034	218
101	3300050492	nmdc:mga0yw44_125449_c1	nmdc:mga0yw44_125449_c1_660_1337	218
102	3300050507	nmdc:mga05p37_390048_c1	nmdc:mga05p37_390048_c1_717_1382	218
103	3300053077	Ga0495601_0085787	Ga0495601_0085787_324_980	218
104	3300005338	Ga0068868_100002153	Ga0068868_1000021537	219
105	3300005548	Ga0070665_100000135	Ga0070665_100000135136	219
106	3300005618	Ga0068864_100000704	Ga0068864_10000070425	219
107	3300005985	Ga0081539_10003008	Ga0081539_1000300810	219
108	3300006038	Ga0075365_10001750	Ga0075365_100017503	219
109	3300006038	Ga0075365_10004143	Ga0075365_100041437	219
110	3300006051	Ga0075364_10028446	Ga0075364_100284465	219
111	3300006051	Ga0075364_10449118	Ga0075364_104491181	219
112	3300006058	Ga0075432_10017927	Ga0075432_100179272	219
113	3300006163	Ga0070715_10000021	Ga0070715_10000021118	219
114	3300006847	Ga0075431_100008031	Ga0075431_10000803110	219
115	3300006852	Ga0075433_10102133	Ga0075433_101021332	219
116	3300006880	Ga0075429_100748388	Ga0075429_1007483881	219
117	3300009147	Ga0114129_10046061	Ga0114129_100460616	219
118	3300009174	Ga0105241_10526399	Ga0105241_105263991	219
119	3300009545	Ga0105237_10260982	Ga0105237_102609822	219
120	3300009551	Ga0105238_10767261	Ga0105238_107672612	219
121	3300025905	Ga0207685_10000028	Ga0207685_100000287	219
122	3300026023	Ga0207677_10000374	Ga0207677_1000037434	219
123	3300026095	Ga0207676_10000632	Ga0207676_100006328	219
124	3300027907	Ga0207428_10013763	Ga0207428_100137635	219
125	3300028379	Ga0268266_10000056	Ga0268266_10000056285	219
126	3300028381	Ga0268264_10010770	Ga0268264_100107708	219
127	3300036401	Ga0373937_0513788	Ga0373937_0513788_115_777	219
128	3300041459	Ga0451800_0574206	Ga0451800_0574206_411_1088	219
129	3300046454	Ga0495592_0161175	Ga0495592_0161175_288_947	219
130	3300046455	Ga0495603_0003584	Ga0495603_0003584_4300_4959	219
131	3300046461	Ga0495641_0021694	Ga0495641_0021694_2283_2942	219
132	3300046539	Ga0495621_0000973	Ga0495621_0000973_2339_3010	219
133	3300046543	Ga0495645_0520829	Ga0495645_0520829_57_716	219
134	3300047317	Ga0495604_0000050	Ga0495604_0000050_99769_100428	219
135	3300047322	Ga0495680_0155223	Ga0495680_0155223_228_890	219
136	3300047322	Ga0495680_0190192	Ga0495680_0190192_639_1298	219
137	3300048916	Ga0496113_0015060	Ga0496113_0015060_3086_3757	219
138	3300048927	Ga0496124_0405801	Ga0496124_0405801_52_717	219
139	3300048929	Ga0496126_0036973	Ga0496126_0036973_194_865	219
140	3300049578	Ga0501042_0168438	Ga0501042_0168438_368_1045	219
141	3300049587	Ga0501071_0227099	Ga0501071_0227099_355_1032	219
142	3300049741	Ga0501079_0323964	Ga0501079_0323964_276_935	219
143	3300049823	Ga0501044_0113087	Ga0501044_0113087_1383_2048	219
144	3300050491	nmdc:mga00v17_244836_c1	nmdc:mga00v17_244836_c1_417_1094	219
145	3300050491	nmdc:mga00v17_353553_c1	nmdc:mga00v17_353553_c1_81_758	219
146	3300050492	nmdc:mga0yw44_1064_c1	nmdc:mga0yw44_1064_c1_1199_1876	219
147	3300050492	nmdc:mga0yw44_7751_c1	nmdc:mga0yw44_7751_c1_525_1202	219
148	3300050510	nmdc:mga06r32_27570_c1	nmdc:mga06r32_27570_c1_4324_5001	219
149	3300050515	nmdc:mga0a205_13148_c1	nmdc:mga0a205_13148_c1_4762_5439	219
150	3300053085	Ga0495619_0000485	Ga0495619_0000485_20463_21125	219
151	3300002244	JGI24742J22300_10016245	JGI24742J22300_100162451	220
152	3300005329	Ga0070683_100001863	Ga0070683_10000186319	220
153	3300005337	Ga0070682_100000578	Ga0070682_1000005787	220
154	3300005341	Ga0070691_10000021	Ga0070691_100000216	220
155	3300005345	Ga0070692_10243805	Ga0070692_102438052	220
156	3300005347	Ga0070668_100013247	Ga0070668_1000132476	220
157	3300005356	Ga0070674_100000235	Ga0070674_1000002357	220
158	3300005356	Ga0070674_100083094	Ga0070674_1000830942	220
159	3300005367	Ga0070667_100001908	Ga0070667_10000190818	220
160	3300005456	Ga0070678_100252583	Ga0070678_1002525832	220
161	3300005458	Ga0070681_10036375	Ga0070681_100363752	220
162	3300005530	Ga0070679_100016435	Ga0070679_1000164352	220
163	3300005535	Ga0070684_100004796	Ga0070684_1000047962	220
164	3300005535	Ga0070684_100032534	Ga0070684_1000325343	220
165	3300005545	Ga0070695_100096572	Ga0070695_1000965722	220
166	3300005547	Ga0070693_100002911	Ga0070693_1000029118	220
167	3300005548	Ga0070665_100129478	Ga0070665_1001294782	220
168	3300005564	Ga0070664_100348224	Ga0070664_1003482242	220
169	3300005564	Ga0070664_100421932	Ga0070664_1004219322	220
170	3300005577	Ga0068857_100266659	Ga0068857_1002666592	220
171	3300005614	Ga0068856_100032534	Ga0068856_1000325346	220
172	3300005614	Ga0068856_100633444	Ga0068856_1006334442	220
173	3300005718	Ga0068866_10000008	Ga0068866_100000087	220
174	3300005718	Ga0068866_10001267	Ga0068866_100012678	220
175	3300005841	Ga0068863_100003052	Ga0068863_10000305216	220
176	3300005841	Ga0068863_100203289	Ga0068863_1002032892	220
177	3300005842	Ga0068858_100753870	Ga0068858_1007538702	220
178	3300005843	Ga0068860_100090882	Ga0068860_1000908823	220
179	3300005843	Ga0068860_100314499	Ga0068860_1003144991	220
180	3300005937	Ga0081455_10007705	Ga0081455_100077059	220
181	3300005981	Ga0081538_10000190	Ga0081538_1000019082	220
182	3300005981	Ga0081538_10028617	Ga0081538_100286172	220
183	3300005983	Ga0081540_1090872	Ga0081540_10908722	220
184	3300009098	Ga0105245_10002008	Ga0105245_100020088	220
185	3300009101	Ga0105247_10000278	Ga0105247_100002787	220
186	3300009148	Ga0105243_10011687	Ga0105243_100116877	220
187	3300009176	Ga0105242_10000533	Ga0105242_1000053331	220
188	3300009553	Ga0105249_10012314	Ga0105249_100123146	220
189	3300009553	Ga0105249_10875569	Ga0105249_108755692	220
190	3300010375	Ga0105239_10505927	Ga0105239_105059272	220
191	3300010375	Ga0105239_10565821	Ga0105239_105658212	220
192	3300013296	Ga0157374_11003345	Ga0157374_110033451	220
193	3300014325	Ga0163163_10869214	Ga0163163_108692142	220
194	3300014969	Ga0157376_10013350	Ga0157376_100133507	220
195	3300014969	Ga0157376_10049226	Ga0157376_100492264	220
196	3300025899	Ga0207642_10000002	Ga0207642_10000002662	220
197	3300025899	Ga0207642_10001753	Ga0207642_100017537	220
198	3300025900	Ga0207710_10000695	Ga0207710_1000069513	220
199	3300025912	Ga0207707_10241058	Ga0207707_102410582	220
200	3300025921	Ga0207652_10001961	Ga0207652_1000196119	220
201	3300025927	Ga0207687_10000032	Ga0207687_10000032137	220
202	3300025934	Ga0207686_10000073	Ga0207686_10000073108	220
203	3300025934	Ga0207686_10054824	Ga0207686_100548242	220
204	3300025937	Ga0207669_10000006	Ga0207669_10000006186	220
205	3300025937	Ga0207669_10000182	Ga0207669_100001827	220
206	3300025937	Ga0207669_10045521	Ga0207669_100455213	220
207	3300025942	Ga0207689_10206528	Ga0207689_102065282	220
208	3300025944	Ga0207661_10000278	Ga0207661_100002787	220
209	3300025944	Ga0207661_10002137	Ga0207661_100021376	220
210	3300025945	Ga0207679_10601443	Ga0207679_106014432	220
211	3300025961	Ga0207712_10004957	Ga0207712_100049577	220
212	3300025972	Ga0207668_10019658	Ga0207668_100196585	220
213	3300025986	Ga0207658_10003595	Ga0207658_100035959	220
214	3300026023	Ga0207677_10058516	Ga0207677_100585162	220
215	3300026035	Ga0207703_10261386	Ga0207703_102613862	220
216	3300026041	Ga0207639_10112946	Ga0207639_101129462	220
217	3300026088	Ga0207641_10002193	Ga0207641_1000219316	220
218	3300026116	Ga0207674_10480270	Ga0207674_104802702	220
219	3300026121	Ga0207683_10287266	Ga0207683_102872662	220
220	3300028379	Ga0268266_10221755	Ga0268266_102217552	220
221	3300028380	Ga0268265_10002439	Ga0268265_100024396	220
222	3300028381	Ga0268264_10269936	Ga0268264_102699362	220
223	3300028556	Ga0265337_1004058	Ga0265337_10040584	220
224	3300028558	Ga0265326_10000514	Ga0265326_1000051418	220
225	3300028563	Ga0265319_1000105	Ga0265319_10001055	220
226	3300028654	Ga0265322_10000029	Ga0265322_1000002988	220
227	3300028666	Ga0265336_10004915	Ga0265336_100049153	220
228	3300028800	Ga0265338_10000507	Ga0265338_1000050769	220
229	3300029957	Ga0265324_10006934	Ga0265324_100069344	220
230	3300031238	Ga0265332_10016434	Ga0265332_100164344	220
231	3300031239	Ga0265328_10001443	Ga0265328_100014434	220
232	3300031240	Ga0265320_10000011	Ga0265320_10000011264	220
233	3300031249	Ga0265339_10007254	Ga0265339_100072544	220
234	3300031250	Ga0265331_10000839	Ga0265331_1000083926	220
235	3300031250	Ga0265331_10036845	Ga0265331_100368452	220
236	3300031251	Ga0265327_10000015	Ga0265327_10000015372	220
237	3300031344	Ga0265316_10075180	Ga0265316_100751803	220
238	3300031595	Ga0265313_10030293	Ga0265313_100302933	220
239	3300031595	Ga0265313_10071401	Ga0265313_100714012	220
240	3300031711	Ga0265314_10000361	Ga0265314_1000036174	220
241	3300035724	Ga0373933_0291729	Ga0373933_0291729_26_706	220
242	3300036401	Ga0373937_0016879	Ga0373937_0016879_28_708	220
243	3300036401	Ga0373937_0152326	Ga0373937_0152326_1233_1913	220
244	3300041491	Ga0451833_0886278	Ga0451833_0886278_547_1227	220
245	3300041496	Ga0451839_0658184	Ga0451839_0658184_570_1250	220
246	3300045976	Ga0466967_0271844	Ga0466967_0271844_828_1496	220
247	3300046455	Ga0495603_0007986	Ga0495603_0007986_814_1494	220
248	3300046459	Ga0495629_0004526	Ga0495629_0004526_655_1335	220
249	3300046459	Ga0495629_0007301	Ga0495629_0007301_4207_4884	220
250	3300046459	Ga0495629_0197217	Ga0495629_0197217_207_884	220
251	3300046462	Ga0495651_0045199	Ga0495651_0045199_112_792	220
252	3300046477	Ga0495664_0280941	Ga0495664_0280941_308_985	220
253	3300046499	Ga0495594_0000011	Ga0495594_0000011_78708_79385	220
254	3300046511	Ga0495608_0265080	Ga0495608_0265080_163_840	220
255	3300046511	Ga0495608_0287823	Ga0495608_0287823_295_975	220
256	3300046514	Ga0495618_0273424	Ga0495618_0273424_190_867	220
257	3300046516	Ga0495628_0001027	Ga0495628_0001027_19686_20363	220
258	3300046517	Ga0495630_0000454	Ga0495630_0000454_24804_25484	220
259	3300046517	Ga0495630_0057962	Ga0495630_0057962_450_1130	220
260	3300046517	Ga0495630_0101959	Ga0495630_0101959_1354_2031	220
261	3300046529	Ga0495652_0000037	Ga0495652_0000037_129029_129709	220
262	3300046529	Ga0495652_0014694	Ga0495652_0014694_936_1613	220
263	3300046533	Ga0495640_0019139	Ga0495640_0019139_1676_2356	220
264	3300046533	Ga0495640_0397909	Ga0495640_0397909_43_723	220
265	3300046536	Ga0495587_0017335	Ga0495587_0017335_1292_1972	220
266	3300046536	Ga0495587_0222018	Ga0495587_0222018_272_952	220
267	3300046543	Ga0495645_0004950	Ga0495645_0004950_8272_8949	220
268	3300046543	Ga0495645_0019494	Ga0495645_0019494_1594_2271	220
269	3300046557	Ga0495622_0000021	Ga0495622_0000021_149109_149786	220
270	3300046559	Ga0495667_0369136	Ga0495667_0369136_13_690	220
271	3300046642	Ga0495634_0006592	Ga0495634_0006592_3453_4130	220
272	3300046660	Ga0495625_0001050	Ga0495625_0001050_31082_31756	220
273	3300046684	Ga0495669_0000143	Ga0495669_0000143_39341_40021	220
274	3300046689	Ga0495613_0354922	Ga0495613_0354922_228_905	220
275	3300046694	Ga0495649_0000585	Ga0495649_0000585_5053_5733	220
276	3300046809	Ga0495600_0238211	Ga0495600_0238211_31_711	220
277	3300047317	Ga0495604_0198443	Ga0495604_0198443_306_986	220
278	3300047319	Ga0495674_0000059	Ga0495674_0000059_35253_35933	220
279	3300047320	Ga0495672_0189863	Ga0495672_0189863_192_881	220
280	3300047321	Ga0495676_0004577	Ga0495676_0004577_6097_6777	220
281	3300047322	Ga0495680_0025775	Ga0495680_0025775_2337_3017	220
282	3300047673	Ga0495593_0221111	Ga0495593_0221111_258_938	220
283	3300048088	Ga0495602_0005656	Ga0495602_0005656_8897_9574	220
284	3300048903	Ga0496100_0000013	Ga0496100_0000013_171274_171954	220
285	3300048904	Ga0496101_0000035	Ga0496101_0000035_171274_171954	220
286	3300048905	Ga0496102_0000522	Ga0496102_0000522_36615_37295	220
287	3300048905	Ga0496102_0113399	Ga0496102_0113399_1709_2380	220
288	3300048905	Ga0496102_0700405	Ga0496102_0700405_61_741	220
289	3300048906	Ga0496103_0000174	Ga0496103_0000174_3747_4427	220
290	3300048906	Ga0496103_0007177	Ga0496103_0007177_3537_4208	220
291	3300048907	Ga0496104_0001566	Ga0496104_0001566_5641_6321	220
292	3300048908	Ga0496105_0000030	Ga0496105_0000030_5330_6010	220
293	3300048908	Ga0496105_0001501	Ga0496105_0001501_13952_14632	220
294	3300048909	Ga0496106_0000062	Ga0496106_0000062_79806_80486	220
295	3300048910	Ga0496107_0000020	Ga0496107_0000020_142423_143103	220
296	3300048913	Ga0496110_0076759	Ga0496110_0076759_1823_2503	220
297	3300048914	Ga0496111_0012923	Ga0496111_0012923_2072_2752	220
298	3300048915	Ga0496112_0000025	Ga0496112_0000025_9266_9946	220
299	3300048916	Ga0496113_0110150	Ga0496113_0110150_735_1415	220
300	3300048917	Ga0496114_0000039	Ga0496114_0000039_130016_130696	220
301	3300048917	Ga0496114_0009804	Ga0496114_0009804_2000_2680	220
302	3300048918	Ga0496115_0000011	Ga0496115_0000011_4240_4920	220
303	3300048918	Ga0496115_0000162	Ga0496115_0000162_54818_55498	220
304	3300048920	Ga0496117_0217210	Ga0496117_0217210_147_821	220
305	3300049575	Ga0501039_0048618	Ga0501039_0048618_23_703	220
306	3300049576	Ga0501040_0182691	Ga0501040_0182691_117_797	220
307	3300049578	Ga0501042_0033797	Ga0501042_0033797_863_1537	220
308	3300049584	Ga0501068_0073765	Ga0501068_0073765_1257_1937	220
309	3300049587	Ga0501071_0137027	Ga0501071_0137027_798_1478	220
310	3300049587	Ga0501071_0246665	Ga0501071_0246665_389_1063	220
311	3300049588	Ga0501072_0008765	Ga0501072_0008765_3054_3734	220
312	3300049590	Ga0501074_0151174	Ga0501074_0151174_827_1501	220
313	3300049591	Ga0501075_0053420	Ga0501075_0053420_1024_1698	220
314	3300049592	Ga0501076_0040680	Ga0501076_0040680_1466_2143	220
315	3300049741	Ga0501079_0027124	Ga0501079_0027124_297_971	220
316	3300049743	Ga0501081_0074984	Ga0501081_0074984_645_1325	220
317	3300049743	Ga0501081_0085469	Ga0501081_0085469_210_890	220
318	3300049824	Ga0501045_0114833	Ga0501045_0114833_610_1290	220
319	3300049824	Ga0501045_0217814	Ga0501045_0217814_356_1036	220
320	3300049824	Ga0501045_0306019	Ga0501045_0306019_426_1106	220
321	3300050510	nmdc:mga06r32_126232_c1	nmdc:mga06r32_126232_c1_899_1579	220
322	3300050515	nmdc:mga0a205_3456_c1	nmdc:mga0a205_3456_c1_9334_10014	220
323	3300050515	nmdc:mga0a205_521_c1	nmdc:mga0a205_521_c1_3909_4589	220
324	3300053077	Ga0495601_0006880	Ga0495601_0006880_2394_3074	220
325	3300053077	Ga0495601_0014754	Ga0495601_0014754_27_707	220
326	3300053078	Ga0495612_0000160	Ga0495612_0000160_23425_24105	220
327	3300053083	Ga0495655_0000002	Ga0495655_0000002_307548_308228	220
328	3300053084	Ga0495595_0313524	Ga0495595_0313524_53_736	220
329	3300053085	Ga0495619_0000680	Ga0495619_0000680_4916_5596	220
330	3300053085	Ga0495619_0009287	Ga0495619_0009287_3609_4289	220
331	3300053085	Ga0495619_0142479	Ga0495619_0142479_540_1220	220
332	3300053094	Ga0500566_0007440	Ga0500566_0007440_3817_4497	220
333	3300053096	Ga0500641_0026027	Ga0500641_0026027_1047_1721	220
334	3300053129	Ga0500628_000001	Ga0500628_000001_396217_396897	220
335	3300060353	Ga0501082_0098175	Ga0501082_0098175_1479_2159	220
336	3300060353	Ga0501082_0294647	Ga0501082_0294647_468_1148	220
337	3300001977	JGI24746J21847_1000412	JGI24746J21847_10004128	221
338	3300005335	Ga0070666_10019920	Ga0070666_100199202	221
339	3300005335	Ga0070666_10162018	Ga0070666_101620182	221
340	3300005367	Ga0070667_100042334	Ga0070667_1000423344	221
341	3300005367	Ga0070667_100458124	Ga0070667_1004581242	221
342	3300005367	Ga0070667_100482583	Ga0070667_1004825832	221
343	3300005455	Ga0070663_100009051	Ga0070663_1000090512	221
344	3300005937	Ga0081455_10105222	Ga0081455_101052223	221
345	3300009101	Ga0105247_10127498	Ga0105247_101274982	221
346	3300009176	Ga0105242_10443088	Ga0105242_104430882	221
347	3300013105	Ga0157369_10312488	Ga0157369_103124881	221
348	3300013308	Ga0157375_10843030	Ga0157375_108430302	221
349	3300025903	Ga0207680_10093661	Ga0207680_100936612	221
350	3300025921	Ga0207652_10008802	Ga0207652_100088026	221
351	3300025986	Ga0207658_10029416	Ga0207658_100294164	221
352	3300025986	Ga0207658_10327321	Ga0207658_103273212	221
353	3300026067	Ga0207678_10009806	Ga0207678_100098066	221
354	3300028379	Ga0268266_10010879	Ga0268266_100108795	221
355	3300046519	Ga0495632_0053203	Ga0495632_0053203_1286_1969	221
356	3300048905	Ga0496102_0081859	Ga0496102_0081859_2182_2862	221
357	3300048907	Ga0496104_0015713	Ga0496104_0015713_3096_3779	221
358	3300048908	Ga0496105_0284461	Ga0496105_0284461_88_771	221
359	3300048909	Ga0496106_0280828	Ga0496106_0280828_145_828	221
360	3300048911	Ga0496108_0589593	Ga0496108_0589593_231_914	221
361	3300048919	Ga0496116_0000176	Ga0496116_0000176_87261_87944	221
362	3300048920	Ga0496117_0012250	Ga0496117_0012250_3672_4352	221
363	3300048920	Ga0496117_0161370	Ga0496117_0161370_371_1051	221
364	3300048920	Ga0496117_0169814	Ga0496117_0169814_459_1142	221
365	3300048921	Ga0496118_0005822	Ga0496118_0005822_9474_10154	221
366	3300048921	Ga0496118_0050263	Ga0496118_0050263_228_908	221
367	3300048922	Ga0496119_0035950	Ga0496119_0035950_2445_3128	221
368	3300048922	Ga0496119_0037715	Ga0496119_0037715_644_1327	221
369	3300048922	Ga0496119_0045653	Ga0496119_0045653_2000_2695	221
370	3300048923	Ga0496120_0008785	Ga0496120_0008785_3027_3719	221
371	3300048924	Ga0496121_0085140	Ga0496121_0085140_1478_2161	221
372	3300048924	Ga0496121_0088226	Ga0496121_0088226_1519_2211	221
373	3300048927	Ga0496124_0017107	Ga0496124_0017107_3293_3976	221
374	3300048928	Ga0496125_0024514	Ga0496125_0024514_638_1330	221
375	3300048928	Ga0496125_0079335	Ga0496125_0079335_685_1368	221
376	3300048929	Ga0496126_0110601	Ga0496126_0110601_36_719	221
377	3300048929	Ga0496126_0272574	Ga0496126_0272574_93_773	221
378	3300049568	Ga0501031_0017289	Ga0501031_0017289_1019_1702	221
379	3300049569	Ga0501032_0002323	Ga0501032_0002323_9655_10338	221
380	3300049570	Ga0501033_0001255	Ga0501033_0001255_12372_13055	221
381	3300049571	Ga0501034_0016423	Ga0501034_0016423_2825_3508	221
382	3300049572	Ga0501036_0004619	Ga0501036_0004619_764_1447	221
383	3300049573	Ga0501037_0002105	Ga0501037_0002105_9692_10375	221
384	3300049574	Ga0501038_0003549	Ga0501038_0003549_9593_10276	221
385	3300049575	Ga0501039_0015041	Ga0501039_0015041_2188_2871	221
386	3300049576	Ga0501040_0051211	Ga0501040_0051211_388_1071	221
387	3300049578	Ga0501042_0006040	Ga0501042_0006040_2703_3386	221
388	3300049579	Ga0501043_0002925	Ga0501043_0002925_9614_10297	221
389	3300049579	Ga0501043_0235827	Ga0501043_0235827_435_1118	221
390	3300049580	Ga0501046_0003552	Ga0501046_0003552_3962_4645	221
391	3300049581	Ga0501047_0002361	Ga0501047_0002361_13274_13957	221
392	3300049581	Ga0501047_0026955	Ga0501047_0026955_3718_4401	221
393	3300049582	Ga0501048_0002577	Ga0501048_0002577_3536_4219	221
394	3300049582	Ga0501048_0362440	Ga0501048_0362440_114_797	221
395	3300049583	Ga0501067_0045969	Ga0501067_0045969_131_814	221
396	3300049584	Ga0501068_0080863	Ga0501068_0080863_474_1157	221
397	3300049585	Ga0501069_0003034	Ga0501069_0003034_1295_1978	221
398	3300049585	Ga0501069_0012692	Ga0501069_0012692_3181_3864	221
399	3300049586	Ga0501070_0000832	Ga0501070_0000832_21599_22282	221
400	3300049586	Ga0501070_0025981	Ga0501070_0025981_694_1374	221
401	3300049586	Ga0501070_0179886	Ga0501070_0179886_12_695	221
402	3300049587	Ga0501071_0046933	Ga0501071_0046933_2268_2951	221
403	3300049587	Ga0501071_0177289	Ga0501071_0177289_346_1029	221
404	3300049588	Ga0501072_0016434	Ga0501072_0016434_727_1410	221
405	3300049589	Ga0501073_0007834	Ga0501073_0007834_3962_4645	221
406	3300049590	Ga0501074_0007166	Ga0501074_0007166_2601_3284	221
407	3300049741	Ga0501079_0009011	Ga0501079_0009011_3009_3692	221
408	3300049741	Ga0501079_0041381	Ga0501079_0041381_2820_3503	221
409	3300049742	Ga0501080_0042656	Ga0501080_0042656_1824_2507	221
410	3300049744	Ga0501083_0002406	Ga0501083_0002406_3299_3982	221
411	3300049744	Ga0501083_0027131	Ga0501083_0027131_2473_3156	221
412	3300049744	Ga0501083_0057462	Ga0501083_0057462_557_1249	221
413	3300049822	Ga0501035_0004128	Ga0501035_0004128_9658_10341	221
414	3300049823	Ga0501044_0000684	Ga0501044_0000684_35803_36486	221
415	3300049823	Ga0501044_0022596	Ga0501044_0022596_3419_4102	221
416	3300049823	Ga0501044_0064508	Ga0501044_0064508_2387_3079	221
417	3300053111	Ga0500572_030115	Ga0500572_030115_380_1060	221
418	3300053119	Ga0500595_019702	Ga0500595_019702_800_1483	221
419	3300054114	Ga0501084_0310542	Ga0501084_0310542_104_784	221
420	3300060353	Ga0501082_0008369	Ga0501082_0008369_3222_3905	221
421	3300060353	Ga0501082_0497583	Ga0501082_0497583_14_706	221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01634

HisG

ATP phosphoribosyltransferase

63

221

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3drf-assembly1.cif.gz_A	lactococcal oppa complexed with an endogenous peptide in the closed conformation	0.6335	53	79
3b8b-assembly1.cif.gz_A	crystal structure of cysq from bacteroides thetaiotaomicron, a bacterial member of the inositol monophosphatase family	0.5686	1	82
2pfy-assembly4.cif.gz_D	crystal structure of dctp7, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid	0.5653	9	77
4n13-assembly1.cif.gz_A	crystal structure of psts (bb_0215) from borrelia burgdorferi	0.5575	9	104
8a29-assembly2.cif.gz_D	error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer'))	0.5419	8	59

ID	Description	Score	Start	End	Superfamily
af_Q2FUT7_2_78_3.40.190.10	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.8406	12	78	3.40.190.10
1nh8A01	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.8204	12	78	3.40.190.10
2vd2A01	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.7581	9	218	3.40.190.10
2vd3B01	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.7416	10	84	3.40.190.10
1z7nF01	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.7382	12	217	3.40.190.10

ID	Description	Score	Start	End	GO Terms
AF-A0A3B8KVY1-F1-model_v4	ATP phosphoribosyltransferase	0.9424	12	72	GO:0016757
AF-A0A354YTB4-F1-model_v4	ATP phosphoribosyltransferase	0.9216	11	72	GO:0016757
AF-A0A1X1FHL9-F1-model_v4	ATP phosphoribosyltransferase (EC 2.4.2.17)	0.9152	9	78	GO:0000105 GO:0003879
AF-A0A3B8KVY1-F1-model_v4	ATP phosphoribosyltransferase	0.914	12	72	GO:0016757
AF-A8V2H7-F1-model_v4	ATP phosphoribosyltransferase (EC 2.4.2.17)	0.894	9	78	GO:0000105 GO:0003879 GO:0005737

Feature Viewer

pLDDT	pTM	Quality
69.37	0.62	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F439917

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01634

HisG

ATP phosphoribosyltransferase

63

221

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map