F439767

General Info

Members Datasets Scaffolds Average Seq Length
420 264 378 395

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10152707|Ga0307513_101527073
Length 411
Sequence VRQVVVTGLGAVAPHGDDPHAMFAALMRGESAVRAVFPELQKPAAAAVTAFDAGRWFTKLQLPGVDRVSQLAAAAADLAMRDAGDLGDLDPERVGVFVGCGMGGAAALEAAYRSNGRVPPLTIPAFMPNAPAAQLAIRHGVQGPVLTYSVACASSSVAIAEAAKAVEHGEVDLAIAGGSEALVVPGVVLAWQAMQTLATFHPDEAARAVRPFASDRSGFALGEGAAFLILESAERAHARRARVYAALAGWGISSDATHLTKPDAPGQARALRAALRRADMAPRDIGYCNAHGTATRIGDVVERDALAATWGDELEHLRVSSTKALHGHLLGAAGALEALITVLALHHRQLPPNAHCESVDPACNLNLVLEAGTAAPQLQAAISSSFAFGGTNSVLLFADASAHKSKKQRLV

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
8 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
9 2643221658 Variovorax sp. Root411 Isolate Unclassified
10 2643221672 Variovorax sp. Root434 Isolate Unclassified
11 2643221683 Variovorax sp. Root473 Isolate Unclassified
12 2738541277 Variovorax sp. GV051 Isolate Unclassified
13 2738541307 Variovorax sp. GV008 Isolate Unclassified
14 2738543013 Variovorax sp. BT01 Isolate Unclassified
15 2738543019 Variovorax sp. GV040 Isolate Unclassified
16 2818991446 Variovorax sp. 1180 Isolate Unclassified
17 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
18 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
19 2842733646 Variovorax sp. R-72446 Isolate Unclassified
20 2842747753 Variovorax sp. R-72060 Isolate Unclassified
21 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
22 2885198086 Variovorax sp. 679 Isolate Unclassified
23 2885211737 Variovorax sp. 553 Isolate Unclassified
24 2899924645 Variovorax sp. 369 Isolate Unclassified
25 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
26 2904456579 Variovorax sp. 2002 Isolate Unclassified
27 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
28 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
29 2928037797 Variovorax sp. 1126 Isolate Unclassified
30 2928044640 Variovorax sp. 1128 Isolate Unclassified
31 2928051484 Variovorax sp. 1133 Isolate Unclassified
32 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
33 2928070936 Variovorax gossypii 1167 Isolate Unclassified
34 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
35 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
36 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
37 2929520902 Variovorax beijingensis 502 Isolate Unclassified
38 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
39 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
40 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
41 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
42 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
43 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
44 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
45 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
46 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
47 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
50 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
51 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
52 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
53 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
54 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
55 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
56 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
57 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
58 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
59 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
62 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
63 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
64 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
112 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
118 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
157 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
158 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
159 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
160 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
161 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
162 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
181 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
182 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
183 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
184 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
185 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
186 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
187 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
188 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
189 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
190 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
191 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
192 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
193 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
194 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
195 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
196 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
197 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
198 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
214 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
225 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
252 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
253 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
254 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
255 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
256 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
257 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
258 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
259 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
260 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
261 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
262 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
263 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
264 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 90
Metatranscriptomes 0
Isolates 10

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.1
Nodule 0.71
Rhizoplane 1.67
Rhizosphere 45.48
Stem 0
Stem Tuber 0
Unclassified 19.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10011902 3300001989 Bacteria 3202
2 JGI25152J39213_1001387 3300002773 Bacteria 10498
3 JGI25152J39213_1010797 3300002773 Bacteria 2061
4 JGI25150J39212_1002097 3300002774 Bacteria 5163
5 JGI25159J45721_1001737 3300002987 Bacteria 8778
6 JGI25151J46595_10001719 3300003187 Bacteria 14295
7 JGI25151J46595_10002659 3300003187 Bacteria 10486
8 JGI25151J46595_10015933 3300003187 Bacteria 3298
9 JGI25153J46596_10002893 3300003215 Bacteria 9739
10 rootL2_10008425 3300003322 Bacteria 29138
11 JGI25160J50197_1001995 3300003354 Bacteria 9739
12 JGI25160J50197_1018467 3300003354 Bacteria 2173
13 JGI25161J50226_1000931 3300003374 Bacteria 10498
14 JGI25161J50226_1001029 3300003374 Bacteria 9691
15 Ga0055535_1000392 3300003761 Bacteria 41361
16 Ga0055542_1000033 3300003762 Bacteria 233997
17 Ga0055526_1003591 3300003771 Bacteria 9739
18 Ga0055526_1003609 3300003771 Bacteria 9707
19 Ga0055537_1001046 3300003773 Bacteria 12403
20 Ga0055537_1001375 3300003773 Bacteria 9739
21 Ga0055524_1002382 3300003775 Bacteria 9739
22 Ga0055524_1002402 3300003775 Bacteria 9707
23 Ga0055536_1001865 3300003781 Bacteria 12295
24 Ga0055536_1002374 3300003781 Bacteria 10625
25 Ga0055536_1006469 3300003781 Bacteria 5461
26 Ga0055536_1030988 3300003781 Bacteria 1407
27 Ga0055534_1000401 3300003784 Bacteria 26682
28 Ga0055534_1002653 3300003784 Bacteria 6070
29 Ga0055534_1003249 3300003784 Bacteria 5198
30 Ga0055534_1007561 3300003784 Bacteria 2572
31 Ga0055528_1002529 3300003790 Bacteria 9739
32 Ga0055528_1003559 3300003790 Bacteria 7766
33 Ga0055530_10000894 3300003791 Bacteria 24528
34 Ga0055530_10002156 3300003791 Bacteria 13041
35 Ga0055530_10006200 3300003791 Bacteria 5409
36 Ga0055540_1000672 3300003792 Bacteria 23734
37 Ga0055540_1001287 3300003792 Bacteria 15227
38 Ga0055540_1001713 3300003792 Bacteria 12615
39 Ga0055540_1006892 3300003792 Bacteria 4406
40 Ga0055531_10000926 3300003794 Bacteria 23734
41 Ga0055531_10011053 3300003794 Bacteria 4406
42 Ga0055531_10014952 3300003794 Bacteria 3458
43 Ga0055543_1002672 3300004625 Bacteria 5724
44 Ga0065165_1003935 3300005262 Bacteria 9777
45 Ga0065165_1014132 3300005262 Bacteria 3117
46 Ga0070669_100023484 3300005353 Bacteria 4415
47 Ga0070667_100001132 3300005367 Bacteria 24302
48 Ga0068867_100008541 3300005459 Bacteria 7228
49 Ga0068867_100154347 3300005459 Bacteria 1806
50 Ga0068853_100132171 3300005539 Bacteria 2235
51 Ga0070672_100224546 3300005543 Bacteria 1576
52 Ga0070665_100362782 3300005548 Bacteria 1455
53 Ga0068855_100081726 3300005563 Bacteria 3745
54 Ga0070664_100017963 3300005564 Bacteria 5806
55 Ga0068852_100164101 3300005616 Bacteria 2077
56 Ga0068859_100152470 3300005617 Bacteria 2387
57 Ga0068864_100008599 3300005618 Bacteria 8425
58 Ga0068866_10021809 3300005718 Bacteria 2955
59 Ga0068861_100002598 3300005719 Bacteria 11823
60 Ga0068851_10017496 3300005834 Bacteria 3444
61 Ga0068863_100008729 3300005841 Bacteria 9899
62 Ga0068858_100075588 3300005842 Bacteria 3129
63 Ga0068860_100001219 3300005843 Bacteria 28009
64 Ga0068860_100038522 3300005843 Bacteria 4573
65 Ga0068862_100012222 3300005844 Bacteria 7097
66 Ga0068862_100019823 3300005844 Bacteria 5616
67 Ga0068862_100089766 3300005844 Bacteria 2675
68 Ga0075367_10033583 3300006178 Bacteria 2959
69 Ga0075366_10001878 3300006195 Bacteria 10598
70 Ga0075366_10019777 3300006195 Bacteria 3902
71 Ga0075366_10021986 3300006195 Bacteria 3708
72 Ga0075370_10000784 3300006353 Bacteria 12697
73 Ga0075370_10003275 3300006353 Bacteria 7680
74 Ga0075370_10005140 3300006353 Bacteria 6456
75 Ga0075370_10014286 3300006353 Bacteria 4235
76 Ga0097620_100152463 3300006931 Bacteria 2387
77 Ga0099826_10013421 3300006948 Bacteria 6192
78 Ga0105240_10003282 3300009093 Bacteria 25301
79 Ga0105245_10014972 3300009098 Bacteria 6757
80 Ga0105243_10002338 3300009148 Bacteria 15864
81 Ga0105243_10003767 3300009148 Bacteria 12156
82 Ga0105243_10023765 3300009148 Bacteria 4671
83 Ga0105237_10001435 3300009545 Bacteria 31496
84 Ga0105238_10035600 3300009551 Bacteria 5061
85 Ga0105249_10038310 3300009553 Bacteria 4350
86 Ga0105239_10001553 3300010375 Bacteria 30349
87 Ga0105246_10017494 3300011119 Bacteria 4557
88 Ga0157373_10205869 3300013100 Bacteria 1387
89 Ga0157370_10008173 3300013104 Bacteria 11309
90 Ga0157369_10018464 3300013105 Bacteria 7819
91 Ga0157378_10011125 3300013297 Bacteria 7875
92 Ga0163162_10004321 3300013306 Bacteria 13683
93 Ga0157375_10263770 3300013308 Bacteria 1884
94 Ga0163163_10056936 3300014325 Bacteria 3865
95 Ga0157380_10064972 3300014326 Bacteria 2931
96 Ga0182008_10001298 3300014497 Bacteria 17055
97 Ga0182008_10002071 3300014497 Bacteria 12832
98 Ga0182008_10006660 3300014497 Bacteria 6432
99 Ga0182008_10016898 3300014497 Bacteria 3785
100 Ga0157379_10021862 3300014968 Bacteria 5667
101 Ga0157379_10090073 3300014968 Bacteria 2752
102 Ga0157379_10098195 3300014968 Bacteria 2629
103 Ga0157379_10332179 3300014968 Bacteria 1389
104 Ga0157376_10117988 3300014969 Bacteria 2347
105 Ga0182006_1000895 3300015261 Bacteria 19978
106 Ga0182007_10000647 3300015262 Bacteria 20069
107 Ga0183362_10003 3300015683 Bacteria 977584
108 Ga0163161_10000166 3300017792 Bacteria 60327
109 Ga0163161_10010912 3300017792 Bacteria 6298
110 Ga0213872_10017782 3300021361 Bacteria 3282
111 Ga0209672_100794 3300025228 Bacteria 15056
112 Ga0209147_104087 3300025229 Bacteria 2546
113 Ga0209258_100089 3300025242 Bacteria 234040
114 Ga0207425_1000603 3300025245 Bacteria 20837
115 Ga0207425_1011544 3300025245 Bacteria 2101
116 Ga0209148_1000097 3300025254 Bacteria 234049
117 Ga0209129_1000071 3300025258 Bacteria 210729
118 Ga0209565_1000175 3300025263 Bacteria 81833
119 Ga0209565_1000334 3300025263 Bacteria 41939
120 Ga0209673_1000099 3300025273 Bacteria 193248
121 Ga0209673_1001065 3300025273 Bacteria 31373
122 Ga0209673_1001338 3300025273 Bacteria 24643
123 Ga0209673_1002081 3300025273 Bacteria 15039
124 Ga0209130_1000456 3300025284 Bacteria 43000
125 Ga0209130_1000812 3300025284 Bacteria 26378
126 Ga0209130_1005272 3300025284 Bacteria 4548
127 Ga0209675_1000054 3300025291 Bacteria 193248
128 Ga0209675_1001110 3300025291 Bacteria 16417
129 Ga0209675_1001269 3300025291 Bacteria 15100
130 Ga0209675_1001575 3300025291 Bacteria 12922
131 Ga0209675_1004395 3300025291 Bacteria 6286
132 Ga0209676_1000005 3300025292 Bacteria 1076001
133 Ga0209676_1000260 3300025292 Bacteria 111683
134 Ga0209676_1001229 3300025292 Bacteria 27108
135 Ga0209676_1006720 3300025292 Bacteria 5599
136 Ga0209676_1015719 3300025292 Bacteria 2772
137 Ga0209676_1024453 3300025292 Bacteria 1956
138 Ga0209025_1000854 3300025294 Bacteria 48260
139 Ga0209025_1001065 3300025294 Bacteria 39873
140 Ga0209025_1001296 3300025294 Bacteria 34134
141 Ga0209025_1001409 3300025294 Bacteria 31873
142 Ga0209025_1013915 3300025294 Bacteria 5009
143 Ga0209025_1016601 3300025294 Bacteria 4325
144 Ga0209564_1000239 3300025295 Bacteria 119761
145 Ga0209564_1000890 3300025295 Bacteria 39405
146 Ga0209758_1000027 3300025297 Bacteria 549650
147 Ga0209050_1000007 3300025298 Bacteria 1187891
148 Ga0209050_1000954 3300025298 Bacteria 37580
149 Ga0209050_1019190 3300025298 Bacteria 2612
150 Ga0209256_1000081 3300025299 Bacteria 222908
151 Ga0209256_1003946 3300025299 Bacteria 9759
152 Ga0207426_1000027 3300025302 Bacteria 513176
153 Ga0207426_1000614 3300025302 Bacteria 45951
154 Ga0209051_1000009 3300025303 Bacteria 706778
155 Ga0209051_1000319 3300025303 Bacteria 72894
156 Ga0209051_1000619 3300025303 Bacteria 40839
157 Ga0209051_1000661 3300025303 Bacteria 38725
158 Ga0209051_1010230 3300025303 Bacteria 4763
159 Ga0209051_1014811 3300025303 Bacteria 3621
160 Ga0209257_1000873 3300025304 Bacteria 42738
161 Ga0209257_1002439 3300025304 Bacteria 18494
162 Ga0209257_1007485 3300025304 Bacteria 6574
163 Ga0209257_1007871 3300025304 Bacteria 6276
164 Ga0209257_1011229 3300025304 Bacteria 4347
165 Ga0207655_1002596 3300025728 Bacteria 14387
166 Ga0207695_10192513 3300025913 Bacteria 1956
167 Ga0207671_10039364 3300025914 Bacteria 3501
168 Ga0207681_10052887 3300025923 Bacteria 2755
169 Ga0207694_10039803 3300025924 Bacteria 3618
170 Ga0207694_10074862 3300025924 Bacteria 2650
171 Ga0207687_10010676 3300025927 Bacteria 5999
172 Ga0207709_10001232 3300025935 Bacteria 18384
173 Ga0207709_10002287 3300025935 Bacteria 12156
174 Ga0207709_10129027 3300025935 Bacteria 1720
175 Ga0207704_10202622 3300025938 Bacteria 1454
176 Ga0207679_10072549 3300025945 Bacteria 2601
177 Ga0207667_10146630 3300025949 Bacteria 2430
178 Ga0207712_10058939 3300025961 Bacteria 2715
179 Ga0207658_10001749 3300025986 Bacteria 16347
180 Ga0207639_10059021 3300026041 Bacteria 2954
181 Ga0207639_10107742 3300026041 Bacteria 2264
182 Ga0207678_10138849 3300026067 Bacteria 2074
183 Ga0207708_10011916 3300026075 Bacteria 6477
184 Ga0207641_10092528 3300026088 Bacteria 2648
185 Ga0207648_10000765 3300026089 Bacteria 36119
186 Ga0207676_10006096 3300026095 Bacteria 8508
187 Ga0207675_100001028 3300026118 Bacteria 27641
188 Ga0207675_100285304 3300026118 Bacteria 1605
189 Ga0207698_10095760 3300026142 Bacteria 2444
190 Ga0209282_1000328 3300027666 Bacteria 23523
191 Ga0268265_10009804 3300028380 Bacteria 6466
192 Ga0268265_10076744 3300028380 Bacteria 2622
193 Ga0268264_10004657 3300028381 Bacteria 11658
194 Ga0307517_10004027 3300028786 Bacteria 22740
195 Ga0307517_10185020 3300028786 Bacteria 1335
196 Ga0307515_10000049 3300028794 Bacteria 278611
197 Ga0307515_10000066 3300028794 Bacteria 244076
198 Ga0307515_10000219 3300028794 Bacteria 141532
199 Ga0307515_10000347 3300028794 Bacteria 114603
200 Ga0307515_10002435 3300028794 Bacteria 40544
201 Ga0307515_10012248 3300028794 Bacteria 16152
202 Ga0307515_10013197 3300028794 Bacteria 15457
203 Ga0307515_10047560 3300028794 Bacteria 6516
204 Ga0307515_10081962 3300028794 Bacteria 4181
205 Ga0307512_10012282 3300030522 Bacteria 8091
206 Ga0316177_1054315 3300030731 Bacteria 5366
207 Ga0316179_1017836 3300030734 Bacteria 2264
208 Ga0316178_1150052 3300030735 Bacteria 3795
209 Ga0316180_1132740 3300030736 Bacteria 4845
210 Ga0316183_1062425 3300030742 Bacteria 4416
211 Ga0316182_1091823 3300030745 Bacteria 3014
212 Ga0265327_10000851 3300031251 Bacteria 45640
213 Ga0265327_10005998 3300031251 Bacteria 9881
214 Ga0307513_10063060 3300031456 Bacteria 3913
215 Ga0307513_10086875 3300031456 Bacteria 3204
216 Ga0307513_10088835 3300031456 Bacteria 3157
217 Ga0307513_10091856 3300031456 Bacteria 3092
218 Ga0307513_10094081 3300031456 Bacteria 3043
219 Ga0307513_10098664 3300031456 Bacteria 2951
220 Ga0307513_10152707 3300031456 Bacteria 2215
221 Ga0307513_10281717 3300031456 Bacteria 1439
222 Ga0307509_10002117 3300031507 Bacteria 32688
223 Ga0307509_10008345 3300031507 Bacteria 13233
224 Ga0307509_10008437 3300031507 Bacteria 13144
225 Ga0307509_10017568 3300031507 Bacteria 8226
226 Ga0307509_10045445 3300031507 Bacteria 4735
227 Ga0307408_100068783 3300031548 Bacteria 2608
228 Ga0307508_10000392 3300031616 Bacteria 52650
229 Ga0307508_10001018 3300031616 Bacteria 32597
230 Ga0307508_10001804 3300031616 Bacteria 23735
231 Ga0307514_10018273 3300031649 Bacteria 5752
232 Ga0307514_10056033 3300031649 Bacteria 3027
233 Ga0307516_10001538 3300031730 Bacteria 31719
234 Ga0307516_10005041 3300031730 Bacteria 15980
235 Ga0307405_10128061 3300031731 Bacteria 1749
236 Ga0307412_10005171 3300031911 Bacteria 7309
237 Ga0307416_100014412 3300032002 Bacteria 5418
238 Ga0307414_10042076 3300032004 Bacteria 3101
239 Ga0307414_10043275 3300032004 Bacteria 3066
240 Ga0307411_10031863 3300032005 Bacteria 3250
241 Ga0307507_10025359 3300033179 Bacteria 6433
242 Ga0307510_10013446 3300033180 Bacteria 9706
243 Ga0307510_10016809 3300033180 Bacteria 8632
244 Ga0307510_10057049 3300033180 Bacteria 4058
245 Ga0373927_0009084 3300035695 Bacteria 6671
246 Ga0373925_0014737 3300037068 Bacteria 5648
247 Ga0373925_0026637 3300037068 Bacteria 4231
248 Ga0436361_0425741 3300039447 Bacteria 44363
249 Ga0436361_0561928 3300039447 Bacteria 10291
250 Ga0436361_0856108 3300039447 Bacteria 17978
251 Ga0439436_0003789 3300041404 Bacteria 4625
252 Ga0439447_005462 3300041407 Bacteria 4229
253 Ga0439461_0014126 3300041410 Bacteria 1514
254 Ga0439466_0003353 3300041411 Bacteria 6230
255 Ga0439466_0006727 3300041411 Bacteria 4361
256 Ga0451843_1322652 3300041509 Bacteria 1879
257 Ga0439431_0000498 3300041997 Bacteria 8312
258 Ga0439431_0010048 3300041997 Bacteria 2143
259 Ga0439433_0008161 3300041999 Bacteria 2267
260 Ga0439442_001009 3300042002 Bacteria 5687
261 Ga0439442_010391 3300042002 Bacteria 1887
262 Ga0439445_0001052 3300042004 Bacteria 5898
263 Ga0439445_0005390 3300042004 Bacteria 2916
264 Ga0439432_002426 3300042006 Bacteria 7019
265 Ga0439432_008862 3300042006 Bacteria 3518
266 Ga0439449_0002385 3300042007 Bacteria 7353
267 Ga0439449_0007720 3300042007 Bacteria 4085
268 Ga0439457_003333 3300042014 Bacteria 4389
269 Ga0439462_0002381 3300042015 Bacteria 4361
270 Ga0450911_000061 3300042115 Bacteria 44228
271 Ga0450920_013455 3300042122 Bacteria 1541
272 Ga0450923_000531 3300042125 Bacteria 4266
273 Ga0450898_008307 3300042134 Bacteria 1635
274 Ga0450898_008436 3300042134 Bacteria 1626
275 Ga0450908_003789 3300042184 Bacteria 2926
276 Ga0439434_0004079 3300042435 Bacteria 4265
277 Ga0439434_0009389 3300042435 Bacteria 2875
278 Ga0439434_0016372 3300042435 Bacteria 2215
279 Ga0451577_0000137 3300042876 Bacteria 163955
280 Ga0453684_0000014 3300044712 Bacteria 993311
281 Ga0453684_0000384 3300044712 Bacteria 181189
282 Ga0453684_0003729 3300044712 Bacteria 33733
283 Ga0453684_0073453 3300044712 Bacteria 4311
284 Ga0466957_0005242 3300044842 Bacteria 7258
285 Ga0466960_0028914 3300044901 Bacteria 2540
286 Ga0451576_0000169 3300045051 Bacteria 164329
287 Ga0495627_006311 3300046453 Bacteria 4656
288 Ga0495592_0000370 3300046454 Bacteria 35460
289 Ga0495629_0160954 3300046459 Bacteria 1559
290 Ga0495638_0033194 3300046460 Bacteria 3302
291 Ga0495638_0073304 3300046460 Bacteria 2090
292 Ga0495582_0070245 3300046473 Bacteria 1937
293 Ga0495610_0010133 3300046512 Bacteria 5883
294 Ga0495616_0022905 3300046513 Bacteria 3367
295 Ga0495620_0035242 3300046515 Bacteria 2252
296 Ga0495620_0048211 3300046515 Bacteria 1830
297 Ga0495630_0153252 3300046517 Bacteria 1754
298 Ga0495631_0002245 3300046518 Bacteria 11094
299 Ga0495637_0004546 3300046520 Bacteria 7173
300 Ga0495586_0019141 3300046535 Bacteria 3642
301 Ga0495621_0007194 3300046539 Bacteria 3286
302 Ga0495668_0024457 3300046616 Bacteria 3435
303 Ga0495625_0000896 3300046660 Bacteria 40225
304 Ga0495625_0008969 3300046660 Bacteria 8447
305 Ga0495625_0041741 3300046660 Bacteria 3338
306 Ga0495588_0012218 3300046674 Bacteria 4051
307 Ga0495588_0015389 3300046674 Bacteria 3681
308 Ga0495588_0040798 3300046674 Bacteria 2368
309 Ga0495658_0018565 3300046683 Bacteria 3618
310 Ga0495613_0175536 3300046689 Bacteria 1519
311 Ga0495624_0081270 3300046690 Bacteria 2007
312 Ga0495671_0050380 3300046692 Bacteria 2073
313 Ga0495660_0019101 3300046810 Bacteria 3935
314 Ga0495636_0021809 3300047318 Bacteria 2587
315 Ga0495676_0026281 3300047321 Bacteria 5014
316 Ga0495676_0103644 3300047321 Bacteria 2100
317 Ga0495593_0030036 3300047673 Bacteria 2976
318 Ga0495593_0033930 3300047673 Bacteria 2778
319 Ga0495602_0155638 3300048088 Bacteria 1790
320 Ga0495614_0021155 3300048089 Bacteria 2811
321 Ga0495614_0032663 3300048089 Bacteria 2240
322 Ga0496102_0001150 3300048905 Bacteria 24162
323 Ga0496102_0028412 3300048905 Bacteria 4995
324 Ga0496108_0028950 3300048911 Bacteria 4583
325 Ga0496114_0142907 3300048917 Bacteria 2073
326 Ga0496116_0042787 3300048919 Bacteria 3092
327 Ga0496117_0035531 3300048920 Bacteria 3739
328 Ga0496118_0015401 3300048921 Bacteria 7079
329 Ga0496118_0078733 3300048921 Bacteria 2330
330 Ga0496121_0002603 3300048924 Bacteria 27252
331 Ga0496122_0000688 3300048925 Bacteria 67392
332 Ga0496122_0025558 3300048925 Bacteria 5125
333 Ga0496122_0049457 3300048925 Bacteria 3219
334 Ga0496122_0064881 3300048925 Bacteria 2653
335 Ga0496123_0001158 3300048926 Bacteria 39125
336 Ga0496123_0030384 3300048926 Bacteria 3955
337 Ga0496124_0032773 3300048927 Bacteria 4582
338 Ga0496124_0191536 3300048927 Bacteria 1564
339 Ga0496124_0276609 3300048927 Bacteria 1226
340 Ga0496125_0012084 3300048928 Bacteria 8592
341 Ga0496125_0012324 3300048928 Bacteria 8494
342 Ga0496125_0015670 3300048928 Bacteria 7314
343 Ga0496125_0037100 3300048928 Bacteria 4242
344 Ga0496126_0080866 3300048929 Bacteria 2874
345 nmdc:mga03683_3988_c1 3300050489 Bacteria 4835
346 nmdc:mga03683_5284_c1 3300050489 Bacteria 4353
347 nmdc:mga0yw44_125962_c1 3300050492 Bacteria 1654
348 nmdc:mga0k408_11117_c1 3300050493 Bacteria 4892
349 nmdc:mga07m45_14769_c1 3300050496 Bacteria 3544
350 nmdc:mga07m45_14996_c1 3300050496 Bacteria 4137
351 nmdc:mga07m45_3999_c1 3300050496 Bacteria 7172
352 nmdc:mga07m45_637_c1 3300050496 Bacteria 14921
353 nmdc:mga0qj67_245562_c1 3300050509 Bacteria 1452
354 Ga0500578_0020786 3300053086 Bacteria 4220
355 Ga0500643_012370 3300053087 Bacteria 3057
356 Ga0500644_0016184 3300053088 Bacteria 2144
357 Ga0500644_0022148 3300053088 Bacteria 1913
358 Ga0500651_0000029 3300053093 Bacteria 113528
359 Ga0500562_005715 3300053108 Bacteria 3131
360 Ga0500562_007153 3300053108 Bacteria 2817
361 Ga0500571_000115 3300053110 Bacteria 26083
362 Ga0500593_000703 3300053117 Bacteria 12759
363 Ga0500594_0000934 3300053118 Bacteria 6280
364 Ga0500607_001057 3300053121 Bacteria 25918
365 Ga0500607_034327 3300053121 Bacteria 2778
366 Ga0500608_008770 3300053122 Bacteria 4266
367 Ga0500655_001331 3300053133 Bacteria 4687
368 Ga0500658_0000245 3300053134 Bacteria 25454
369 Ga0500658_0000252 3300053134 Bacteria 24949
370 Ga0500559_0000195 3300053136 Bacteria 48743
371 Ga0500559_0001309 3300053136 Bacteria 14367
372 Ga0500559_0004121 3300053136 Bacteria 6968
373 Ga0500559_0012713 3300053136 Bacteria 3573
374 Ga0500564_015041 3300053138 Bacteria 3490
375 Ga0500590_013646 3300053148 Bacteria 4174
376 Ga0500619_000078 3300053154 Bacteria 27132
377 Ga0500634_0021440 3300053161 Bacteria 3501
378 Ga0500645_000801 3300053730 Bacteria 18863

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025961 Ga0207712_10058939 Ga0207712_100589392 326
2 3300046660 Ga0495625_0041741 Ga0495625_0041741_1672_2874 339
3 3300030731 Ga0316177_1054315 Ga0316177_10543152 345
4 3300030742 Ga0316183_1062425 Ga0316183_10624253 345
5 3300030734 Ga0316179_1017836 Ga0316179_10178362 346
6 3300030735 Ga0316178_1150052 Ga0316178_11500522 346
7 3300030745 Ga0316182_1091823 Ga0316182_10918232 346
8 3300031731 Ga0307405_10128061 Ga0307405_101280612 348
9 3300053154 Ga0500619_000078 Ga0500619_000078_13632_14834 348
10 3300003354 JGI25160J50197_1018467 JGI25160J50197_10184672 353
11 3300030736 Ga0316180_1132740 Ga0316180_11327403 359
12 3300021361 Ga0213872_10017782 Ga0213872_100177822 363
13 3300039447 Ga0436361_0856108 Ga0436361_0856108_6040_7263 363
14 3300042876 Ga0451577_0000137 Ga0451577_0000137_42814_44022 365
15 3300044712 Ga0453684_0000014 Ga0453684_0000014_145858_147066 365
16 3300032005 Ga0307411_10031863 Ga0307411_100318632 367
17 3300048905 Ga0496102_0001150 Ga0496102_0001150_8851_10056 369
18 3300026067 Ga0207678_10138849 Ga0207678_101388492 370
19 3300035695 Ga0373927_0009084 Ga0373927_0009084_4020_5243 370
20 3300037068 Ga0373925_0014737 Ga0373925_0014737_2483_3706 370
21 3300046535 Ga0495586_0019141 Ga0495586_0019141_1782_3005 370
22 3300053088 Ga0500644_0022148 Ga0500644_0022148_33_1244 370
23 3300053108 Ga0500562_005715 Ga0500562_005715_651_1862 370
24 3300005459 Ga0068867_100008541 Ga0068867_1000085413 371
25 3300005543 Ga0070672_100224546 Ga0070672_1002245462 371
26 3300005719 Ga0068861_100002598 Ga0068861_1000025986 371
27 3300005843 Ga0068860_100001219 Ga0068860_10000121928 371
28 3300005844 Ga0068862_100019823 Ga0068862_1000198233 371
29 3300013297 Ga0157378_10011125 Ga0157378_100111256 371
30 3300013306 Ga0163162_10004321 Ga0163162_1000432112 371
31 3300014326 Ga0157380_10064972 Ga0157380_100649724 371
32 3300014968 Ga0157379_10021862 Ga0157379_100218625 371
33 3300025938 Ga0207704_10202622 Ga0207704_102026221 371
34 3300026075 Ga0207708_10011916 Ga0207708_100119168 371
35 3300026089 Ga0207648_10000765 Ga0207648_1000076533 371
36 3300026118 Ga0207675_100001028 Ga0207675_10000102825 371
37 3300028380 Ga0268265_10009804 Ga0268265_100098045 371
38 3300028381 Ga0268264_10004657 Ga0268264_1000465710 371
39 3300048917 Ga0496114_0142907 Ga0496114_0142907_246_1448 371
40 3300048925 Ga0496122_0064881 Ga0496122_0064881_1011_2240 371
41 3300031456 Ga0307513_10098664 Ga0307513_100986642 372
42 3300031456 Ga0307513_10281717 Ga0307513_102817172 372
43 3300053136 Ga0500559_0000195 Ga0500559_0000195_455_1657 372
44 3300005617 Ga0068859_100152470 Ga0068859_1001524701 373
45 3300006931 Ga0097620_100152463 Ga0097620_1001524633 373
46 3300014968 Ga0157379_10098195 Ga0157379_100981953 373
47 3300030522 Ga0307512_10012282 Ga0307512_100122826 374
48 3300031507 Ga0307509_10002117 Ga0307509_1000211714 374
49 3300033180 Ga0307510_10016809 Ga0307510_100168095 374
50 3300046454 Ga0495592_0000370 Ga0495592_0000370_30299_31501 374
51 3300044842 Ga0466957_0005242 Ga0466957_0005242_2203_3411 375
52 3300006195 Ga0075366_10021986 Ga0075366_100219864 376
53 3300025273 Ga0209673_1002081 Ga0209673_10020819 376
54 3300039447 Ga0436361_0561928 Ga0436361_0561928_5465_6688 376
55 3300044712 Ga0453684_0000384 Ga0453684_0000384_92567_93775 376
56 3300053086 Ga0500578_0020786 Ga0500578_0020786_2188_3423 376
57 3300053730 Ga0500645_000801 Ga0500645_000801_1268_2503 376
58 3300046473 Ga0495582_0070245 Ga0495582_0070245_680_1837 377
59 3300003781 Ga0055536_1001865 Ga0055536_10018656 379
60 3300003792 Ga0055540_1001713 Ga0055540_10017136 379
61 3300009148 Ga0105243_10003767 Ga0105243_100037676 379
62 3300025292 Ga0209676_1000260 Ga0209676_1000260113 379
63 3300025303 Ga0209051_1000319 Ga0209051_100031973 379
64 3300025304 Ga0209257_1007485 Ga0209257_10074853 379
65 3300025935 Ga0207709_10002287 Ga0207709_1000228710 379
66 3300044712 Ga0453684_0003729 Ga0453684_0003729_23856_25064 379
67 3300045051 Ga0451576_0000169 Ga0451576_0000169_121375_122583 379
68 3300047321 Ga0495676_0026281 Ga0495676_0026281_142_1350 379
69 3300003322 rootL2_10008425 rootL2_1000842512 380
70 3300031251 Ga0265327_10000851 Ga0265327_1000085124 380
71 3300048088 Ga0495602_0155638 Ga0495602_0155638_634_1776 380
72 3300028794 Ga0307515_10000347 Ga0307515_1000034798 382
73 3300028794 Ga0307515_10012248 Ga0307515_1001224810 382
74 3300031507 Ga0307509_10017568 Ga0307509_100175685 382
75 3300031616 Ga0307508_10000392 Ga0307508_1000039220 382
76 3300031649 Ga0307514_10018273 Ga0307514_100182735 382
77 3300033179 Ga0307507_10025359 Ga0307507_100253597 382
78 3300053088 Ga0500644_0016184 Ga0500644_0016184_411_1613 382
79 3300033180 Ga0307510_10057049 Ga0307510_100570494 383
80 3300046460 Ga0495638_0073304 Ga0495638_0073304_434_1636 383
81 3300048924 Ga0496121_0002603 Ga0496121_0002603_1882_3090 383
82 3300048928 Ga0496125_0012324 Ga0496125_0012324_2869_4077 383
83 3300053118 Ga0500594_0000934 Ga0500594_0000934_1197_2399 383
84 3300031251 Ga0265327_10005998 Ga0265327_100059986 384
85 3300028794 Ga0307515_10002435 Ga0307515_1000243520 385
86 3300046660 Ga0495625_0008969 Ga0495625_0008969_6569_7774 385
87 3300006353 Ga0075370_10003275 Ga0075370_100032753 386
88 3300031456 Ga0307513_10091856 Ga0307513_100918562 386
89 3300031730 Ga0307516_10001538 Ga0307516_100015387 386
90 3300041509 Ga0451843_1322652 Ga0451843_1322652_41_1246 386
91 3300046515 Ga0495620_0048211 Ga0495620_0048211_252_1457 386
92 3300050496 nmdc:mga07m45_637_c1 nmdc:mga07m45_637_c1_12331_13539 386
93 3300015683 Ga0183362_10003 Ga0183362_10003399 387
94 3300028794 Ga0307515_10081962 Ga0307515_100819622 387
95 3300041411 Ga0439466_0006727 Ga0439466_0006727_1323_2531 387
96 3300042002 Ga0439442_001009 Ga0439442_001009_2144_3352 387
97 3300042125 Ga0450923_000531 Ga0450923_000531_430_1638 387
98 3300042134 Ga0450898_008436 Ga0450898_008436_86_1294 387
99 3300042184 Ga0450908_003789 Ga0450908_003789_1618_2826 387
100 3300042435 Ga0439434_0004079 Ga0439434_0004079_2001_3209 387
101 iso_pu_bacteria 2643221683 2644469167 387
102 3300005459 Ga0068867_100154347 Ga0068867_1001543472 388
103 3300005718 Ga0068866_10021809 Ga0068866_100218094 388
104 3300009553 Ga0105249_10038310 Ga0105249_100383103 388
105 3300025292 Ga0209676_1015719 Ga0209676_10157193 388
106 3300041997 Ga0439431_0010048 Ga0439431_0010048_518_1726 388
107 3300042122 Ga0450920_013455 Ga0450920_013455_59_1267 388
108 3300046660 Ga0495625_0000896 Ga0495625_0000896_21475_22683 388
109 3300028794 Ga0307515_10047560 Ga0307515_100475605 389
110 3300031456 Ga0307513_10086875 Ga0307513_100868754 389
111 3300046517 Ga0495630_0153252 Ga0495630_0153252_444_1646 389
112 3300046674 Ga0495588_0015389 Ga0495588_0015389_1283_2497 389
113 3300046689 Ga0495613_0175536 Ga0495613_0175536_260_1462 389
114 3300046690 Ga0495624_0081270 Ga0495624_0081270_367_1569 389
115 3300047321 Ga0495676_0103644 Ga0495676_0103644_277_1479 389
116 3300047673 Ga0495593_0033930 Ga0495593_0033930_854_2056 389
117 3300003773 Ga0055537_1001046 Ga0055537_10010463 390
118 3300003784 Ga0055534_1000401 Ga0055534_100040124 390
119 3300003790 Ga0055528_1003559 Ga0055528_10035593 390
120 3300006948 Ga0099826_10013421 Ga0099826_100134213 390
121 3300014968 Ga0157379_10090073 Ga0157379_100900733 390
122 3300017792 Ga0163161_10010912 Ga0163161_100109126 390
123 3300025263 Ga0209565_1000175 Ga0209565_100017582 390
124 3300025273 Ga0209673_1000099 Ga0209673_100009982 390
125 3300025291 Ga0209675_1000054 Ga0209675_100005482 390
126 3300025291 Ga0209675_1004395 Ga0209675_10043952 390
127 3300025294 Ga0209025_1013915 Ga0209025_10139153 390
128 3300025294 Ga0209025_1016601 Ga0209025_10166014 390
129 3300027666 Ga0209282_1000328 Ga0209282_10003283 390
130 3300032004 Ga0307414_10043275 Ga0307414_100432753 390
131 3300042004 Ga0439445_0005390 Ga0439445_0005390_1523_2728 390
132 3300042115 Ga0450911_000061 Ga0450911_000061_22031_23236 390
133 3300046518 Ga0495631_0002245 Ga0495631_0002245_35_1207 390
134 3300048927 Ga0496124_0276609 Ga0496124_0276609_25_1197 390
135 3300048928 Ga0496125_0012084 Ga0496125_0012084_6163_7437 390
136 3300048928 Ga0496125_0037100 Ga0496125_0037100_1063_2268 390
137 3300048929 Ga0496126_0080866 Ga0496126_0080866_768_1973 390
138 3300050496 nmdc:mga07m45_3999_c1 nmdc:mga07m45_3999_c1_5699_6871 390
139 3300005367 Ga0070667_100001132 Ga0070667_1000011326 391
140 3300005539 Ga0068853_100132171 Ga0068853_1001321712 391
141 3300005548 Ga0070665_100362782 Ga0070665_1003627822 391
142 3300009093 Ga0105240_10003282 Ga0105240_1000328221 391
143 3300009545 Ga0105237_10001435 Ga0105237_1000143515 391
144 3300009551 Ga0105238_10035600 Ga0105238_100356003 391
145 3300010375 Ga0105239_10001553 Ga0105239_1000155315 391
146 3300013308 Ga0157375_10263770 Ga0157375_102637702 391
147 3300025924 Ga0207694_10039803 Ga0207694_100398034 391
148 3300025986 Ga0207658_10001749 Ga0207658_1000174920 391
149 3300026041 Ga0207639_10059021 Ga0207639_100590213 391
150 3300003781 Ga0055536_1030988 Ga0055536_10309881 392
151 3300003784 Ga0055534_1002653 Ga0055534_10026532 392
152 3300025284 Ga0209130_1005272 Ga0209130_10052724 392
153 3300025291 Ga0209675_1001575 Ga0209675_10015756 392
154 3300025292 Ga0209676_1006720 Ga0209676_10067203 392
155 3300025298 Ga0209050_1019190 Ga0209050_10191902 392
156 3300025303 Ga0209051_1010230 Ga0209051_10102302 392
157 3300025304 Ga0209257_1007871 Ga0209257_10078716 392
158 3300031730 Ga0307516_10005041 Ga0307516_1000504114 392
159 3300037068 Ga0373925_0026637 Ga0373925_0026637_100_1317 392
160 3300031456 Ga0307513_10094081 Ga0307513_100940815 393
161 3300048089 Ga0495614_0032663 Ga0495614_0032663_19_1230 393
162 3300048911 Ga0496108_0028950 Ga0496108_0028950_281_1471 394
163 iso_pu_bacteria 2842747753 2842747864 394
164 iso_pu_bacteria 2928115317 2928119360 395
165 3300005843 Ga0068860_100038522 Ga0068860_1000385223 396
166 3300005844 Ga0068862_100012222 Ga0068862_1000122225 396
167 3300005844 Ga0068862_100089766 Ga0068862_1000897662 396
168 3300026118 Ga0207675_100285304 Ga0207675_1002853042 396
169 3300028380 Ga0268265_10076744 Ga0268265_100767442 396
170 3300050509 nmdc:mga0qj67_245562_c1 nmdc:mga0qj67_245562_c1_205_1407 396
171 iso_pu_bacteria 2842733646 2842736793 396
172 iso_pu_bacteria 2885192300 2885193421 396
173 3300005353 Ga0070669_100023484 Ga0070669_1000234845 397
174 3300006195 Ga0075366_10001878 Ga0075366_100018783 397
175 3300014497 Ga0182008_10002071 Ga0182008_100020714 397
176 3300025923 Ga0207681_10052887 Ga0207681_100528871 397
177 3300028786 Ga0307517_10004027 Ga0307517_1000402718 397
178 3300031456 Ga0307513_10088835 Ga0307513_100888352 397
179 3300031616 Ga0307508_10001804 Ga0307508_100018046 397
180 3300039447 Ga0436361_0425741 Ga0436361_0425741_7147_8370 397
181 3300044712 Ga0453684_0073453 Ga0453684_0073453_2059_3267 397
182 3300048925 Ga0496122_0000688 Ga0496122_0000688_51803_53008 397
183 3300048925 Ga0496122_0049457 Ga0496122_0049457_800_2008 397
184 3300048926 Ga0496123_0001158 Ga0496123_0001158_23332_24537 397
185 3300048927 Ga0496124_0032773 Ga0496124_0032773_2222_3427 397
186 3300053136 Ga0500559_0012713 Ga0500559_0012713_1478_2683 397
187 iso_pu_bacteria 2738543013 2739249628 397
188 3300014968 Ga0157379_10332179 Ga0157379_103321792 398
189 3300028786 Ga0307517_10185020 Ga0307517_101850202 398
190 3300028794 Ga0307515_10000049 Ga0307515_10000049243 398
191 3300028794 Ga0307515_10000066 Ga0307515_1000006672 398
192 3300031456 Ga0307513_10152707 Ga0307513_101527073 398
193 3300031507 Ga0307509_10045445 Ga0307509_100454453 398
194 3300031548 Ga0307408_100068783 Ga0307408_1000687833 398
195 3300031911 Ga0307412_10005171 Ga0307412_100051716 398
196 3300032002 Ga0307416_100014412 Ga0307416_1000144123 398
197 3300033180 Ga0307510_10013446 Ga0307510_100134469 398
198 3300048905 Ga0496102_0028412 Ga0496102_0028412_2671_3876 398
199 3300053136 Ga0500559_0001309 Ga0500559_0001309_9871_11082 398
200 3300053148 Ga0500590_013646 Ga0500590_013646_1187_2389 398
201 iso_pu_bacteria 2513020051 2513227989 398
202 iso_pu_bacteria 2585428062 2587758878 398
203 iso_pu_bacteria 2599185214 2599624043 398
204 iso_pu_bacteria 2599185226 2599672054 398
205 iso_pu_bacteria 2599185227 2599681864 398
206 iso_pu_bacteria 2599185229 2599693877 398
207 iso_pu_bacteria 2643221628 2644162611 398
208 iso_pu_bacteria 2643221658 2644328800 398
209 iso_pu_bacteria 2643221672 2644397981 398
210 iso_pu_bacteria 2738541307 2738881452 398
211 iso_pu_bacteria 2818991446 2819596492 398
212 iso_pu_bacteria 2831265667 2831269530 398
213 iso_pu_bacteria 2838054893 2838060021 398
214 iso_pu_bacteria 2885198086 2885199626 398
215 iso_pu_bacteria 2885211737 2885213101 398
216 iso_pu_bacteria 2899924645 2899931209 398
217 iso_pu_bacteria 2919462493 2919464996 398
218 iso_pu_bacteria 2928037797 2928038018 398
219 iso_pu_bacteria 2928044640 2928046376 398
220 iso_pu_bacteria 2928051484 2928054072 398
221 iso_pu_bacteria 2928064002 2928065825 398
222 iso_pu_bacteria 2928070936 2928076725 398
223 iso_pu_bacteria 2928084124 2928090525 398
224 iso_pu_bacteria 2945945610 2945948734 398
225 iso_pu_bacteria 2945972063 2945972858 398
226 iso_pu_bacteria 2954767861 2954772877 398
227 3300006178 Ga0075367_10033583 Ga0075367_100335832 399
228 3300028794 Ga0307515_10000219 Ga0307515_10000219115 399
229 3300028794 Ga0307515_10013197 Ga0307515_100131978 399
230 3300031456 Ga0307513_10063060 Ga0307513_100630604 399
231 3300031507 Ga0307509_10008345 Ga0307509_100083459 399
232 3300031507 Ga0307509_10008437 Ga0307509_100084379 399
233 3300031616 Ga0307508_10001018 Ga0307508_100010182 399
234 3300041407 Ga0439447_005462 Ga0439447_005462_591_1796 399
235 3300041997 Ga0439431_0000498 Ga0439431_0000498_162_1367 399
236 3300041999 Ga0439433_0008161 Ga0439433_0008161_340_1545 399
237 3300042004 Ga0439445_0001052 Ga0439445_0001052_528_1733 399
238 3300042006 Ga0439432_008862 Ga0439432_008862_713_1918 399
239 3300042007 Ga0439449_0007720 Ga0439449_0007720_2417_3622 399
240 3300042014 Ga0439457_003333 Ga0439457_003333_867_2072 399
241 3300042435 Ga0439434_0016372 Ga0439434_0016372_826_2031 399
242 3300044901 Ga0466960_0028914 Ga0466960_0028914_338_1555 399
243 3300050496 nmdc:mga07m45_14769_c1 nmdc:mga07m45_14769_c1_2059_3267 399
244 iso_pu_bacteria 2643221654 2644303894 399
245 iso_pu_bacteria 2904449895 2904450076 399
246 iso_pu_bacteria 2904456579 2904457108 399
247 iso_pu_bacteria 2929520902 2929525359 399
248 iso_pu_bacteria 2945909444 2945913090 399
249 iso_pu_bacteria 2945984333 2945984623 399
250 3300005618 Ga0068864_100008599 Ga0068864_1000085996 400
251 3300005841 Ga0068863_100008729 Ga0068863_1000087293 400
252 3300005842 Ga0068858_100075588 Ga0068858_1000755883 400
253 3300006195 Ga0075366_10019777 Ga0075366_100197774 400
254 3300009098 Ga0105245_10014972 Ga0105245_100149726 400
255 3300014325 Ga0163163_10056936 Ga0163163_100569364 400
256 3300025927 Ga0207687_10010676 Ga0207687_100106764 400
257 3300026088 Ga0207641_10092528 Ga0207641_100925282 400
258 3300026095 Ga0207676_10006096 Ga0207676_100060964 400
259 3300041404 Ga0439436_0003789 Ga0439436_0003789_2504_3718 400
260 3300041410 Ga0439461_0014126 Ga0439461_0014126_148_1362 400
261 3300041411 Ga0439466_0003353 Ga0439466_0003353_1993_3207 400
262 3300042002 Ga0439442_010391 Ga0439442_010391_620_1834 400
263 3300042006 Ga0439432_002426 Ga0439432_002426_5524_6738 400
264 3300042007 Ga0439449_0002385 Ga0439449_0002385_620_1834 400
265 3300042015 Ga0439462_0002381 Ga0439462_0002381_1520_2734 400
266 3300042134 Ga0450898_008307 Ga0450898_008307_173_1387 400
267 3300042435 Ga0439434_0009389 Ga0439434_0009389_1136_2350 400
268 3300050489 nmdc:mga03683_5284_c1 nmdc:mga03683_5284_c1_2143_3357 400
269 3300050493 nmdc:mga0k408_11117_c1 nmdc:mga0k408_11117_c1_1534_2748 400
270 3300050496 nmdc:mga07m45_14996_c1 nmdc:mga07m45_14996_c1_459_1673 400
271 iso_pu_bacteria 2904541872 2904543912 400
272 iso_pu_bacteria 2929160207 2929162529 400
273 3300002773 JGI25152J39213_1001387 JGI25152J39213_100138711 402
274 3300002773 JGI25152J39213_1010797 JGI25152J39213_10107972 402
275 3300002774 JGI25150J39212_1002097 JGI25150J39212_10020974 402
276 3300002987 JGI25159J45721_1001737 JGI25159J45721_10017379 402
277 3300003187 JGI25151J46595_10002659 JGI25151J46595_100026592 402
278 3300003187 JGI25151J46595_10015933 JGI25151J46595_100159332 402
279 3300003215 JGI25153J46596_10002893 JGI25153J46596_1000289310 402
280 3300003354 JGI25160J50197_1001995 JGI25160J50197_100199510 402
281 3300003374 JGI25161J50226_1000931 JGI25161J50226_10009312 402
282 3300003374 JGI25161J50226_1001029 JGI25161J50226_100102910 402
283 3300003761 Ga0055535_1000392 Ga0055535_100039222 402
284 3300003762 Ga0055542_1000033 Ga0055542_100003358 402
285 3300003771 Ga0055526_1003591 Ga0055526_100359110 402
286 3300003771 Ga0055526_1003609 Ga0055526_100360910 402
287 3300003773 Ga0055537_1001375 Ga0055537_100137510 402
288 3300003775 Ga0055524_1002382 Ga0055524_100238210 402
289 3300003775 Ga0055524_1002402 Ga0055524_100240210 402
290 3300003781 Ga0055536_1002374 Ga0055536_100237410 402
291 3300003781 Ga0055536_1006469 Ga0055536_10064695 402
292 3300003784 Ga0055534_1003249 Ga0055534_10032495 402
293 3300003784 Ga0055534_1007561 Ga0055534_10075614 402
294 3300003790 Ga0055528_1002529 Ga0055528_100252910 402
295 3300003791 Ga0055530_10000894 Ga0055530_100008943 402
296 3300003791 Ga0055530_10002156 Ga0055530_100021565 402
297 3300003791 Ga0055530_10006200 Ga0055530_100062001 402
298 3300003792 Ga0055540_1000672 Ga0055540_10006728 402
299 3300003792 Ga0055540_1006892 Ga0055540_10068922 402
300 3300003794 Ga0055531_10000926 Ga0055531_1000092620 402
301 3300003794 Ga0055531_10011053 Ga0055531_100110534 402
302 3300003794 Ga0055531_10014952 Ga0055531_100149523 402
303 3300004625 Ga0055543_1002672 Ga0055543_10026722 402
304 3300005262 Ga0065165_1003935 Ga0065165_10039352 402
305 3300005262 Ga0065165_1014132 Ga0065165_10141321 402
306 3300005563 Ga0068855_100081726 Ga0068855_1000817263 402
307 3300005564 Ga0070664_100017963 Ga0070664_1000179635 402
308 3300005616 Ga0068852_100164101 Ga0068852_1001641012 402
309 3300005834 Ga0068851_10017496 Ga0068851_100174964 402
310 3300006353 Ga0075370_10000784 Ga0075370_100007847 402
311 3300006353 Ga0075370_10014286 Ga0075370_100142863 402
312 3300009148 Ga0105243_10002338 Ga0105243_100023383 402
313 3300009148 Ga0105243_10023765 Ga0105243_100237653 402
314 3300011119 Ga0105246_10017494 Ga0105246_100174942 402
315 3300013100 Ga0157373_10205869 Ga0157373_102058692 402
316 3300013104 Ga0157370_10008173 Ga0157370_100081737 402
317 3300013105 Ga0157369_10018464 Ga0157369_100184647 402
318 3300014497 Ga0182008_10001298 Ga0182008_1000129818 402
319 3300014497 Ga0182008_10006660 Ga0182008_100066606 402
320 3300014969 Ga0157376_10117988 Ga0157376_101179882 402
321 3300015261 Ga0182006_1000895 Ga0182006_100089511 402
322 3300015262 Ga0182007_10000647 Ga0182007_1000064712 402
323 3300017792 Ga0163161_10000166 Ga0163161_1000016619 402
324 3300025228 Ga0209672_100794 Ga0209672_10079416 402
325 3300025229 Ga0209147_104087 Ga0209147_1040872 402
326 3300025242 Ga0209258_100089 Ga0209258_10008957 402
327 3300025245 Ga0207425_1000603 Ga0207425_100060320 402
328 3300025245 Ga0207425_1011544 Ga0207425_10115442 402
329 3300025254 Ga0209148_1000097 Ga0209148_100009757 402
330 3300025258 Ga0209129_1000071 Ga0209129_1000071166 402
331 3300025263 Ga0209565_1000334 Ga0209565_100033439 402
332 3300025273 Ga0209673_1001065 Ga0209673_100106526 402
333 3300025273 Ga0209673_1001338 Ga0209673_10013388 402
334 3300025284 Ga0209130_1000456 Ga0209130_100045620 402
335 3300025284 Ga0209130_1000812 Ga0209130_100081219 402
336 3300025291 Ga0209675_1001110 Ga0209675_10011106 402
337 3300025291 Ga0209675_1001269 Ga0209675_10012693 402
338 3300025292 Ga0209676_1000005 Ga0209676_100000519 402
339 3300025292 Ga0209676_1001229 Ga0209676_100122922 402
340 3300025292 Ga0209676_1024453 Ga0209676_10244532 402
341 3300025294 Ga0209025_1000854 Ga0209025_100085413 402
342 3300025294 Ga0209025_1001065 Ga0209025_100106514 402
343 3300025294 Ga0209025_1001409 Ga0209025_100140918 402
344 3300025295 Ga0209564_1000239 Ga0209564_100023989 402
345 3300025295 Ga0209564_1000890 Ga0209564_100089026 402
346 3300025297 Ga0209758_1000027 Ga0209758_1000027343 402
347 3300025298 Ga0209050_1000007 Ga0209050_10000071079 402
348 3300025298 Ga0209050_1000954 Ga0209050_100095419 402
349 3300025299 Ga0209256_1000081 Ga0209256_1000081166 402
350 3300025299 Ga0209256_1003946 Ga0209256_10039462 402
351 3300025302 Ga0207426_1000027 Ga0207426_1000027308 402
352 3300025302 Ga0207426_1000614 Ga0207426_100061412 402
353 3300025303 Ga0209051_1000009 Ga0209051_100000919 402
354 3300025303 Ga0209051_1000619 Ga0209051_100061922 402
355 3300025303 Ga0209051_1014811 Ga0209051_10148113 402
356 3300025304 Ga0209257_1000873 Ga0209257_100087320 402
357 3300025304 Ga0209257_1002439 Ga0209257_10024398 402
358 3300025304 Ga0209257_1011229 Ga0209257_10112292 402
359 3300025728 Ga0207655_1002596 Ga0207655_100259614 402
360 3300025913 Ga0207695_10192513 Ga0207695_101925133 402
361 3300025914 Ga0207671_10039364 Ga0207671_100393642 402
362 3300025924 Ga0207694_10074862 Ga0207694_100748623 402
363 3300025935 Ga0207709_10001232 Ga0207709_1000123212 402
364 3300025935 Ga0207709_10129027 Ga0207709_101290272 402
365 3300025945 Ga0207679_10072549 Ga0207679_100725492 402
366 3300025949 Ga0207667_10146630 Ga0207667_101466302 402
367 3300026041 Ga0207639_10107742 Ga0207639_101077423 402
368 3300026142 Ga0207698_10095760 Ga0207698_100957603 402
369 3300031649 Ga0307514_10056033 Ga0307514_100560334 402
370 3300046453 Ga0495627_006311 Ga0495627_006311_2022_3254 402
371 3300046459 Ga0495629_0160954 Ga0495629_0160954_51_1259 402
372 3300046460 Ga0495638_0033194 Ga0495638_0033194_698_1906 402
373 3300046512 Ga0495610_0010133 Ga0495610_0010133_3904_5112 402
374 3300046513 Ga0495616_0022905 Ga0495616_0022905_633_1841 402
375 3300046515 Ga0495620_0035242 Ga0495620_0035242_229_1437 402
376 3300046520 Ga0495637_0004546 Ga0495637_0004546_3709_4920 402
377 3300046539 Ga0495621_0007194 Ga0495621_0007194_770_1978 402
378 3300046616 Ga0495668_0024457 Ga0495668_0024457_1884_3092 402
379 3300046674 Ga0495588_0012218 Ga0495588_0012218_1619_2827 402
380 3300046674 Ga0495588_0040798 Ga0495588_0040798_584_1795 402
381 3300046683 Ga0495658_0018565 Ga0495658_0018565_319_1527 402
382 3300046692 Ga0495671_0050380 Ga0495671_0050380_375_1586 402
383 3300046810 Ga0495660_0019101 Ga0495660_0019101_298_1509 402
384 3300047318 Ga0495636_0021809 Ga0495636_0021809_145_1527 402
385 3300047673 Ga0495593_0030036 Ga0495593_0030036_1713_2921 402
386 3300048089 Ga0495614_0021155 Ga0495614_0021155_884_2092 402
387 3300048919 Ga0496116_0042787 Ga0496116_0042787_1555_2763 402
388 3300048920 Ga0496117_0035531 Ga0496117_0035531_456_1664 402
389 3300048921 Ga0496118_0015401 Ga0496118_0015401_4372_5580 402
390 3300048921 Ga0496118_0078733 Ga0496118_0078733_161_1369 402
391 3300048925 Ga0496122_0025558 Ga0496122_0025558_1442_2674 402
392 3300048926 Ga0496123_0030384 Ga0496123_0030384_1115_2326 402
393 3300048927 Ga0496124_0191536 Ga0496124_0191536_228_1436 402
394 3300048928 Ga0496125_0015670 Ga0496125_0015670_5978_7186 402
395 3300053087 Ga0500643_012370 Ga0500643_012370_1432_2640 402
396 3300053093 Ga0500651_0000029 Ga0500651_0000029_101162_102370 402
397 3300053108 Ga0500562_007153 Ga0500562_007153_1271_2479 402
398 3300053110 Ga0500571_000115 Ga0500571_000115_7443_8651 402
399 3300053117 Ga0500593_000703 Ga0500593_000703_2481_3692 402
400 3300053121 Ga0500607_001057 Ga0500607_001057_8233_9444 402
401 3300053121 Ga0500607_034327 Ga0500607_034327_1268_2479 402
402 3300053122 Ga0500608_008770 Ga0500608_008770_2042_3250 402
403 3300053133 Ga0500655_001331 Ga0500655_001331_2049_3257 402
404 3300053134 Ga0500658_0000245 Ga0500658_0000245_16990_18198 402
405 3300053134 Ga0500658_0000252 Ga0500658_0000252_7258_8466 402
406 3300053136 Ga0500559_0004121 Ga0500559_0004121_4307_5515 402
407 3300053138 Ga0500564_015041 Ga0500564_015041_824_2032 402
408 3300053161 Ga0500634_0021440 Ga0500634_0021440_838_2046 402
409 iso_pu_bacteria 2738541277 2738719953 402
410 iso_pu_bacteria 2738543019 2739279152 402
411 3300001989 JGI24739J22299_10011902 JGI24739J22299_100119023 403
412 3300003187 JGI25151J46595_10001719 JGI25151J46595_100017193 403
413 3300003792 Ga0055540_1001287 Ga0055540_100128712 403
414 3300006353 Ga0075370_10005140 Ga0075370_100051406 403
415 3300014497 Ga0182008_10016898 Ga0182008_100168984 403
416 3300025294 Ga0209025_1001296 Ga0209025_100129632 403
417 3300025303 Ga0209051_1000661 Ga0209051_100066126 403
418 3300032004 Ga0307414_10042076 Ga0307414_100420763 403
419 3300050489 nmdc:mga03683_3988_c1 nmdc:mga03683_3988_c1_2286_3497 403
420 3300050492 nmdc:mga0yw44_125962_c1 nmdc:mga0yw44_125962_c1_300_1511 403

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02801

Ketoacyl-synt_C

Beta-ketoacyl synthase, C-terminal domain

244

357

0.97

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

1

236

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hnz-assembly1.cif.gz_A structure of e. coli fabf(c163a) in complex with platensimycin 0.9552 2 403
2gfy-assembly1.cif.gz_A-2 structure of e. coli fabf(k335a) mutant with covalently linked dodecanoic acid 0.9545 2 403
6olt-assembly1.cif.gz_A crosslinked crystal structure of type ii fatty acid synthase ketosynthase, fabf, and c12-crypto acyl carrier protein, acpp 0.9538 1 403
4r8e-assembly1.cif.gz_B crystal structure of beta-ketoacyl-acp synthase ii (fabf) from yersinia pestis 0.9535 2 403
4jrm-assembly2.cif.gz_B crystal structure of beta-ketoacyl-acp synthase ii (fabf) from vibrio cholerae (space group p212121) at 1.75 angstrom 0.9531 2 403
ID Description Score Start End Superfamily
af_C6KT99_32_472_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9551 2 403 3.40.47.10
af_P0AAI5_1_413_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9528 2 403 3.40.47.10
af_C6KT99_32_472_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9505 2 403 3.40.47.10
4ewgB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.95 254 403 3.40.47.10
4xoxB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9492 254 403 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A353Y2R0-F1-model_v4 Beta-ketoacyl-ACP synthase 0.9808 241 369 GO:0004315
GO:0005829
GO:0006633
AF-A0A7C7PAC7-F1-model_v4 Nodulation protein E (Host-specificity of nodulation protein B) 0.9682 105 403 GO:0004315
GO:0006633
AF-A0A7C7GJ16-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase II 0.967 162 403 GO:0004315
GO:0005829
GO:0006633
AF-X0YZS4-F1-model_v4 Ketosynthase family 3 (KS3) domain-containing protein 0.9653 234 403 GO:0004315
GO:0005829
GO:0006633
AF-A0A530L7T1-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase II 0.9641 123 245 GO:0004315
GO:0005829
GO:0006633

Feature Viewer

pLDDT pTM Quality
93.26 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map