F439846

General Info

Members Datasets Scaffolds Average Seq Length
420 246 840 249

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0000923|Ga0501037_0000923_13843_14742
Length 299
Sequence MASFFQFRKSMPVSALPNAGGGLKPEPAHLLSSKVGLTLVSSSAWATPTRFNMSGHSKWATIKHKKAALDSKRGKVFTRIIKEIMIAARGGGDPDANPRLRTAIAAAKAVSMPAENIKRAIMRGTGELEGAQIEEIMFEGYGPGGAAVLVMVATDNRNRTVSEIRHAFSKNGGNLGEQGSVAWMFERKSQILVEKEKADEDTLMGVVLDAGADDLRGDGDSWEILSPPEAQEAVLEALRKAKIDTISAEVAMIPKNLMKLEGKNAGAMLRLSEVLEEHDDVQNVYSNFDVDESELAALA

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
136 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
159 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
239 2831426010 Nostoc sp. 106C Isolate Unclassified
240 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
241 2849660919 Nostoc sp. T09 Isolate Unclassified
242 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
243 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
244 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
245 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
246 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.38
Metatranscriptomes 0.48
Isolates 2.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 4.29
Rhizosphere 90.24
Stem 0
Stem Tuber 0
Unclassified 3.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0000923 3300049573 Bacteria 21831
2 Ga0070683_100043798 3300005329 Bacteria 4125
3 Ga0070683_100235072 3300005329 Bacteria 1742
4 Ga0070683_100435848 3300005329 Bacteria 1250
5 Ga0070683_100458299 3300005329 Bacteria 1217
6 Ga0070690_100018412 3300005330 Bacteria 4219
7 Ga0068869_100120403 3300005334 Bacteria 2006
8 Ga0068869_100299474 3300005334 Bacteria 1298
9 Ga0070666_10003684 3300005335 Bacteria 9284
10 Ga0070666_10081225 3300005335 Bacteria 2216
11 Ga0070680_100624679 3300005336 Bacteria 925
12 Ga0068868_100262978 3300005338 Bacteria 1455
13 Ga0070660_100009652 3300005339 Bacteria 6797
14 Ga0070661_100124418 3300005344 Bacteria 1933
15 Ga0070671_100151522 3300005355 Bacteria 1958
16 Ga0070673_100021284 3300005364 Bacteria 4698
17 Ga0070688_100335635 3300005365 Bacteria 1102
18 Ga0070659_100284088 3300005366 Bacteria 1377
19 Ga0070709_10075408 3300005434 Unclassified 2188
20 Ga0070709_10175267 3300005434 Bacteria 1502
21 Ga0070714_100025436 3300005435 Bacteria 4886
22 Ga0070714_100051237 3300005435 Bacteria 3518
23 Ga0070713_100001456 3300005436 Bacteria 15108
24 Ga0070711_100012164 3300005439 Bacteria 5371
25 Ga0070662_100105614 3300005457 Bacteria 2138
26 Ga0070662_100442333 3300005457 Bacteria 1078
27 Ga0070681_10220982 3300005458 Bacteria 1809
28 Ga0070681_10836513 3300005458 Bacteria 838
29 Ga0070699_100007973 3300005518 Bacteria 9195
30 Ga0070679_100247854 3300005530 Bacteria 1738
31 Ga0070684_100054209 3300005535 Bacteria 3493
32 Ga0068853_100459938 3300005539 Bacteria 1198
33 Ga0070696_100009856 3300005546 Bacteria 6390
34 Ga0070693_100116200 3300005547 Bacteria 1653
35 Ga0070665_100028882 3300005548 Bacteria 5582
36 Ga0070665_100030926 3300005548 Bacteria 5388
37 Ga0068855_100052841 3300005563 Bacteria 4782
38 Ga0068857_100021654 3300005577 Bacteria 5657
39 Ga0068857_100034775 3300005577 Bacteria 4457
40 Ga0068854_100526125 3300005578 Bacteria 999
41 Ga0068856_100027794 3300005614 Bacteria 5518
42 Ga0068856_100081402 3300005614 Bacteria 3212
43 Ga0068856_100448760 3300005614 Bacteria 1310
44 Ga0068852_100046535 3300005616 Bacteria 3698
45 Ga0068859_100121318 3300005617 Bacteria 2680
46 Ga0068864_100008459 3300005618 Bacteria 8492
47 Ga0068864_100020847 3300005618 Bacteria 5485
48 Ga0068851_10060980 3300005834 Bacteria 1932
49 Ga0068863_100176011 3300005841 Bacteria 2053
50 Ga0068858_100010084 3300005842 Bacteria 8969
51 Ga0068858_100046664 3300005842 Bacteria 4015
52 Ga0068860_100035770 3300005843 Bacteria 4762
53 Ga0068862_100305562 3300005844 Bacteria 1464
54 Ga0081540_1043907 3300005983 Bacteria 2287
55 Ga0070717_10011363 3300006028 Bacteria 6758
56 Ga0075363_100048155 3300006048 Bacteria 2266
57 Ga0070712_100622969 3300006175 Bacteria 915
58 Ga0068871_100062555 3300006358 Bacteria 3042
59 Ga0068871_100915036 3300006358 Bacteria 813
60 Ga0075428_100091962 3300006844 Bacteria 3308
61 Ga0075434_100116545 3300006871 Bacteria 2684
62 Ga0075434_100487593 3300006871 Bacteria 1253
63 Ga0068865_100702175 3300006881 Bacteria 864
64 Ga0075436_100002958 3300006914 Bacteria 11637
65 Ga0075436_100480286 3300006914 Bacteria 907
66 Ga0097620_100121315 3300006931 Bacteria 2680
67 Ga0075435_100036445 3300007076 Bacteria 3909
68 Ga0075435_100098371 3300007076 Bacteria 2422
69 Ga0105240_10002876 3300009093 Bacteria 27223
70 Ga0105240_10002966 3300009093 Bacteria 26719
71 Ga0105240_10114457 3300009093 Bacteria 3258
72 Ga0105240_10149826 3300009093 Bacteria 2780
73 Ga0105240_10423657 3300009093 Bacteria 1495
74 Ga0105240_10536621 3300009093 Bacteria 1296
75 Ga0111539_10004457 3300009094 Bacteria 18306
76 Ga0105245_10064059 3300009098 Bacteria 3322
77 Ga0114129_10162015 3300009147 Bacteria 3055
78 Ga0114129_10802012 3300009147 Bacteria 1201
79 Ga0114129_11006977 3300009147 Bacteria 1049
80 Ga0105242_10064102 3300009176 Bacteria 3028
81 Ga0105242_10311185 3300009176 Bacteria 1441
82 Ga0105242_10821356 3300009176 Bacteria 922
83 Ga0105242_10875209 3300009176 Bacteria 896
84 Ga0105248_10085833 3300009177 Bacteria 3542
85 Ga0105248_10093758 3300009177 Bacteria 3381
86 Ga0105237_10006850 3300009545 Bacteria 12557
87 Ga0105237_10082001 3300009545 Bacteria 3216
88 Ga0105237_10311723 3300009545 Bacteria 1577
89 Ga0105237_10333081 3300009545 Bacteria 1522
90 Ga0105238_10027956 3300009551 Bacteria 5747
91 Ga0105238_10079993 3300009551 Bacteria 3258
92 Ga0105238_10157315 3300009551 Bacteria 2248
93 Ga0105238_10398651 3300009551 Bacteria 1369
94 Ga0105238_10503264 3300009551 Bacteria 1212
95 Ga0105239_10056792 3300010375 Bacteria 4294
96 Ga0105239_10072470 3300010375 Bacteria 3787
97 Ga0105239_10876366 3300010375 Bacteria 1030
98 Ga0105239_10939701 3300010375 Bacteria 993
99 Ga0157373_10128774 3300013100 Bacteria 1780
100 Ga0157370_10169086 3300013104 Bacteria 2032
101 Ga0157370_10269604 3300013104 Bacteria 1573
102 Ga0157369_10071585 3300013105 Bacteria 3721
103 Ga0157369_10219886 3300013105 Bacteria 1988
104 Ga0157369_10307899 3300013105 Bacteria 1647
105 Ga0157374_10078967 3300013296 Bacteria 3117
106 Ga0157374_10168745 3300013296 Bacteria 2134
107 Ga0157374_10242838 3300013296 Bacteria 1771
108 Ga0157378_10033612 3300013297 Bacteria 4534
109 Ga0157372_10143839 3300013307 Bacteria 2750
110 Ga0157372_10168141 3300013307 Bacteria 2536
111 Ga0157372_10605560 3300013307 Bacteria 1277
112 Ga0163163_10011962 3300014325 Bacteria 7896
113 Ga0163163_10012585 3300014325 Bacteria 7716
114 Ga0163163_10012986 3300014325 Bacteria 7608
115 Ga0163163_10040181 3300014325 Bacteria 4567
116 Ga0157379_10997209 3300014968 Bacteria 798
117 Ga0157376_10031742 3300014969 Bacteria 4234
118 Ga0157376_10132829 3300014969 Bacteria 2224
119 Ga0157376_10222714 3300014969 Bacteria 1748
120 Ga0157376_10762587 3300014969 Bacteria 977
121 Ga0206352_10464202 3300020078 Bacteria 1447
122 Ga0213872_10003622 3300021361 Bacteria 8479
123 Ga0213872_10007718 3300021361 Bacteria 5263
124 Ga0213875_10062949 3300021388 Bacteria 1734
125 Ga0224712_10253876 3300022467 Bacteria 813
126 Ga0207656_10048217 3300025321 Bacteria 1833
127 Ga0207656_10093564 3300025321 Bacteria 1368
128 Ga0207682_10033772 3300025893 Bacteria 2060
129 Ga0207688_10038338 3300025901 Bacteria 2659
130 Ga0207680_10047341 3300025903 Bacteria 2547
131 Ga0207647_10002796 3300025904 Bacteria 13162
132 Ga0207699_10003677 3300025906 Bacteria 7323
133 Ga0207699_10019551 3300025906 Bacteria 3614
134 Ga0207699_10081341 3300025906 Bacteria 2009
135 Ga0207645_10010985 3300025907 Bacteria 6195
136 Ga0207645_10025446 3300025907 Bacteria 3830
137 Ga0207643_10086858 3300025908 Bacteria 1818
138 Ga0207654_10032682 3300025911 Bacteria 2878
139 Ga0207654_10060191 3300025911 Bacteria 2218
140 Ga0207707_10067430 3300025912 Bacteria 3117
141 Ga0207707_10208428 3300025912 Bacteria 1703
142 Ga0207707_10549424 3300025912 Bacteria 981
143 Ga0207695_10004385 3300025913 Bacteria 19298
144 Ga0207695_10080033 3300025913 Bacteria 3310
145 Ga0207695_10112655 3300025913 Bacteria 2698
146 Ga0207695_10125553 3300025913 Bacteria 2529
147 Ga0207695_10269998 3300025913 Bacteria 1597
148 Ga0207671_10034124 3300025914 Bacteria 3782
149 Ga0207671_10083096 3300025914 Bacteria 2404
150 Ga0207671_10107628 3300025914 Unclassified 2118
151 Ga0207671_10284301 3300025914 Bacteria 1305
152 Ga0207671_10352026 3300025914 Bacteria 1168
153 Ga0207671_10588148 3300025914 Bacteria 887
154 Ga0207663_10149104 3300025916 Unclassified 1639
155 Ga0207657_10015485 3300025919 Bacteria 7387
156 Ga0207649_10288299 3300025920 Bacteria 1196
157 Ga0207649_10608025 3300025920 Bacteria 841
158 Ga0207694_10052823 3300025924 Bacteria 3150
159 Ga0207694_10084165 3300025924 Bacteria 2502
160 Ga0207694_10144168 3300025924 Bacteria 1916
161 Ga0207694_10154414 3300025924 Bacteria 1850
162 Ga0207694_10214783 3300025924 Bacteria 1568
163 Ga0207694_10215272 3300025924 Bacteria 1566
164 Ga0207650_10016758 3300025925 Bacteria 5124
165 Ga0207659_10078729 3300025926 Bacteria 2429
166 Ga0207687_10036290 3300025927 Bacteria 3357
167 Ga0207687_10076325 3300025927 Bacteria 2407
168 Ga0207687_10118111 3300025927 Bacteria 1979
169 Ga0207700_10001226 3300025928 Bacteria 14668
170 Ga0207700_10139397 3300025928 Bacteria 1991
171 Ga0207664_10011799 3300025929 Bacteria 6228
172 Ga0207664_10074290 3300025929 Bacteria 2746
173 Ga0207644_10100494 3300025931 Bacteria 2172
174 Ga0207644_10171388 3300025931 Bacteria 1694
175 Ga0207706_10001451 3300025933 Bacteria 23721
176 Ga0207706_10160189 3300025933 Bacteria 1978
177 Ga0207706_10410982 3300025933 Bacteria 1173
178 Ga0207686_10050486 3300025934 Bacteria 2587
179 Ga0207686_10178548 3300025934 Bacteria 1504
180 Ga0207686_10216788 3300025934 Bacteria 1379
181 Ga0207686_10648184 3300025934 Bacteria 835
182 Ga0207709_10007327 3300025935 Bacteria 6151
183 Ga0207670_10113285 3300025936 Bacteria 1959
184 Ga0207669_10404140 3300025937 Bacteria 1071
185 Ga0207704_10011415 3300025938 Bacteria 4374
186 Ga0207691_10085615 3300025940 Bacteria 2829
187 Ga0207691_10279257 3300025940 Bacteria 1437
188 Ga0207711_10140419 3300025941 Bacteria 2173
189 Ga0207711_10213908 3300025941 Bacteria 1761
190 Ga0207711_10297698 3300025941 Bacteria 1488
191 Ga0207689_10012376 3300025942 Bacteria 7298
192 Ga0207689_10027134 3300025942 Bacteria 4794
193 Ga0207661_10064665 3300025944 Bacteria 2966
194 Ga0207661_10259004 3300025944 Bacteria 1549
195 Ga0207661_10391232 3300025944 Bacteria 1259
196 Ga0207679_10505655 3300025945 Bacteria 1079
197 Ga0207679_10652181 3300025945 Bacteria 952
198 Ga0207667_10069731 3300025949 Bacteria 3659
199 Ga0207667_10216937 3300025949 Bacteria 1960
200 Ga0207651_10063606 3300025960 Bacteria 2577
201 Ga0207651_10075195 3300025960 Bacteria 2409
202 Ga0207651_10632686 3300025960 Bacteria 938
203 Ga0207668_10024846 3300025972 Bacteria 3872
204 Ga0207640_10281590 3300025981 Bacteria 1306
205 Ga0207640_10486522 3300025981 Bacteria 1025
206 Ga0207658_10062531 3300025986 Bacteria 2786
207 Ga0207658_10170308 3300025986 Bacteria 1793
208 Ga0207677_10003509 3300026023 Bacteria 8309
209 Ga0207677_10748186 3300026023 Bacteria 871
210 Ga0207703_10018422 3300026035 Bacteria 5453
211 Ga0207703_10057362 3300026035 Bacteria 3175
212 Ga0207703_10070673 3300026035 Bacteria 2881
213 Ga0207703_10202476 3300026035 Bacteria 1765
214 Ga0207639_10658317 3300026041 Bacteria 969
215 Ga0207678_10019603 3300026067 Bacteria 5946
216 Ga0207678_10413100 3300026067 Bacteria 1170
217 Ga0207708_10015634 3300026075 Bacteria 5692
218 Ga0207702_10138482 3300026078 Bacteria 2199
219 Ga0207702_10269544 3300026078 Bacteria 1605
220 Ga0207702_10271213 3300026078 Bacteria 1600
221 Ga0207641_10110496 3300026088 Bacteria 2436
222 Ga0207641_10129592 3300026088 Bacteria 2263
223 Ga0207641_10383994 3300026088 Bacteria 1346
224 Ga0207648_10043301 3300026089 Bacteria 3952
225 Ga0207648_10124061 3300026089 Bacteria 2272
226 Ga0207676_10036130 3300026095 Bacteria 3756
227 Ga0207676_10037418 3300026095 Bacteria 3698
228 Ga0207676_10043996 3300026095 Bacteria 3442
229 Ga0207676_10047138 3300026095 Bacteria 3338
230 Ga0207674_10004644 3300026116 Bacteria 16494
231 Ga0207674_10019064 3300026116 Bacteria 7435
232 Ga0207674_10510394 3300026116 Bacteria 1161
233 Ga0207674_10793946 3300026116 Bacteria 914
234 Ga0207675_100154979 3300026118 Bacteria 2183
235 Ga0207683_10001612 3300026121 Bacteria 20272
236 Ga0207683_10141624 3300026121 Bacteria 2167
237 Ga0207683_10207085 3300026121 Bacteria 1784
238 Ga0207683_10252375 3300026121 Bacteria 1610
239 Ga0207698_10034752 3300026142 Bacteria 3679
240 Ga0209998_10030782 3300027717 Bacteria 1187
241 Ga0268266_10013356 3300028379 Bacteria 7075
242 Ga0268266_10041296 3300028379 Bacteria 3935
243 Ga0268265_10363202 3300028380 Bacteria 1326
244 Ga0268264_10026849 3300028381 Bacteria 4705
245 Ga0268264_10552753 3300028381 Bacteria 1129
246 Ga0265336_10003415 3300028666 Bacteria 6228
247 Ga0265338_10071463 3300028800 Bacteria 2968
248 Ga0265330_10034669 3300031235 Bacteria 2253
249 Ga0265325_10002775 3300031241 Bacteria 11694
250 Ga0265325_10100881 3300031241 Bacteria 1413
251 Ga0265340_10066877 3300031247 Bacteria 1709
252 Ga0265340_10151968 3300031247 Bacteria 1055
253 Ga0265331_10025111 3300031250 Unclassified 3009
254 Ga0265316_10013838 3300031344 Bacteria 7144
255 Ga0265316_10023108 3300031344 Bacteria 5228
256 Ga0265316_10081710 3300031344 Bacteria 2477
257 Ga0265316_10277855 3300031344 Bacteria 1224
258 Ga0265316_10295123 3300031344 Bacteria 1182
259 Ga0307408_100095824 3300031548 Bacteria 2250
260 Ga0265313_10004076 3300031595 Bacteria 11381
261 Ga0316579_10004917 3300031691 Bacteria 5349
262 Ga0265314_10042227 3300031711 Unclassified 3256
263 Ga0307410_10301761 3300031852 Bacteria 1264
264 Ga0373929_0048103 3300035085 Bacteria 968
265 Ga0373934_0212461 3300035086 Bacteria 797
266 Ga0373923_0015030 3300035111 Bacteria 2916
267 Ga0373923_0058421 3300035111 Bacteria 1633
268 Ga0373923_0059653 3300035111 Bacteria 1618
269 Ga0373936_0016739 3300035113 Bacteria 2822
270 Ga0373953_0188594 3300035117 Bacteria 890
271 Ga0373954_0047966 3300035118 Bacteria 2000
272 Ga0373956_0042870 3300035119 Bacteria 2013
273 Ga0373943_0369820 3300035170 Bacteria 824
274 Ga0373946_0038718 3300035171 Bacteria 1944
275 Ga0373946_0152569 3300035171 Bacteria 1079
276 Ga0373955_0095376 3300035172 Bacteria 1701
277 Ga0373935_0022444 3300035692 Unclassified 3871
278 Ga0373935_0100843 3300035692 Bacteria 1903
279 Ga0373927_0004230 3300035695 Bacteria 10080
280 Ga0373927_0393643 3300035695 Unclassified 914
281 Ga0373933_0144002 3300035724 Unclassified 1506
282 Ga0373933_0227541 3300035724 Bacteria 1197
283 Ga0373947_0004753 3300035725 Bacteria 7965
284 Ga0373947_0014638 3300035725 Bacteria 4498
285 Ga0373947_0147806 3300035725 Bacteria 1512
286 Ga0373937_0010601 3300036401 Bacteria 8053
287 Ga0373937_0054490 3300036401 Bacteria 3670
288 Ga0373937_0085313 3300036401 Bacteria 2922
289 Ga0373937_0102951 3300036401 Bacteria 2651
290 Ga0373937_0285725 3300036401 Bacteria 1558
291 Ga0316582_0208260 3300036647 Bacteria 1335
292 Ga0373925_0195064 3300037068 Bacteria 1608
293 Ga0373925_0550032 3300037068 Bacteria 949
294 Ga0395900_0327004 3300037418 Bacteria 1512
295 Ga0436364_0042605 3300037853 Bacteria 11237
296 Ga0237819_03057 3300038705 Bacteria 3092
297 Ga0400489_55154 3300039093 Bacteria 26379
298 Ga0436365_0808202 3300039437 Bacteria 1158
299 Ga0436365_1049966 3300039437 Bacteria 1437
300 Ga0436360_0265147 3300039438 Bacteria 3176
301 Ga0436360_0846025 3300039438 Bacteria 4394
302 Ga0436361_0258098 3300039447 Bacteria 16112
303 Ga0436361_0261973 3300039447 Bacteria 39815
304 Ga0436361_0329054 3300039447 Bacteria 3107
305 Ga0436363_1267617 3300039450 Bacteria 2526
306 Ga0436362_0550728 3300039453 Bacteria 1316
307 Ga0451795_0059010 3300041456 Bacteria 1338
308 Ga0453683_0027119 3300044673 Bacteria 3637
309 Ga0466963_0019797 3300044694 Bacteria 4227
310 Ga0466963_0027345 3300044694 Bacteria 3652
311 Ga0466963_0116341 3300044694 Bacteria 1838
312 Ga0466971_0093882 3300044719 Bacteria 1375
313 Ga0466959_0114704 3300045049 Bacteria 1920
314 Ga0466959_0231062 3300045049 Bacteria 1280
315 Ga0466967_0055486 3300045976 Bacteria 3490
316 Ga0466967_0310544 3300045976 Bacteria 1519
317 Ga0495651_0052205 3300046462 Bacteria 3149
318 Ga0495651_0191820 3300046462 Bacteria 1437
319 Ga0495651_0377723 3300046462 Bacteria 930
320 Ga0495650_0124244 3300046471 Bacteria 947
321 Ga0495580_0002526 3300046472 Bacteria 15953
322 Ga0495580_0044352 3300046472 Bacteria 3163
323 Ga0495580_0197431 3300046472 Bacteria 1387
324 Ga0495580_0254097 3300046472 Bacteria 1203
325 Ga0495580_0373439 3300046472 Bacteria 964
326 Ga0495664_0233008 3300046477 Bacteria 1114
327 Ga0495618_0117503 3300046514 Bacteria 1703
328 Ga0495628_0186349 3300046516 Bacteria 1568
329 Ga0495630_0267176 3300046517 Bacteria 1307
330 Ga0495652_0034279 3300046529 Bacteria 4426
331 Ga0495652_0140142 3300046529 Bacteria 1902
332 Ga0495665_0111431 3300046531 Unclassified 1435
333 Ga0495587_0020563 3300046536 Bacteria 4073
334 Ga0495645_0001607 3300046543 Bacteria 15303
335 Ga0495645_0002652 3300046543 Bacteria 12164
336 Ga0495645_0042534 3300046543 Bacteria 3313
337 Ga0495667_0248391 3300046559 Bacteria 1132
338 Ga0495625_0069293 3300046660 Bacteria 2478
339 Ga0495623_0238996 3300046679 Bacteria 1027
340 Ga0495669_0091437 3300046684 Bacteria 1405
341 Ga0495669_0185389 3300046684 Bacteria 992
342 Ga0495624_0091991 3300046690 Bacteria 1871
343 Ga0495600_0051689 3300046809 Bacteria 2682
344 Ga0495581_0157623 3300047315 Bacteria 1327
345 Ga0495604_0049437 3300047317 Bacteria 3267
346 Ga0495604_0223291 3300047317 Bacteria 1296
347 Ga0495674_0326452 3300047319 Bacteria 1249
348 Ga0495674_0332813 3300047319 Unclassified 1235
349 Ga0495686_0000093 3300047472 Bacteria 188735
350 Ga0495686_0000504 3300047472 Bacteria 56825
351 Ga0495602_0079994 3300048088 Bacteria 2755
352 Ga0496100_0533957 3300048903 Bacteria 906
353 Ga0496101_0463294 3300048904 Bacteria 1000
354 Ga0496102_0051347 3300048905 Bacteria 3757
355 Ga0496104_0000049 3300048907 Bacteria 144754
356 Ga0496104_0025942 3300048907 Bacteria 5404
357 Ga0496104_0877146 3300048907 Bacteria 802
358 Ga0496105_0096678 3300048908 Bacteria 2439
359 Ga0496105_0206544 3300048908 Bacteria 1602
360 Ga0496108_0034917 3300048911 Bacteria 4178
361 Ga0496109_0076030 3300048912 Bacteria 3088
362 Ga0496110_0297261 3300048913 Bacteria 1471
363 Ga0496110_0403169 3300048913 Bacteria 1247
364 Ga0496113_0019111 3300048916 Bacteria 4788
365 Ga0496114_0209126 3300048917 Bacteria 1711
366 Ga0496114_0358084 3300048917 Bacteria 1291
367 Ga0496115_0274277 3300048918 Unclassified 1385
368 Ga0496115_0442000 3300048918 Bacteria 1051
369 Ga0496119_0189167 3300048922 Bacteria 1074
370 Ga0496125_0320964 3300048928 Bacteria 939
371 Ga0496126_0000191 3300048929 Bacteria 137108
372 Ga0496126_0002173 3300048929 Bacteria 27234
373 Ga0496126_0002701 3300048929 Bacteria 23442
374 Ga0496126_0038530 3300048929 Bacteria 4447
375 Ga0501032_0069311 3300049569 Unclassified 2353
376 Ga0501033_0016593 3300049570 Bacteria 5571
377 Ga0501036_0002031 3300049572 Bacteria 15758
378 Ga0501038_0011293 3300049574 Bacteria 8153
379 Ga0501039_0042468 3300049575 Bacteria 3513
380 Ga0501042_0187259 3300049578 Bacteria 1493
381 Ga0501043_0016535 3300049579 Bacteria 5782
382 Ga0501046_0102147 3300049580 Bacteria 2198
383 Ga0501047_0021769 3300049581 Bacteria 6155
384 Ga0501068_0104249 3300049584 Bacteria 1759
385 Ga0501069_0011460 3300049585 Bacteria 4696
386 Ga0501070_0249344 3300049586 Bacteria 1452
387 Ga0501071_0019377 3300049587 Bacteria 4721
388 Ga0501072_0001174 3300049588 Bacteria 19494
389 Ga0501074_0047612 3300049590 Bacteria 3098
390 Ga0501075_0193363 3300049591 Bacteria 1552
391 Ga0501076_0034295 3300049592 Bacteria 3966
392 Ga0501077_0071716 3300049593 Unclassified 2195
393 Ga0501249_003147 3300049679 Bacteria 3318
394 Ga0501079_0005062 3300049741 Bacteria 9785
395 Ga0501080_0000033 3300049742 Bacteria 85171
396 nmdc:mga05p37_1009872_c1 3300050507 Bacteria 882
397 nmdc:mga05p37_278653_c1 3300050507 Bacteria 1995
398 nmdc:mga05p37_724953_c1 3300050507 Bacteria 1100
399 nmdc:mga08y16_314167_c1 3300050511 Bacteria 1614
400 nmdc:mga0n895_145566_c1 3300050512 Bacteria 2399
401 nmdc:mga0n895_437857_c1 3300050512 Bacteria 1321
402 nmdc:mga0n895_649260_c1 3300050512 Bacteria 1054
403 nmdc:mga0rr50_265217_c1 3300050513 Bacteria 1430
404 nmdc:mga08x19_4057_c1 3300050514 Bacteria 8696
405 nmdc:mga0a205_96995_c1 3300050515 Bacteria 2847
406 Ga0495601_0082775 3300053077 Bacteria 2060
407 Ga0495601_0099092 3300053077 Bacteria 1881
408 Ga0495601_0248632 3300053077 Bacteria 1161
409 Ga0495619_0439308 3300053085 Bacteria 900
410 Ga0501084_0000776 3300054114 Bacteria 24296
411 Ga0501082_0060828 3300060353 Bacteria 3251
412 2617912390 2617270889 Bacteria 9064343
413 2831428659 2831426010 Bacteria 8662725
414 2848701281 2848694841 Bacteria 9205737
415 2849660966 2849660919 Bacteria 8251853
416 2886633125 2886627955 Bacteria 7618130
417 2913850374 2913844669 Bacteria 8381711
418 2913917926 2913912277 Bacteria 9037797
419 2913942786 2913939268 Bacteria 8559644
420 642604571 642555144 Bacteria 9059191
421 Ga0501037_0000923
422 Ga0070683_100043798
423 Ga0070683_100235072
424 Ga0070683_100435848
425 Ga0070683_100458299
426 Ga0070690_100018412
427 Ga0068869_100120403
428 Ga0068869_100299474
429 Ga0070666_10003684
430 Ga0070666_10081225
431 Ga0070680_100624679
432 Ga0068868_100262978
433 Ga0070660_100009652
434 Ga0070661_100124418
435 Ga0070671_100151522
436 Ga0070673_100021284
437 Ga0070688_100335635
438 Ga0070659_100284088
439 Ga0070709_10075408
440 Ga0070709_10175267
441 Ga0070714_100025436
442 Ga0070714_100051237
443 Ga0070713_100001456
444 Ga0070711_100012164
445 Ga0070662_100105614
446 Ga0070662_100442333
447 Ga0070681_10220982
448 Ga0070681_10836513
449 Ga0070699_100007973
450 Ga0070679_100247854
451 Ga0070684_100054209
452 Ga0068853_100459938
453 Ga0070696_100009856
454 Ga0070693_100116200
455 Ga0070665_100028882
456 Ga0070665_100030926
457 Ga0068855_100052841
458 Ga0068857_100021654
459 Ga0068857_100034775
460 Ga0068854_100526125
461 Ga0068856_100027794
462 Ga0068856_100081402
463 Ga0068856_100448760
464 Ga0068852_100046535
465 Ga0068859_100121318
466 Ga0068864_100008459
467 Ga0068864_100020847
468 Ga0068851_10060980
469 Ga0068863_100176011
470 Ga0068858_100010084
471 Ga0068858_100046664
472 Ga0068860_100035770
473 Ga0068862_100305562
474 Ga0081540_1043907
475 Ga0070717_10011363
476 Ga0075363_100048155
477 Ga0070712_100622969
478 Ga0068871_100062555
479 Ga0068871_100915036
480 Ga0075428_100091962
481 Ga0075434_100116545
482 Ga0075434_100487593
483 Ga0068865_100702175
484 Ga0075436_100002958
485 Ga0075436_100480286
486 Ga0097620_100121315
487 Ga0075435_100036445
488 Ga0075435_100098371
489 Ga0105240_10002876
490 Ga0105240_10002966
491 Ga0105240_10114457
492 Ga0105240_10149826
493 Ga0105240_10423657
494 Ga0105240_10536621
495 Ga0111539_10004457
496 Ga0105245_10064059
497 Ga0114129_10162015
498 Ga0114129_10802012
499 Ga0114129_11006977
500 Ga0105242_10064102
501 Ga0105242_10311185
502 Ga0105242_10821356
503 Ga0105242_10875209
504 Ga0105248_10085833
505 Ga0105248_10093758
506 Ga0105237_10006850
507 Ga0105237_10082001
508 Ga0105237_10311723
509 Ga0105237_10333081
510 Ga0105238_10027956
511 Ga0105238_10079993
512 Ga0105238_10157315
513 Ga0105238_10398651
514 Ga0105238_10503264
515 Ga0105239_10056792
516 Ga0105239_10072470
517 Ga0105239_10876366
518 Ga0105239_10939701
519 Ga0157373_10128774
520 Ga0157370_10169086
521 Ga0157370_10269604
522 Ga0157369_10071585
523 Ga0157369_10219886
524 Ga0157369_10307899
525 Ga0157374_10078967
526 Ga0157374_10168745
527 Ga0157374_10242838
528 Ga0157378_10033612
529 Ga0157372_10143839
530 Ga0157372_10168141
531 Ga0157372_10605560
532 Ga0163163_10011962
533 Ga0163163_10012585
534 Ga0163163_10012986
535 Ga0163163_10040181
536 Ga0157379_10997209
537 Ga0157376_10031742
538 Ga0157376_10132829
539 Ga0157376_10222714
540 Ga0157376_10762587
541 Ga0206352_10464202
542 Ga0213872_10003622
543 Ga0213872_10007718
544 Ga0213875_10062949
545 Ga0224712_10253876
546 Ga0207656_10048217
547 Ga0207656_10093564
548 Ga0207682_10033772
549 Ga0207688_10038338
550 Ga0207680_10047341
551 Ga0207647_10002796
552 Ga0207699_10003677
553 Ga0207699_10019551
554 Ga0207699_10081341
555 Ga0207645_10010985
556 Ga0207645_10025446
557 Ga0207643_10086858
558 Ga0207654_10032682
559 Ga0207654_10060191
560 Ga0207707_10067430
561 Ga0207707_10208428
562 Ga0207707_10549424
563 Ga0207695_10004385
564 Ga0207695_10080033
565 Ga0207695_10112655
566 Ga0207695_10125553
567 Ga0207695_10269998
568 Ga0207671_10034124
569 Ga0207671_10083096
570 Ga0207671_10107628
571 Ga0207671_10284301
572 Ga0207671_10352026
573 Ga0207671_10588148
574 Ga0207663_10149104
575 Ga0207657_10015485
576 Ga0207649_10288299
577 Ga0207649_10608025
578 Ga0207694_10052823
579 Ga0207694_10084165
580 Ga0207694_10144168
581 Ga0207694_10154414
582 Ga0207694_10214783
583 Ga0207694_10215272
584 Ga0207650_10016758
585 Ga0207659_10078729
586 Ga0207687_10036290
587 Ga0207687_10076325
588 Ga0207687_10118111
589 Ga0207700_10001226
590 Ga0207700_10139397
591 Ga0207664_10011799
592 Ga0207664_10074290
593 Ga0207644_10100494
594 Ga0207644_10171388
595 Ga0207706_10001451
596 Ga0207706_10160189
597 Ga0207706_10410982
598 Ga0207686_10050486
599 Ga0207686_10178548
600 Ga0207686_10216788
601 Ga0207686_10648184
602 Ga0207709_10007327
603 Ga0207670_10113285
604 Ga0207669_10404140
605 Ga0207704_10011415
606 Ga0207691_10085615
607 Ga0207691_10279257
608 Ga0207711_10140419
609 Ga0207711_10213908
610 Ga0207711_10297698
611 Ga0207689_10012376
612 Ga0207689_10027134
613 Ga0207661_10064665
614 Ga0207661_10259004
615 Ga0207661_10391232
616 Ga0207679_10505655
617 Ga0207679_10652181
618 Ga0207667_10069731
619 Ga0207667_10216937
620 Ga0207651_10063606
621 Ga0207651_10075195
622 Ga0207651_10632686
623 Ga0207668_10024846
624 Ga0207640_10281590
625 Ga0207640_10486522
626 Ga0207658_10062531
627 Ga0207658_10170308
628 Ga0207677_10003509
629 Ga0207677_10748186
630 Ga0207703_10018422
631 Ga0207703_10057362
632 Ga0207703_10070673
633 Ga0207703_10202476
634 Ga0207639_10658317
635 Ga0207678_10019603
636 Ga0207678_10413100
637 Ga0207708_10015634
638 Ga0207702_10138482
639 Ga0207702_10269544
640 Ga0207702_10271213
641 Ga0207641_10110496
642 Ga0207641_10129592
643 Ga0207641_10383994
644 Ga0207648_10043301
645 Ga0207648_10124061
646 Ga0207676_10036130
647 Ga0207676_10037418
648 Ga0207676_10043996
649 Ga0207676_10047138
650 Ga0207674_10004644
651 Ga0207674_10019064
652 Ga0207674_10510394
653 Ga0207674_10793946
654 Ga0207675_100154979
655 Ga0207683_10001612
656 Ga0207683_10141624
657 Ga0207683_10207085
658 Ga0207683_10252375
659 Ga0207698_10034752
660 Ga0209998_10030782
661 Ga0268266_10013356
662 Ga0268266_10041296
663 Ga0268265_10363202
664 Ga0268264_10026849
665 Ga0268264_10552753
666 Ga0265336_10003415
667 Ga0265338_10071463
668 Ga0265330_10034669
669 Ga0265325_10002775
670 Ga0265325_10100881
671 Ga0265340_10066877
672 Ga0265340_10151968
673 Ga0265331_10025111
674 Ga0265316_10013838
675 Ga0265316_10023108
676 Ga0265316_10081710
677 Ga0265316_10277855
678 Ga0265316_10295123
679 Ga0307408_100095824
680 Ga0265313_10004076
681 Ga0316579_10004917
682 Ga0265314_10042227
683 Ga0307410_10301761
684 Ga0373929_0048103
685 Ga0373934_0212461
686 Ga0373923_0015030
687 Ga0373923_0058421
688 Ga0373923_0059653
689 Ga0373936_0016739
690 Ga0373953_0188594
691 Ga0373954_0047966
692 Ga0373956_0042870
693 Ga0373943_0369820
694 Ga0373946_0038718
695 Ga0373946_0152569
696 Ga0373955_0095376
697 Ga0373935_0022444
698 Ga0373935_0100843
699 Ga0373927_0004230
700 Ga0373927_0393643
701 Ga0373933_0144002
702 Ga0373933_0227541
703 Ga0373947_0004753
704 Ga0373947_0014638
705 Ga0373947_0147806
706 Ga0373937_0010601
707 Ga0373937_0054490
708 Ga0373937_0085313
709 Ga0373937_0102951
710 Ga0373937_0285725
711 Ga0316582_0208260
712 Ga0373925_0195064
713 Ga0373925_0550032
714 Ga0395900_0327004
715 Ga0436364_0042605
716 Ga0237819_03057
717 Ga0400489_55154
718 Ga0436365_0808202
719 Ga0436365_1049966
720 Ga0436360_0265147
721 Ga0436360_0846025
722 Ga0436361_0258098
723 Ga0436361_0261973
724 Ga0436361_0329054
725 Ga0436363_1267617
726 Ga0436362_0550728
727 Ga0451795_0059010
728 Ga0453683_0027119
729 Ga0466963_0019797
730 Ga0466963_0027345
731 Ga0466963_0116341
732 Ga0466971_0093882
733 Ga0466959_0114704
734 Ga0466959_0231062
735 Ga0466967_0055486
736 Ga0466967_0310544
737 Ga0495651_0052205
738 Ga0495651_0191820
739 Ga0495651_0377723
740 Ga0495650_0124244
741 Ga0495580_0002526
742 Ga0495580_0044352
743 Ga0495580_0197431
744 Ga0495580_0254097
745 Ga0495580_0373439
746 Ga0495664_0233008
747 Ga0495618_0117503
748 Ga0495628_0186349
749 Ga0495630_0267176
750 Ga0495652_0034279
751 Ga0495652_0140142
752 Ga0495665_0111431
753 Ga0495587_0020563
754 Ga0495645_0001607
755 Ga0495645_0002652
756 Ga0495645_0042534
757 Ga0495667_0248391
758 Ga0495625_0069293
759 Ga0495623_0238996
760 Ga0495669_0091437
761 Ga0495669_0185389
762 Ga0495624_0091991
763 Ga0495600_0051689
764 Ga0495581_0157623
765 Ga0495604_0049437
766 Ga0495604_0223291
767 Ga0495674_0326452
768 Ga0495674_0332813
769 Ga0495686_0000093
770 Ga0495686_0000504
771 Ga0495602_0079994
772 Ga0496100_0533957
773 Ga0496101_0463294
774 Ga0496102_0051347
775 Ga0496104_0000049
776 Ga0496104_0025942
777 Ga0496104_0877146
778 Ga0496105_0096678
779 Ga0496105_0206544
780 Ga0496108_0034917
781 Ga0496109_0076030
782 Ga0496110_0297261
783 Ga0496110_0403169
784 Ga0496113_0019111
785 Ga0496114_0209126
786 Ga0496114_0358084
787 Ga0496115_0274277
788 Ga0496115_0442000
789 Ga0496119_0189167
790 Ga0496125_0320964
791 Ga0496126_0000191
792 Ga0496126_0002173
793 Ga0496126_0002701
794 Ga0496126_0038530
795 Ga0501032_0069311
796 Ga0501033_0016593
797 Ga0501036_0002031
798 Ga0501038_0011293
799 Ga0501039_0042468
800 Ga0501042_0187259
801 Ga0501043_0016535
802 Ga0501046_0102147
803 Ga0501047_0021769
804 Ga0501068_0104249
805 Ga0501069_0011460
806 Ga0501070_0249344
807 Ga0501071_0019377
808 Ga0501072_0001174
809 Ga0501074_0047612
810 Ga0501075_0193363
811 Ga0501076_0034295
812 Ga0501077_0071716
813 Ga0501249_003147
814 Ga0501079_0005062
815 Ga0501080_0000033
816 nmdc:mga05p37_1009872_c1
817 nmdc:mga05p37_278653_c1
818 nmdc:mga05p37_724953_c1
819 nmdc:mga08y16_314167_c1
820 nmdc:mga0n895_145566_c1
821 nmdc:mga0n895_437857_c1
822 nmdc:mga0n895_649260_c1
823 nmdc:mga0rr50_265217_c1
824 nmdc:mga08x19_4057_c1
825 nmdc:mga0a205_96995_c1
826 Ga0495601_0082775
827 Ga0495601_0099092
828 Ga0495601_0248632
829 Ga0495619_0439308
830 Ga0501084_0000776
831 Ga0501082_0060828
832 2617912390
833 2831428659
834 2848701281
835 2849660966
836 2886633125
837 2913850374
838 2913917926
839 2913942786
840 642604571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01709

Transcrip_reg

TACO1/YebC second and third domain

133

288

0.97

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

57

127

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8808 4 242
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8562 4 242
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8559 7 240
4f3q-assembly1.cif.gz_A structure of a yebc family protein (cbu_1566) from coxiella burnetii 0.8404 6 242
4f3q-assembly1.cif.gz_A structure of a yebc family protein (cbu_1566) from coxiella burnetii 0.8305 6 242
ID Description Score Start End Superfamily
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9802 25 74 1.10.10.200
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9775 83 240 3.30.70.980
1lfpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9151 18 79 1.10.10.200
1mw7A03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9035 136 203 3.30.70.980
1mw7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9032 83 238 3.30.70.980
ID Description Score Start End GO Terms
AF-K1UEW2-F1-model_v4 Protein containing DUF28 0.972 83 238 GO:0005829
AF-A0A1F4Q977-F1-model_v4 TACO1/YebC-like second and third domain-containing protein 0.9718 81 249 GO:0005829
AF-A0A2M6R9V3-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9663 85 240 GO:0003677
GO:0005829
AF-A0A3B9L7U6-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9652 61 240 GO:0003677
GO:0005829
AF-A0A3M1HJ34-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.965 107 249 GO:0003677
GO:0005829

Map