F439779

General Info

Members Datasets Scaffolds Average Seq Length
420 226 840 166

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0009571|Ga0373935_0009571_2094_2657
Length 187
Sequence MGGDRANSWLEPAFIGPHKEIKKMSEPFIAEIKIISWNFPPKGWTFCNGQLLPINQNQALFSILGTTYGGDGRTTFGLPNLQGRMPVHVGNGIVLGELGGETAHTLNISELPAHAHTPRANHTAPTLSVAAGNVWADNPSQYNSTSNTAMSPTCIAATGGNQPHENMSPYLVLNFIIALQGIFPSQN

Samples

Sample ID Description Type Environment
1 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
2 3300001426 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
75 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
76 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
94 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.19
Metatranscriptomes 8.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.52
Rhizosphere 93.57
Stem 0
Stem Tuber 0
Unclassified 5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373935_0009571 3300035692 Bacteria 5801
2 JGI24030J14995_100774 3300001426 Bacteria 1073
3 JGI24748J21848_1000038 3300002074 Bacteria 69882
4 JGI24034J26672_10000041 3300002239 Bacteria 69886
5 JGI25406J46586_10017123 3300003203 Bacteria 3003
6 JGI25406J46586_10049873 3300003203 Bacteria 1409
7 rootH1_10131938 3300003316 Bacteria 1275
8 rootL2_10286159 3300003322 Bacteria 1939
9 Ga0058863_10009159 3300004799 Bacteria 2870
10 Ga0058863_10014517 3300004799 Bacteria 1910
11 Ga0058863_11888212 3300004799 Bacteria 1386
12 Ga0058861_10042818 3300004800 Bacteria 2267
13 Ga0058861_11607165 3300004800 Bacteria 1057
14 Ga0058862_10106663 3300004803 Bacteria 1665
15 Ga0058862_10114140 3300004803 Bacteria 1814
16 Ga0058862_10130740 3300004803 Bacteria 1331
17 Ga0058862_12485591 3300004803 Bacteria 1651
18 Ga0058862_12787001 3300004803 Bacteria 3034
19 Ga0070658_10088529 3300005327 Bacteria 2549
20 Ga0070683_100038919 3300005329 Bacteria 4362
21 Ga0070683_100938186 3300005329 Bacteria 830
22 Ga0070670_100829687 3300005331 Bacteria 836
23 Ga0070680_100013475 3300005336 Bacteria 6368
24 Ga0070680_100672798 3300005336 Bacteria 890
25 Ga0070682_100501785 3300005337 Bacteria 940
26 Ga0068868_100161512 3300005338 Bacteria 1850
27 Ga0068868_101001430 3300005338 Unclassified 764
28 Ga0070689_100965517 3300005340 Bacteria 757
29 Ga0070661_100138957 3300005344 Bacteria 1830
30 Ga0070692_10111401 3300005345 Bacteria 1514
31 Ga0070669_100495666 3300005353 Viruses 1013
32 Ga0070675_100145194 3300005354 Bacteria 2031
33 Ga0070671_100023908 3300005355 Bacteria 5000
34 Ga0070673_100543280 3300005364 Bacteria 1055
35 Ga0070709_10018088 3300005434 Bacteria 4052
36 Ga0070714_100027525 3300005435 Bacteria 4708
37 Ga0070714_100039174 3300005435 Bacteria 3988
38 Ga0070714_100053321 3300005435 Bacteria 3451
39 Ga0070714_100061879 3300005435 Bacteria 3216
40 Ga0070714_100348473 3300005435 Bacteria 1390
41 Ga0070714_100575576 3300005435 Bacteria 1080
42 Ga0070714_100590714 3300005435 Bacteria 1066
43 Ga0070714_101249931 3300005435 Bacteria 725
44 Ga0070713_100036604 3300005436 Bacteria 3961
45 Ga0070713_100051515 3300005436 Bacteria 3404
46 Ga0070713_100110295 3300005436 Bacteria 2398
47 Ga0070713_100192056 3300005436 Bacteria 1840
48 Ga0070713_100390886 3300005436 Bacteria 1297
49 Ga0070713_101143076 3300005436 Bacteria 753
50 Ga0070710_10064779 3300005437 Bacteria 2091
51 Ga0070711_100179662 3300005439 Bacteria 1619
52 Ga0070711_100512373 3300005439 Bacteria 990
53 Ga0070711_100518807 3300005439 Bacteria 984
54 Ga0070662_101099685 3300005457 Unclassified 682
55 Ga0070681_10018975 3300005458 Bacteria 6883
56 Ga0070681_10097841 3300005458 Bacteria 2881
57 Ga0070681_10113224 3300005458 Bacteria 2652
58 Ga0070681_10154542 3300005458 Bacteria 2220
59 Ga0070681_10294776 3300005458 Bacteria 1532
60 Ga0070681_10960458 3300005458 Bacteria 774
61 Ga0070681_11869709 3300005458 Bacteria 528
62 Ga0070685_10081036 3300005466 Bacteria 1946
63 Ga0070707_100037936 3300005468 Bacteria 4601
64 Ga0070707_100067922 3300005468 Bacteria 3430
65 Ga0070698_100207864 3300005471 Bacteria 1893
66 Ga0070698_100214030 3300005471 Bacteria 1861
67 Ga0070699_100656824 3300005518 Bacteria 957
68 Ga0070699_101589940 3300005518 Bacteria 599
69 Ga0070679_100012341 3300005530 Bacteria 8161
70 Ga0070679_100365368 3300005530 Bacteria 1390
71 Ga0070679_100538586 3300005530 Unclassified 1111
72 Ga0070679_101127983 3300005530 Bacteria 729
73 Ga0070684_100137573 3300005535 Bacteria 2207
74 Ga0070684_100143749 3300005535 Bacteria 2159
75 Ga0070684_100461193 3300005535 Bacteria 1175
76 Ga0070697_100039041 3300005536 Bacteria 3838
77 Ga0070697_100170735 3300005536 Viruses 1841
78 Ga0070697_100174919 3300005536 Bacteria 1818
79 Ga0070697_100382450 3300005536 Bacteria 1219
80 Ga0068853_100015315 3300005539 Bacteria 6301
81 Ga0068853_100147038 3300005539 Bacteria 2119
82 Ga0068853_100198681 3300005539 Bacteria 1824
83 Ga0070695_100229163 3300005545 Viruses 1342
84 Ga0070695_101071650 3300005545 Bacteria 658
85 Ga0070693_100016289 3300005547 Bacteria 3845
86 Ga0068855_100075091 3300005563 Bacteria 3925
87 Ga0068855_100110933 3300005563 Bacteria 3149
88 Ga0068857_100180893 3300005577 Bacteria 1919
89 Ga0068854_100224777 3300005578 Bacteria 1487
90 Ga0068854_100487129 3300005578 Bacteria 1036
91 Ga0068856_100088364 3300005614 Unclassified 3081
92 Ga0068856_100392218 3300005614 Bacteria 1408
93 Ga0068852_100053723 3300005616 Bacteria 3469
94 Ga0068852_100070707 3300005616 Bacteria 3062
95 Ga0068859_100121710 3300005617 Bacteria 2676
96 Ga0068859_100271510 3300005617 Bacteria 1788
97 Ga0068864_100097166 3300005618 Bacteria 2607
98 Ga0068864_100426477 3300005618 Bacteria 1264
99 Ga0068866_10126493 3300005718 Unclassified 1447
100 Ga0068861_100028043 3300005719 Viruses 4106
101 Ga0068861_100920001 3300005719 Bacteria 830
102 Ga0068863_100391089 3300005841 Bacteria 1359
103 Ga0068863_101403663 3300005841 Bacteria 706
104 Ga0068858_100000443 3300005842 Bacteria 43345
105 Ga0068858_100130665 3300005842 Bacteria 2354
106 Ga0068860_100362691 3300005843 Bacteria 1428
107 Ga0068860_101420879 3300005843 Bacteria 715
108 Ga0081539_10008539 3300005985 Bacteria 8872
109 Ga0081539_10059063 3300005985 Bacteria 2113
110 Ga0070717_10187793 3300006028 Bacteria 1804
111 Ga0070717_10195576 3300006028 Bacteria 1769
112 Ga0070717_10323943 3300006028 Bacteria 1373
113 Ga0070717_10335333 3300006028 Bacteria 1350
114 Ga0070717_10519860 3300006028 Bacteria 1077
115 Ga0070717_10664244 3300006028 Unclassified 946
116 Ga0070715_10156900 3300006163 Bacteria 1121
117 Ga0070716_100000020 3300006173 Bacteria 79851
118 Ga0070716_100060387 3300006173 Bacteria 2189
119 Ga0070716_100097115 3300006173 Bacteria 1797
120 Ga0070716_100137428 3300006173 Bacteria 1553
121 Ga0070716_100272237 3300006173 Bacteria 1164
122 Ga0070712_100118577 3300006175 Bacteria 1988
123 Ga0097621_100390981 3300006237 Bacteria 1244
124 Ga0097621_101425337 3300006237 Bacteria 656
125 Ga0075434_100530352 3300006871 Bacteria 1198
126 Ga0075429_100344934 3300006880 Bacteria 1304
127 Ga0075436_100161103 3300006914 Bacteria 1582
128 Ga0097620_100121715 3300006931 Bacteria 2676
129 Ga0097620_100271497 3300006931 Bacteria 1788
130 Ga0099794_10208396 3300007265 Bacteria 1002
131 Ga0105240_10021475 3300009093 Bacteria 8585
132 Ga0105240_10063602 3300009093 Bacteria 4589
133 Ga0105240_10290809 3300009093 Bacteria 1873
134 Ga0105240_10452608 3300009093 Viruses 1436
135 Ga0105245_10055620 3300009098 Bacteria 3555
136 Ga0105245_10059086 3300009098 Bacteria 3452
137 Ga0105245_10078279 3300009098 Unclassified 3017
138 Ga0105245_10229668 3300009098 Bacteria 1794
139 Ga0105245_10790276 3300009098 Bacteria 987
140 Ga0105247_10000142 3300009101 Bacteria 69945
141 Ga0105247_10027397 3300009101 Bacteria 3446
142 Ga0114129_10017606 3300009147 Bacteria 10171
143 Ga0114129_10453026 3300009147 Bacteria 1682
144 Ga0114129_10723077 3300009147 Bacteria 1277
145 Ga0114129_11902271 3300009147 Bacteria 721
146 Ga0105243_10041102 3300009148 Bacteria 3616
147 Ga0105241_10042300 3300009174 Viruses 3446
148 Ga0105241_10440412 3300009174 Bacteria 1151
149 Ga0105242_10077459 3300009176 Bacteria 2774
150 Ga0105237_10122735 3300009545 Bacteria 2592
151 Ga0105237_10367559 3300009545 Bacteria 1443
152 Ga0105237_10850395 3300009545 Bacteria 919
153 Ga0105238_10054798 3300009551 Bacteria 4003
154 Ga0105238_10059886 3300009551 Bacteria 3814
155 Ga0105238_10124492 3300009551 Viruses 2557
156 Ga0105238_10131900 3300009551 Bacteria 2477
157 Ga0105238_10138702 3300009551 Bacteria 2409
158 Ga0105249_10204490 3300009553 Unclassified 1934
159 Ga0130087_1080617 3300009828 Bacteria 1223
160 Ga0130084_1086005 3300009835 Bacteria 1223
161 Ga0130085_1110429 3300009850 Bacteria 1223
162 Ga0105239_10142773 3300010375 Bacteria 2669
163 Ga0105239_10158746 3300010375 Bacteria 2526
164 Ga0105239_10203623 3300010375 Bacteria 2217
165 Ga0105239_10212584 3300010375 Bacteria 2168
166 Ga0105239_10794017 3300010375 Bacteria 1084
167 Ga0105246_10146409 3300011119 Bacteria 1783
168 Ga0105246_10547078 3300011119 Bacteria 991
169 Ga0157373_10211005 3300013100 Bacteria 1369
170 Ga0157371_10083293 3300013102 Bacteria 2265
171 Ga0157370_11274075 3300013104 Bacteria 662
172 Ga0157369_10083856 3300013105 Bacteria 3407
173 Ga0157369_10141790 3300013105 Bacteria 2543
174 Ga0157369_10469505 3300013105 Bacteria 1303
175 Ga0157369_10523041 3300013105 Unclassified 1227
176 Ga0157369_10910286 3300013105 Bacteria 902
177 Ga0157374_10000057 3300013296 Bacteria 117036
178 Ga0157374_10091147 3300013296 Bacteria 2906
179 Ga0157374_10130340 3300013296 Bacteria 2433
180 Ga0157374_10855991 3300013296 Bacteria 926
181 Ga0157374_11403319 3300013296 Bacteria 721
182 Ga0157378_10009411 3300013297 Bacteria 8512
183 Ga0157378_10042091 3300013297 Bacteria 4053
184 Ga0157378_10070160 3300013297 Bacteria 3145
185 Ga0157378_10257656 3300013297 Viruses 1672
186 Ga0163162_10022461 3300013306 Bacteria 6215
187 Ga0157372_10128180 3300013307 Bacteria 2918
188 Ga0157372_10748581 3300013307 Bacteria 1136
189 Ga0157372_10833420 3300013307 Unclassified 1071
190 Ga0157375_10413114 3300013308 Bacteria 1516
191 Ga0163163_10554391 3300014325 Bacteria 1212
192 Ga0163163_11719288 3300014325 Bacteria 688
193 Ga0157379_10010007 3300014968 Bacteria 8262
194 Ga0157376_10000581 3300014969 Bacteria 23586
195 Ga0163161_10407681 3300017792 Viruses 1091
196 Ga0206349_1402693 3300020075 Bacteria 1659
197 Ga0206349_1442471 3300020075 Bacteria 641
198 Ga0206355_1626827 3300020076 Bacteria 775
199 Ga0206351_10745108 3300020077 Bacteria 1815
200 Ga0206352_10867125 3300020078 Bacteria 1649
201 Ga0206350_11091030 3300020080 Bacteria 1379
202 Ga0206350_11545301 3300020080 Bacteria 1711
203 Ga0206353_10287839 3300020082 Bacteria 1105
204 Ga0206353_11977533 3300020082 Bacteria 1308
205 Ga0154015_1206444 3300020610 Bacteria 2254
206 Ga0213876_10000935 3300021384 Bacteria 19266
207 Ga0224712_10015526 3300022467 Bacteria 2480
208 Ga0207672_1000598 3300025223 Bacteria 4312
209 Ga0207692_10042396 3300025898 Bacteria 2258
210 Ga0207692_10202146 3300025898 Bacteria 1169
211 Ga0207642_10484864 3300025899 Bacteria 755
212 Ga0207710_10000001 3300025900 Bacteria 1797433
213 Ga0207688_10710067 3300025901 Unclassified 636
214 Ga0207699_10609297 3300025906 Bacteria 795
215 Ga0207699_10619660 3300025906 Bacteria 789
216 Ga0207645_10543469 3300025907 Bacteria 788
217 Ga0207705_10056642 3300025909 Bacteria 2827
218 Ga0207654_10018445 3300025911 Unclassified 3662
219 Ga0207707_10053555 3300025912 Bacteria 3512
220 Ga0207707_10070523 3300025912 Bacteria 3045
221 Ga0207707_10245798 3300025912 Bacteria 1555
222 Ga0207707_10251354 3300025912 Bacteria 1536
223 Ga0207707_10386455 3300025912 Bacteria 1203
224 Ga0207695_10046391 3300025913 Bacteria 4606
225 Ga0207695_10304135 3300025913 Bacteria 1486
226 Ga0207695_10474643 3300025913 Bacteria 1133
227 Ga0207695_10652926 3300025913 Viruses 933
228 Ga0207671_10230097 3300025914 Bacteria 1454
229 Ga0207693_10044388 3300025915 Bacteria 3494
230 Ga0207693_10052290 3300025915 Bacteria 3204
231 Ga0207693_10284243 3300025915 Bacteria 1296
232 Ga0207693_10388031 3300025915 Bacteria 1092
233 Ga0207663_10045613 3300025916 Bacteria 2697
234 Ga0207663_10977959 3300025916 Unclassified 678
235 Ga0207660_10039376 3300025917 Bacteria 3304
236 Ga0207660_10364456 3300025917 Bacteria 1160
237 Ga0207652_10040248 3300025921 Bacteria 3968
238 Ga0207652_10084114 3300025921 Bacteria 2787
239 Ga0207652_10219572 3300025921 Bacteria 1713
240 Ga0207652_10537311 3300025921 Bacteria 1051
241 Ga0207646_10244209 3300025922 Bacteria 1622
242 Ga0207681_10394272 3300025923 Viruses 1117
243 Ga0207694_10010839 3300025924 Bacteria 6881
244 Ga0207694_10194066 3300025924 Bacteria 1650
245 Ga0207694_10313566 3300025924 Bacteria 1293
246 Ga0207694_10418342 3300025924 Bacteria 1116
247 Ga0207694_10718021 3300025924 Bacteria 843
248 Ga0207687_10033159 3300025927 Bacteria 3501
249 Ga0207687_10061902 3300025927 Bacteria 2644
250 Ga0207700_10024041 3300025928 Bacteria 4212
251 Ga0207700_10181528 3300025928 Bacteria 1762
252 Ga0207700_10281318 3300025928 Bacteria 1431
253 Ga0207700_10282678 3300025928 Bacteria 1428
254 Ga0207700_10330193 3300025928 Bacteria 1324
255 Ga0207664_10009227 3300025929 Bacteria 6911
256 Ga0207664_10050398 3300025929 Bacteria 3283
257 Ga0207664_10214233 3300025929 Unclassified 1668
258 Ga0207664_10390372 3300025929 Bacteria 1237
259 Ga0207664_10419437 3300025929 Bacteria 1192
260 Ga0207664_10437088 3300025929 Bacteria 1167
261 Ga0207664_10612113 3300025929 Bacteria 978
262 Ga0207644_10002643 3300025931 Bacteria 11538
263 Ga0207686_10114083 3300025934 Bacteria 1828
264 Ga0207709_10043185 3300025935 Bacteria 2716
265 Ga0207665_10000045 3300025939 Bacteria 79809
266 Ga0207665_10004993 3300025939 Bacteria 8853
267 Ga0207665_10133736 3300025939 Bacteria 1763
268 Ga0207665_10175068 3300025939 Bacteria 1551
269 Ga0207665_10182802 3300025939 Bacteria 1519
270 Ga0207689_11031144 3300025942 Unclassified 694
271 Ga0207661_10076723 3300025944 Bacteria 2745
272 Ga0207661_10263634 3300025944 Bacteria 1536
273 Ga0207661_10277585 3300025944 Bacteria 1497
274 Ga0207661_10293168 3300025944 Bacteria 1456
275 Ga0207667_10017037 3300025949 Bacteria 8197
276 Ga0207667_10089435 3300025949 Bacteria 3183
277 Ga0207651_10234911 3300025960 Bacteria 1491
278 Ga0207640_10293547 3300025981 Bacteria 1283
279 Ga0207677_10147573 3300026023 Bacteria 1810
280 Ga0207703_10000818 3300026035 Bacteria 30635
281 Ga0207703_10628617 3300026035 Bacteria 1017
282 Ga0207639_10006234 3300026041 Bacteria 8103
283 Ga0207639_10145553 3300026041 Bacteria 1979
284 Ga0207639_10204415 3300026041 Bacteria 1696
285 Ga0207639_10269866 3300026041 Bacteria 1492
286 Ga0207702_10019229 3300026078 Bacteria 5650
287 Ga0207641_10117211 3300026088 Bacteria 2371
288 Ga0207676_10008732 3300026095 Bacteria 7207
289 Ga0207676_11046568 3300026095 Bacteria 805
290 Ga0207676_11137768 3300026095 Viruses 772
291 Ga0207674_10016690 3300026116 Bacteria 8025
292 Ga0207674_10505484 3300026116 Bacteria 1167
293 Ga0207675_100010289 3300026118 Bacteria 8763
294 Ga0207698_10061432 3300026142 Bacteria 2928
295 Ga0207698_10296865 3300026142 Bacteria 1502
296 Ga0209588_1026432 3300027671 Bacteria 1843
297 Ga0268264_11234707 3300028381 Bacteria 757
298 Ga0265320_10108765 3300031240 Bacteria 1271
299 Ga0265316_10838555 3300031344 Bacteria 644
300 Ga0307513_10431979 3300031456 Bacteria 1045
301 Ga0373926_0120841 3300035083 Bacteria 987
302 Ga0373932_0045218 3300035112 Bacteria 1287
303 Ga0373945_0002570 3300035116 Bacteria 5680
304 Ga0373956_0536145 3300035119 Bacteria 559
305 Ga0373957_0100386 3300035120 Bacteria 1158
306 Ga0373943_0044770 3300035170 Bacteria 2154
307 Ga0373946_0019647 3300035171 Bacteria 2604
308 Ga0373955_0000430 3300035172 Bacteria 17725
309 Ga0373924_0000790 3300035410 Bacteria 9864
310 Ga0373924_0063212 3300035410 Bacteria 1552
311 Ga0373924_0074524 3300035410 Bacteria 1436
312 Ga0373935_0134835 3300035692 Bacteria 1662
313 Ga0373935_0737676 3300035692 Bacteria 725
314 Ga0373935_1157583 3300035692 Bacteria 576
315 Ga0373927_0307459 3300035695 Bacteria 1043
316 Ga0373927_0400805 3300035695 Bacteria 905
317 Ga0373947_0006211 3300035725 Bacteria 6948
318 Ga0373947_0024403 3300035725 Bacteria 3523
319 Ga0373937_0014490 3300036401 Bacteria 6963
320 Ga0373937_0166046 3300036401 Bacteria 2070
321 Ga0373937_0221186 3300036401 Bacteria 1782
322 Ga0373937_0276837 3300036401 Bacteria 1584
323 Ga0373937_1119977 3300036401 Bacteria 736
324 Ga0373925_0089845 3300037068 Bacteria 2347
325 Ga0373925_0211609 3300037068 Bacteria 1544
326 Ga0373925_0494805 3300037068 Bacteria 1003
327 Ga0395898_0590910 3300037466 Bacteria 1053
328 Ga0395898_1113410 3300037466 Bacteria 723
329 Ga0395905_0092273 3300037471 Bacteria 2840
330 Ga0436364_0361650 3300037853 Bacteria 764
331 Ga0436365_0231947 3300039437 Bacteria 692
332 Ga0436365_1526301 3300039437 Bacteria 136420
333 Ga0436365_1827113 3300039437 Unclassified 3952
334 Ga0436361_0456810 3300039447 Bacteria 1226
335 Ga0436362_0195829 3300039453 Bacteria 883
336 Ga0439443_001161 3300042003 Bacteria 2792
337 Ga0451577_0126127 3300042876 Unclassified 2294
338 Ga0451577_0530825 3300042876 Bacteria 1069
339 Ga0466963_0002995 3300044694 Bacteria 9555
340 Ga0466963_0141577 3300044694 Bacteria 1666
341 Ga0453684_0250050 3300044712 Bacteria 2036
342 Ga0453684_0290350 3300044712 Unclassified 1862
343 Ga0466957_0000161 3300044842 Bacteria 29452
344 Ga0466957_0528473 3300044842 Bacteria 820
345 Ga0451576_0015906 3300045051 Bacteria 8318
346 Ga0451576_0495546 3300045051 Bacteria 1283
347 Ga0466958_0053979 3300045836 Bacteria 2436
348 Ga0466967_0005761 3300045976 Bacteria 8654
349 Ga0495603_0712258 3300046455 Bacteria 574
350 Ga0495651_0077384 3300046462 Bacteria 2518
351 Ga0495651_0410415 3300046462 Bacteria 882
352 Ga0495582_0136647 3300046473 Bacteria 1387
353 Ga0495605_0008611 3300046474 Bacteria 5763
354 Ga0495639_0062195 3300046475 Bacteria 1712
355 Ga0495639_0222992 3300046475 Bacteria 927
356 Ga0495594_0528495 3300046499 Bacteria 670
357 Ga0495628_0062836 3300046516 Bacteria 2910
358 Ga0495630_0137873 3300046517 Bacteria 1854
359 Ga0495663_0154408 3300046525 Bacteria 785
360 Ga0495666_0144901 3300046526 Bacteria 1106
361 Ga0495665_0050350 3300046531 Bacteria 2208
362 Ga0495586_0069299 3300046535 Bacteria 1925
363 Ga0495598_0021997 3300046537 Bacteria 1702
364 Ga0495621_0059202 3300046539 Bacteria 1387
365 Ga0495633_0256070 3300046558 Bacteria 798
366 Ga0495667_0135622 3300046559 Bacteria 1587
367 Ga0495635_0276247 3300046663 Bacteria 1129
368 Ga0495659_0019682 3300046664 Bacteria 2259
369 Ga0495599_0555185 3300046678 Bacteria 672
370 Ga0495623_0024374 3300046679 Bacteria 3899
371 Ga0495669_0115522 3300046684 Bacteria 1256
372 Ga0495669_0364488 3300046684 Bacteria 699
373 Ga0495624_0150204 3300046690 Bacteria 1425
374 Ga0495670_0434886 3300046691 Bacteria 710
375 Ga0495581_0017964 3300047315 Bacteria 4110
376 Ga0495604_0061859 3300047317 Bacteria 2862
377 Ga0495604_0411001 3300047317 Bacteria 890
378 Ga0495680_0271033 3300047322 Bacteria 1199
379 Ga0495675_0216083 3300047444 Bacteria 1162
380 Ga0495684_0279397 3300047471 Bacteria 1205
381 Ga0495614_0081032 3300048089 Bacteria 1406
382 Ga0495615_0175006 3300048090 Bacteria 651
383 Ga0496101_0644677 3300048904 Bacteria 837
384 Ga0496102_0002198 3300048905 Bacteria 16755
385 Ga0496102_0091220 3300048905 Unclassified 2820
386 Ga0496103_0158610 3300048906 Bacteria 1451
387 Ga0496103_0167383 3300048906 Bacteria 1410
388 Ga0496104_0054009 3300048907 Bacteria 3797
389 Ga0496104_0108276 3300048907 Bacteria 2663
390 Ga0496104_0195602 3300048907 Unclassified 1934
391 Ga0496107_0595903 3300048910 Bacteria 817
392 Ga0496110_0194957 3300048913 Bacteria 1839
393 Ga0496110_0764593 3300048913 Viruses 870
394 Ga0496111_0002956 3300048914 Bacteria 10401
395 Ga0496112_0000254 3300048915 Bacteria 34068
396 Ga0496112_0199819 3300048915 Bacteria 1959
397 Ga0496112_0280264 3300048915 Bacteria 1614
398 Ga0496112_0946498 3300048915 Bacteria 782
399 Ga0496113_0002528 3300048916 Bacteria 10662
400 Ga0496113_0170555 3300048916 Bacteria 1723
401 Ga0496113_0458489 3300048916 Bacteria 1024
402 nmdc:mga05p37_1342_c1 3300050507 Bacteria 28603
403 nmdc:mga05p37_142968_c1 3300050507 Bacteria 2554
404 nmdc:mga05p37_292721_c1 3300050507 Bacteria 1937
405 nmdc:mga0n895_1290605_c1 3300050512 Unclassified 701
406 nmdc:mga0n895_456523_c1 3300050512 Bacteria 1290
407 nmdc:mga08x19_149428_c1 3300050514 Bacteria 1581
408 Ga0587066_043148 3300059490 Bacteria 858
409 Ga0587070_012929 3300059491 Viruses 1278
410 Ga0587077_003172 3300059493 Bacteria 2041
411 Ga0587091_004455 3300059511 Bacteria 1842
412 Ga0587092_001776 3300059512 Bacteria 2181
413 Ga0587068_023087 3300059641 Bacteria 1034
414 Ga0587069_003443 3300059642 Bacteria 1708
415 Ga0587072_012897 3300059643 Bacteria 1386
416 Ga0587076_000747 3300059645 Bacteria 2911
417 Ga0587079_009935 3300059647 Bacteria 1495
418 Ga0587079_018946 3300059647 Bacteria 1213
419 Ga0587119_005186 3300059658 Bacteria 1325
420 Ga0587060_001905 3300060243 Bacteria 1415
421 Ga0373935_0009571
422 JGI24030J14995_100774
423 JGI24748J21848_1000038
424 JGI24034J26672_10000041
425 JGI25406J46586_10017123
426 JGI25406J46586_10049873
427 rootH1_10131938
428 rootL2_10286159
429 Ga0058863_10009159
430 Ga0058863_10014517
431 Ga0058863_11888212
432 Ga0058861_10042818
433 Ga0058861_11607165
434 Ga0058862_10106663
435 Ga0058862_10114140
436 Ga0058862_10130740
437 Ga0058862_12485591
438 Ga0058862_12787001
439 Ga0070658_10088529
440 Ga0070683_100038919
441 Ga0070683_100938186
442 Ga0070670_100829687
443 Ga0070680_100013475
444 Ga0070680_100672798
445 Ga0070682_100501785
446 Ga0068868_100161512
447 Ga0068868_101001430
448 Ga0070689_100965517
449 Ga0070661_100138957
450 Ga0070692_10111401
451 Ga0070669_100495666
452 Ga0070675_100145194
453 Ga0070671_100023908
454 Ga0070673_100543280
455 Ga0070709_10018088
456 Ga0070714_100027525
457 Ga0070714_100039174
458 Ga0070714_100053321
459 Ga0070714_100061879
460 Ga0070714_100348473
461 Ga0070714_100575576
462 Ga0070714_100590714
463 Ga0070714_101249931
464 Ga0070713_100036604
465 Ga0070713_100051515
466 Ga0070713_100110295
467 Ga0070713_100192056
468 Ga0070713_100390886
469 Ga0070713_101143076
470 Ga0070710_10064779
471 Ga0070711_100179662
472 Ga0070711_100512373
473 Ga0070711_100518807
474 Ga0070662_101099685
475 Ga0070681_10018975
476 Ga0070681_10097841
477 Ga0070681_10113224
478 Ga0070681_10154542
479 Ga0070681_10294776
480 Ga0070681_10960458
481 Ga0070681_11869709
482 Ga0070685_10081036
483 Ga0070707_100037936
484 Ga0070707_100067922
485 Ga0070698_100207864
486 Ga0070698_100214030
487 Ga0070699_100656824
488 Ga0070699_101589940
489 Ga0070679_100012341
490 Ga0070679_100365368
491 Ga0070679_100538586
492 Ga0070679_101127983
493 Ga0070684_100137573
494 Ga0070684_100143749
495 Ga0070684_100461193
496 Ga0070697_100039041
497 Ga0070697_100170735
498 Ga0070697_100174919
499 Ga0070697_100382450
500 Ga0068853_100015315
501 Ga0068853_100147038
502 Ga0068853_100198681
503 Ga0070695_100229163
504 Ga0070695_101071650
505 Ga0070693_100016289
506 Ga0068855_100075091
507 Ga0068855_100110933
508 Ga0068857_100180893
509 Ga0068854_100224777
510 Ga0068854_100487129
511 Ga0068856_100088364
512 Ga0068856_100392218
513 Ga0068852_100053723
514 Ga0068852_100070707
515 Ga0068859_100121710
516 Ga0068859_100271510
517 Ga0068864_100097166
518 Ga0068864_100426477
519 Ga0068866_10126493
520 Ga0068861_100028043
521 Ga0068861_100920001
522 Ga0068863_100391089
523 Ga0068863_101403663
524 Ga0068858_100000443
525 Ga0068858_100130665
526 Ga0068860_100362691
527 Ga0068860_101420879
528 Ga0081539_10008539
529 Ga0081539_10059063
530 Ga0070717_10187793
531 Ga0070717_10195576
532 Ga0070717_10323943
533 Ga0070717_10335333
534 Ga0070717_10519860
535 Ga0070717_10664244
536 Ga0070715_10156900
537 Ga0070716_100000020
538 Ga0070716_100060387
539 Ga0070716_100097115
540 Ga0070716_100137428
541 Ga0070716_100272237
542 Ga0070712_100118577
543 Ga0097621_100390981
544 Ga0097621_101425337
545 Ga0075434_100530352
546 Ga0075429_100344934
547 Ga0075436_100161103
548 Ga0097620_100121715
549 Ga0097620_100271497
550 Ga0099794_10208396
551 Ga0105240_10021475
552 Ga0105240_10063602
553 Ga0105240_10290809
554 Ga0105240_10452608
555 Ga0105245_10055620
556 Ga0105245_10059086
557 Ga0105245_10078279
558 Ga0105245_10229668
559 Ga0105245_10790276
560 Ga0105247_10000142
561 Ga0105247_10027397
562 Ga0114129_10017606
563 Ga0114129_10453026
564 Ga0114129_10723077
565 Ga0114129_11902271
566 Ga0105243_10041102
567 Ga0105241_10042300
568 Ga0105241_10440412
569 Ga0105242_10077459
570 Ga0105237_10122735
571 Ga0105237_10367559
572 Ga0105237_10850395
573 Ga0105238_10054798
574 Ga0105238_10059886
575 Ga0105238_10124492
576 Ga0105238_10131900
577 Ga0105238_10138702
578 Ga0105249_10204490
579 Ga0130087_1080617
580 Ga0130084_1086005
581 Ga0130085_1110429
582 Ga0105239_10142773
583 Ga0105239_10158746
584 Ga0105239_10203623
585 Ga0105239_10212584
586 Ga0105239_10794017
587 Ga0105246_10146409
588 Ga0105246_10547078
589 Ga0157373_10211005
590 Ga0157371_10083293
591 Ga0157370_11274075
592 Ga0157369_10083856
593 Ga0157369_10141790
594 Ga0157369_10469505
595 Ga0157369_10523041
596 Ga0157369_10910286
597 Ga0157374_10000057
598 Ga0157374_10091147
599 Ga0157374_10130340
600 Ga0157374_10855991
601 Ga0157374_11403319
602 Ga0157378_10009411
603 Ga0157378_10042091
604 Ga0157378_10070160
605 Ga0157378_10257656
606 Ga0163162_10022461
607 Ga0157372_10128180
608 Ga0157372_10748581
609 Ga0157372_10833420
610 Ga0157375_10413114
611 Ga0163163_10554391
612 Ga0163163_11719288
613 Ga0157379_10010007
614 Ga0157376_10000581
615 Ga0163161_10407681
616 Ga0206349_1402693
617 Ga0206349_1442471
618 Ga0206355_1626827
619 Ga0206351_10745108
620 Ga0206352_10867125
621 Ga0206350_11091030
622 Ga0206350_11545301
623 Ga0206353_10287839
624 Ga0206353_11977533
625 Ga0154015_1206444
626 Ga0213876_10000935
627 Ga0224712_10015526
628 Ga0207672_1000598
629 Ga0207692_10042396
630 Ga0207692_10202146
631 Ga0207642_10484864
632 Ga0207710_10000001
633 Ga0207688_10710067
634 Ga0207699_10609297
635 Ga0207699_10619660
636 Ga0207645_10543469
637 Ga0207705_10056642
638 Ga0207654_10018445
639 Ga0207707_10053555
640 Ga0207707_10070523
641 Ga0207707_10245798
642 Ga0207707_10251354
643 Ga0207707_10386455
644 Ga0207695_10046391
645 Ga0207695_10304135
646 Ga0207695_10474643
647 Ga0207695_10652926
648 Ga0207671_10230097
649 Ga0207693_10044388
650 Ga0207693_10052290
651 Ga0207693_10284243
652 Ga0207693_10388031
653 Ga0207663_10045613
654 Ga0207663_10977959
655 Ga0207660_10039376
656 Ga0207660_10364456
657 Ga0207652_10040248
658 Ga0207652_10084114
659 Ga0207652_10219572
660 Ga0207652_10537311
661 Ga0207646_10244209
662 Ga0207681_10394272
663 Ga0207694_10010839
664 Ga0207694_10194066
665 Ga0207694_10313566
666 Ga0207694_10418342
667 Ga0207694_10718021
668 Ga0207687_10033159
669 Ga0207687_10061902
670 Ga0207700_10024041
671 Ga0207700_10181528
672 Ga0207700_10281318
673 Ga0207700_10282678
674 Ga0207700_10330193
675 Ga0207664_10009227
676 Ga0207664_10050398
677 Ga0207664_10214233
678 Ga0207664_10390372
679 Ga0207664_10419437
680 Ga0207664_10437088
681 Ga0207664_10612113
682 Ga0207644_10002643
683 Ga0207686_10114083
684 Ga0207709_10043185
685 Ga0207665_10000045
686 Ga0207665_10004993
687 Ga0207665_10133736
688 Ga0207665_10175068
689 Ga0207665_10182802
690 Ga0207689_11031144
691 Ga0207661_10076723
692 Ga0207661_10263634
693 Ga0207661_10277585
694 Ga0207661_10293168
695 Ga0207667_10017037
696 Ga0207667_10089435
697 Ga0207651_10234911
698 Ga0207640_10293547
699 Ga0207677_10147573
700 Ga0207703_10000818
701 Ga0207703_10628617
702 Ga0207639_10006234
703 Ga0207639_10145553
704 Ga0207639_10204415
705 Ga0207639_10269866
706 Ga0207702_10019229
707 Ga0207641_10117211
708 Ga0207676_10008732
709 Ga0207676_11046568
710 Ga0207676_11137768
711 Ga0207674_10016690
712 Ga0207674_10505484
713 Ga0207675_100010289
714 Ga0207698_10061432
715 Ga0207698_10296865
716 Ga0209588_1026432
717 Ga0268264_11234707
718 Ga0265320_10108765
719 Ga0265316_10838555
720 Ga0307513_10431979
721 Ga0373926_0120841
722 Ga0373932_0045218
723 Ga0373945_0002570
724 Ga0373956_0536145
725 Ga0373957_0100386
726 Ga0373943_0044770
727 Ga0373946_0019647
728 Ga0373955_0000430
729 Ga0373924_0000790
730 Ga0373924_0063212
731 Ga0373924_0074524
732 Ga0373935_0134835
733 Ga0373935_0737676
734 Ga0373935_1157583
735 Ga0373927_0307459
736 Ga0373927_0400805
737 Ga0373947_0006211
738 Ga0373947_0024403
739 Ga0373937_0014490
740 Ga0373937_0166046
741 Ga0373937_0221186
742 Ga0373937_0276837
743 Ga0373937_1119977
744 Ga0373925_0089845
745 Ga0373925_0211609
746 Ga0373925_0494805
747 Ga0395898_0590910
748 Ga0395898_1113410
749 Ga0395905_0092273
750 Ga0436364_0361650
751 Ga0436365_0231947
752 Ga0436365_1526301
753 Ga0436365_1827113
754 Ga0436361_0456810
755 Ga0436362_0195829
756 Ga0439443_001161
757 Ga0451577_0126127
758 Ga0451577_0530825
759 Ga0466963_0002995
760 Ga0466963_0141577
761 Ga0453684_0250050
762 Ga0453684_0290350
763 Ga0466957_0000161
764 Ga0466957_0528473
765 Ga0451576_0015906
766 Ga0451576_0495546
767 Ga0466958_0053979
768 Ga0466967_0005761
769 Ga0495603_0712258
770 Ga0495651_0077384
771 Ga0495651_0410415
772 Ga0495582_0136647
773 Ga0495605_0008611
774 Ga0495639_0062195
775 Ga0495639_0222992
776 Ga0495594_0528495
777 Ga0495628_0062836
778 Ga0495630_0137873
779 Ga0495663_0154408
780 Ga0495666_0144901
781 Ga0495665_0050350
782 Ga0495586_0069299
783 Ga0495598_0021997
784 Ga0495621_0059202
785 Ga0495633_0256070
786 Ga0495667_0135622
787 Ga0495635_0276247
788 Ga0495659_0019682
789 Ga0495599_0555185
790 Ga0495623_0024374
791 Ga0495669_0115522
792 Ga0495669_0364488
793 Ga0495624_0150204
794 Ga0495670_0434886
795 Ga0495581_0017964
796 Ga0495604_0061859
797 Ga0495604_0411001
798 Ga0495680_0271033
799 Ga0495675_0216083
800 Ga0495684_0279397
801 Ga0495614_0081032
802 Ga0495615_0175006
803 Ga0496101_0644677
804 Ga0496102_0002198
805 Ga0496102_0091220
806 Ga0496103_0158610
807 Ga0496103_0167383
808 Ga0496104_0054009
809 Ga0496104_0108276
810 Ga0496104_0195602
811 Ga0496107_0595903
812 Ga0496110_0194957
813 Ga0496110_0764593
814 Ga0496111_0002956
815 Ga0496112_0000254
816 Ga0496112_0199819
817 Ga0496112_0280264
818 Ga0496112_0946498
819 Ga0496113_0002528
820 Ga0496113_0170555
821 Ga0496113_0458489
822 nmdc:mga05p37_1342_c1
823 nmdc:mga05p37_142968_c1
824 nmdc:mga05p37_292721_c1
825 nmdc:mga0n895_1290605_c1
826 nmdc:mga0n895_456523_c1
827 nmdc:mga08x19_149428_c1
828 Ga0587066_043148
829 Ga0587070_012929
830 Ga0587077_003172
831 Ga0587091_004455
832 Ga0587092_001776
833 Ga0587068_023087
834 Ga0587069_003443
835 Ga0587072_012897
836 Ga0587076_000747
837 Ga0587079_009935
838 Ga0587079_018946
839 Ga0587119_005186
840 Ga0587060_001905

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

30

86

0.97

Map