F439748

General Info

Members Datasets Scaffolds Average Seq Length
420 241 349 253

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10101959|Ga0105246_101019592
Length 292
Sequence MRHLIALFTTWYCNTKKALWLTFPFNLGLSPLLSPSEPDSMIDIVILCVFAFSAGLIDAAVGGGGLIQIPALFNVLPTAQPAALLGTNKVAAACGTAFAARSFVRKVVINWSLVIPAASAAFVMSFFGAATVSFVPQSVIRPAVLVLIVLMAIYTFWKKDFGALHKPMHIGTKEKLLAIVIGGAIGFYDGLFGPGTGSFLIFLFIRCFAFDFLHASASAKLVNIATNVAALMFFIPTGNVLYLIAIPMAAFNILGALTGTWLAVHKGAPFVRALFLVLLLILIGKLSYDLFV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231007 Pseudomonas sp. GM18 Isolate Nodule
4 2511231016 Pseudomonas sp. GM50 Isolate Nodule
5 2511231022 Pseudomonas sp. GM79 Isolate Nodule
6 2511231024 Pseudomonas sp. GM84 Isolate Nodule
7 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
8 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
9 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
10 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
11 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
12 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
13 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
14 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
15 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
16 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
17 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
18 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
19 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
20 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
21 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
22 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
23 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
24 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
25 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
26 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
27 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
28 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
29 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
30 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
31 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
32 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
33 2765235841 Pseudomonas putida AA7 Isolate Unclassified
34 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
35 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
36 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
37 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
38 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
39 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
40 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
41 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
42 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
43 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
44 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
45 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
46 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
47 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
48 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
49 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
50 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
51 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
52 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
53 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
54 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
55 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
56 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
57 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
58 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
59 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
60 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
61 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
62 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
63 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
64 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
65 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
66 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
67 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
68 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
69 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
70 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
71 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
72 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
73 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
74 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
77 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
78 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
79 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
121 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
125 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
126 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
139 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
140 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
141 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
142 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
143 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
144 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
145 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
146 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
147 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
148 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
149 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
150 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
151 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
152 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
157 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
168 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
169 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
173 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
178 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
183 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
188 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
208 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
229 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
232 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
233 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
234 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
235 8052494512 Pseudomonas putida LD6 Isolate Unclassified
236 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
237 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
238 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
239 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
240 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
241 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.1
Metatranscriptomes 0
Isolates 16.9

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 3.81
Nodule 1.67
Rhizoplane 5.24
Rhizosphere 72.38
Stem 0
Stem Tuber 0
Unclassified 16.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1738858 2162886007 Bacteria 5335
2 SwRhRL2b_contig_3325370 2162886007 Bacteria 2520
3 SwRhRL2b_contig_938429 2162886007 Bacteria 2953
4 JGI25162J39368_1000045 3300002737 Bacteria 170731
5 JGI25163J39215_1000286 3300002771 Bacteria 17369
6 JGI25164J39214_1000147 3300002772 Bacteria 67564
7 JGI25165J46597_1000086 3300003214 Bacteria 170731
8 rootL2_10000116 3300003322 Bacteria 29881
9 Ga0055536_1002193 3300003781 Bacteria 11123
10 Ga0055536_1020649 3300003781 Bacteria 2026
11 Ga0058692_1000007 3300003856 Bacteria 366313
12 Ga0058692_1000061 3300003856 Bacteria 98304
13 Ga0058692_1015011 3300003856 Bacteria 1756
14 Ga0065703_1000503 3300005272 Bacteria 59697
15 Ga0065714_10002075 3300005288 Bacteria 2143
16 Ga0065714_10003804 3300005288 Bacteria 6218
17 Ga0065714_10013264 3300005288 Bacteria 3687
18 Ga0065704_10004354 3300005289 Bacteria 3832
19 Ga0065704_10022617 3300005289 Bacteria 1006
20 Ga0065704_10070431 3300005289 Bacteria 25069
21 Ga0065704_10070585 3300005289 Bacteria 19742
22 Ga0065704_10075826 3300005289 Bacteria 5398
23 Ga0065704_10123544 3300005289 Bacteria 1731
24 Ga0065712_10072326 3300005290 Bacteria 4803
25 Ga0070660_100104571 3300005339 Bacteria 2246
26 Ga0070669_100002127 3300005353 Bacteria 14327
27 Ga0070673_100074480 3300005364 Bacteria 2736
28 Ga0070659_100102304 3300005366 Bacteria 2306
29 Ga0070708_100339059 3300005445 Bacteria 1417
30 Ga0070665_100023617 3300005548 Bacteria 6191
31 Ga0070664_100341893 3300005564 Bacteria 1359
32 Ga0075364_10006630 3300006051 Bacteria 6820
33 Ga0075364_10063633 3300006051 Bacteria 2422
34 Ga0099823_1000006 3300006944 Bacteria 135028
35 Ga0105251_10005420 3300009011 Bacteria 8341
36 Ga0105251_10064698 3300009011 Bacteria 1713
37 Ga0105251_10081602 3300009011 Bacteria 1494
38 Ga0105251_10162950 3300009011 Bacteria 1005
39 Ga0105244_10001830 3300009036 Bacteria 16634
40 Ga0105244_10002834 3300009036 Bacteria 12867
41 Ga0105244_10003046 3300009036 Bacteria 12298
42 Ga0105244_10004469 3300009036 Bacteria 9607
43 Ga0105244_10018008 3300009036 Bacteria 3976
44 Ga0105244_10037841 3300009036 Bacteria 2519
45 Ga0105244_10042874 3300009036 Bacteria 2337
46 Ga0105244_10138914 3300009036 Bacteria 1170
47 Ga0105250_10000034 3300009092 Bacteria 157547
48 Ga0105250_10006006 3300009092 Bacteria 5356
49 Ga0105250_10024879 3300009092 Bacteria 2413
50 Ga0105250_10040142 3300009092 Bacteria 1877
51 Ga0105240_10003913 3300009093 Bacteria 23003
52 Ga0105247_10033531 3300009101 Bacteria 3123
53 Ga0105247_10203066 3300009101 Bacteria 1333
54 Ga0105243_10000835 3300009148 Bacteria 29277
55 Ga0105243_10002910 3300009148 Bacteria 14172
56 Ga0105243_10138709 3300009148 Bacteria 2072
57 Ga0105243_10142205 3300009148 Bacteria 2048
58 Ga0105243_10142388 3300009148 Bacteria 2047
59 Ga0105249_10000066 3300009553 Bacteria 149801
60 Ga0105246_10074021 3300011119 Bacteria 2406
61 Ga0105246_10101959 3300011119 Bacteria 2092
62 Ga0157371_10000045 3300013102 Bacteria 189065
63 Ga0157371_10011307 3300013102 Bacteria 6889
64 Ga0163162_10366829 3300013306 Bacteria 1573
65 Ga0182008_10000114 3300014497 Bacteria 61409
66 Ga0182008_10000355 3300014497 Bacteria 35722
67 Ga0182008_10040095 3300014497 Bacteria 2339
68 Ga0182006_1000067 3300015261 Bacteria 147932
69 Ga0182006_1000083 3300015261 Bacteria 118727
70 Ga0182006_1026661 3300015261 Bacteria 2364
71 Ga0182007_10000086 3300015262 Bacteria 69920
72 Ga0182007_10000123 3300015262 Bacteria 53953
73 Ga0182005_1000002 3300015265 Bacteria 908499
74 Ga0182005_1001499 3300015265 Bacteria 9312
75 Ga0163161_10001818 3300017792 Bacteria 15573
76 Ga0163161_10031470 3300017792 Bacteria 3780
77 Ga0163161_10133585 3300017792 Bacteria 1874
78 Ga0163161_10150070 3300017792 Bacteria 1771
79 Ga0163161_10221791 3300017792 Bacteria 1464
80 Ga0213872_10000192 3300021361 Bacteria 54234
81 Ga0213872_10000425 3300021361 Bacteria 34570
82 Ga0213872_10008655 3300021361 Bacteria 4913
83 Ga0209760_100019 3300025207 Bacteria 170806
84 Ga0209563_100747 3300025230 Bacteria 10005
85 Ga0207427_100011 3300025231 Bacteria 640076
86 Ga0209437_100044 3300025233 Bacteria 430619
87 Ga0209759_1020617 3300025256 Bacteria 1524
88 Ga0209233_1000057 3300025261 Bacteria 430619
89 Ga0209676_1000292 3300025292 Bacteria 101778
90 Ga0207696_1000018 3300025711 Bacteria 478605
91 Ga0207696_1000107 3300025711 Bacteria 157537
92 Ga0207696_1008887 3300025711 Bacteria 3790
93 Ga0207696_1019592 3300025711 Bacteria 2198
94 Ga0207696_1022162 3300025711 Bacteria 2023
95 Ga0207655_1000014 3300025728 Bacteria 607124
96 Ga0207655_1000081 3300025728 Bacteria 214272
97 Ga0207655_1000094 3300025728 Bacteria 196748
98 Ga0207655_1000180 3300025728 Bacteria 112767
99 Ga0207655_1000481 3300025728 Bacteria 51474
100 Ga0207655_1000613 3300025728 Bacteria 43127
101 Ga0207655_1005084 3300025728 Bacteria 9093
102 Ga0207655_1011118 3300025728 Bacteria 5390
103 Ga0207655_1013557 3300025728 Bacteria 4670
104 Ga0207655_1015549 3300025728 Bacteria 4221
105 Ga0207655_1043712 3300025728 Bacteria 1890
106 Ga0207713_1001535 3300025735 Bacteria 18179
107 Ga0207713_1002863 3300025735 Bacteria 12118
108 Ga0207713_1002900 3300025735 Bacteria 12008
109 Ga0207713_1013034 3300025735 Bacteria 4409
110 Ga0207713_1030764 3300025735 Bacteria 2386
111 Ga0207713_1051544 3300025735 Bacteria 1636
112 Ga0207713_1103430 3300025735 Bacteria 979
113 Ga0207710_10000018 3300025900 Bacteria 346727
114 Ga0207710_10173721 3300025900 Bacteria 1054
115 Ga0207695_10010322 3300025913 Bacteria 11434
116 Ga0207657_10112484 3300025919 Bacteria 2247
117 Ga0207649_10074652 3300025920 Bacteria 2177
118 Ga0207681_10001656 3300025923 Bacteria 14344
119 Ga0207690_10082743 3300025932 Bacteria 2245
120 Ga0207709_10000016 3300025935 Bacteria 478406
121 Ga0207709_10001842 3300025935 Bacteria 14124
122 Ga0207709_10056979 3300025935 Bacteria 2421
123 Ga0207709_10082852 3300025935 Bacteria 2072
124 Ga0207679_10001517 3300025945 Bacteria 14526
125 Ga0207651_10052391 3300025960 Bacteria 2782
126 Ga0207712_10000365 3300025961 Bacteria 40041
127 Ga0209389_1000030 3300027296 Bacteria 139329
128 Ga0209371_1000024 3300027312 Bacteria 477286
129 Ga0209371_1000168 3300027312 Bacteria 98356
130 Ga0209371_1001284 3300027312 Bacteria 17670
131 Ga0207428_10202425 3300027907 Bacteria 1494
132 Ga0268266_10007314 3300028379 Bacteria 9979
133 Ga0265336_10055785 3300028666 Bacteria 1187
134 Ga0265324_10000005 3300029957 Bacteria 347038
135 Ga0265324_10000120 3300029957 Bacteria 61840
136 Ga0268256_1000026 3300030500 Bacteria 477260
137 Ga0268256_1000140 3300030500 Bacteria 98356
138 Ga0268256_1001098 3300030500 Bacteria 17670
139 Ga0265332_10002918 3300031238 Bacteria 8418
140 Ga0265325_10008862 3300031241 Bacteria 5910
141 Ga0265325_10019448 3300031241 Bacteria 3754
142 Ga0265316_10055879 3300031344 Bacteria 3086
143 Ga0307408_100010209 3300031548 Bacteria 6197
144 Ga0307508_10008679 3300031616 Bacteria 9382
145 Ga0265314_10000371 3300031711 Bacteria 61424
146 Ga0265314_10102649 3300031711 Bacteria 1834
147 Ga0307405_10000087 3300031731 Bacteria 39283
148 Ga0307412_10058589 3300031911 Bacteria 2577
149 Ga0307414_10345387 3300032004 Bacteria 1275
150 Ga0436360_0599364 3300039438 Bacteria 7020
151 Ga0436361_0008537 3300039447 Bacteria 11190
152 Ga0436361_0148838 3300039447 Bacteria 11698
153 Ga0436361_0165048 3300039447 Bacteria 2313
154 Ga0436361_0466567 3300039447 Bacteria 20890
155 Ga0436361_0478700 3300039447 Bacteria 3800
156 Ga0436361_0776927 3300039447 Bacteria 26461
157 Ga0436361_0871895 3300039447 Bacteria 3737
158 Ga0436361_0911100 3300039447 Bacteria 2849
159 Ga0436361_0937046 3300039447 Bacteria 4002
160 Ga0436361_1077701 3300039447 Bacteria 4006
161 Ga0439438_006059 3300041405 Bacteria 4338
162 Ga0439438_015581 3300041405 Bacteria 2231
163 Ga0439447_002760 3300041407 Bacteria 6348
164 Ga0439466_0003404 3300041411 Bacteria 6171
165 Ga0439466_0035945 3300041411 Bacteria 1674
166 Ga0439432_002247 3300042006 Bacteria 7285
167 Ga0439432_003047 3300042006 Bacteria 6239
168 Ga0439432_034211 3300042006 Bacteria 1632
169 Ga0439451_000967 3300042009 Bacteria 5548
170 Ga0439451_002470 3300042009 Bacteria 3747
171 Ga0439451_003580 3300042009 Bacteria 3145
172 Ga0439451_004351 3300042009 Bacteria 2876
173 Ga0439451_011617 3300042009 Bacteria 1776
174 Ga0439452_014510 3300042010 Bacteria 2186
175 Ga0439456_000013 3300042013 Bacteria 72544
176 Ga0439456_001614 3300042013 Bacteria 4551
177 Ga0439456_007066 3300042013 Bacteria 2299
178 Ga0439456_011621 3300042013 Bacteria 1822
179 Ga0450890_000102 3300042127 Bacteria 14165
180 Ga0450894_000678 3300042131 Bacteria 5689
181 Ga0450898_000021 3300042134 Bacteria 12898
182 Ga0450900_000420 3300042136 Bacteria 3295
183 Ga0450902_008878 3300042137 Bacteria 1576
184 Ga0450905_008594 3300042142 Bacteria 1399
185 Ga0450905_015900 3300042142 Bacteria 1082
186 Ga0450906_000420 3300042145 Bacteria 8756
187 Ga0450906_003609 3300042145 Bacteria 3308
188 Ga0450907_000661 3300042146 Bacteria 9049
189 Ga0450907_000791 3300042146 Bacteria 7876
190 Ga0439446_0006376 3300042156 Bacteria 3073
191 Ga0450909_000211 3300042185 Bacteria 6788
192 Ga0439434_0040945 3300042435 Bacteria 1423
193 Ga0439464_0004284 3300042439 Bacteria 3645
194 Ga0450901_001132 3300042533 Bacteria 3092
195 Ga0451577_0312608 3300042876 Bacteria 1424
196 Ga0439440_0000207 3300042993 Bacteria 9172
197 Ga0439440_0003972 3300042993 Bacteria 2885
198 Ga0466969_0007183 3300044656 Bacteria 5924
199 Ga0466969_0162668 3300044656 Bacteria 1025
200 Ga0466965_0068166 3300044683 Bacteria 1786
201 Ga0466966_0008473 3300044684 Bacteria 6807
202 Ga0466966_0085724 3300044684 Bacteria 1958
203 Ga0466961_0000034 3300044693 Bacteria 84993
204 Ga0453684_0023821 3300044712 Bacteria 8986
205 Ga0453684_0315658 3300044712 Bacteria 1772
206 Ga0466959_0116595 3300045049 Bacteria 1901
207 Ga0451576_0326362 3300045051 Bacteria 1606
208 Ga0451576_0381105 3300045051 Bacteria 1478
209 Ga0495617_000106 3300046452 Bacteria 61107
210 Ga0495627_000098 3300046453 Bacteria 107446
211 Ga0495627_041164 3300046453 Bacteria 1419
212 Ga0495590_0002968 3300046457 Bacteria 6966
213 Ga0495638_0220201 3300046460 Bacteria 1061
214 Ga0495650_0000911 3300046471 Bacteria 34840
215 Ga0495650_0027569 3300046471 Bacteria 2622
216 Ga0495605_0000114 3300046474 Bacteria 103834
217 Ga0495605_0003516 3300046474 Bacteria 9311
218 Ga0495605_0017352 3300046474 Bacteria 3879
219 Ga0495639_0000001 3300046475 Bacteria 204442
220 Ga0495584_0000568 3300046491 Bacteria 24896
221 Ga0495584_0001357 3300046491 Bacteria 14807
222 Ga0495585_0176343 3300046492 Bacteria 1101
223 Ga0495594_0000316 3300046499 Bacteria 23873
224 Ga0495607_0000540 3300046501 Bacteria 37020
225 Ga0495607_0002462 3300046501 Bacteria 15044
226 Ga0495607_0004537 3300046501 Bacteria 10195
227 Ga0495607_0025288 3300046501 Bacteria 3694
228 Ga0495583_0015737 3300046506 Bacteria 4098
229 Ga0495583_0015740 3300046506 Bacteria 4098
230 Ga0495606_0029645 3300046507 Bacteria 3836
231 Ga0495616_0006099 3300046513 Bacteria 7343
232 Ga0495620_0000037 3300046515 Bacteria 114491
233 Ga0495632_0000322 3300046519 Bacteria 46210
234 Ga0495632_0000376 3300046519 Bacteria 42540
235 Ga0495632_0019019 3300046519 Bacteria 3751
236 Ga0495632_0058202 3300046519 Bacteria 1885
237 Ga0495632_0068838 3300046519 Bacteria 1704
238 Ga0495637_0000499 3300046520 Bacteria 28432
239 Ga0495643_0000508 3300046522 Bacteria 48532
240 Ga0495643_0002114 3300046522 Bacteria 16408
241 Ga0495643_0018850 3300046522 Bacteria 3998
242 Ga0495643_0143317 3300046522 Bacteria 1189
243 Ga0495648_0004207 3300046524 Bacteria 12362
244 Ga0495648_0037242 3300046524 Bacteria 3128
245 Ga0495648_0149539 3300046524 Bacteria 1220
246 Ga0495663_0036198 3300046525 Bacteria 1485
247 Ga0495642_0000130 3300046528 Bacteria 43443
248 Ga0495654_0000088 3300046530 Bacteria 104763
249 Ga0495654_0001422 3300046530 Bacteria 16529
250 Ga0495654_0004399 3300046530 Bacteria 8374
251 Ga0495654_0015477 3300046530 Bacteria 4049
252 Ga0495654_0020233 3300046530 Bacteria 3470
253 Ga0495609_0009473 3300046538 Bacteria 4711
254 Ga0495597_0013595 3300046542 Bacteria 3893
255 Ga0495622_0000347 3300046557 Bacteria 33186
256 Ga0495622_0064346 3300046557 Bacteria 1696
257 Ga0495633_0000348 3300046558 Bacteria 51243
258 Ga0495611_0038780 3300046648 Bacteria 2120
259 Ga0495611_0047722 3300046648 Bacteria 1922
260 Ga0495625_0015261 3300046660 Bacteria 6092
261 Ga0495625_0072342 3300046660 Bacteria 2418
262 Ga0495659_0000002 3300046664 Bacteria 176698
263 Ga0495659_0001572 3300046664 Bacteria 7677
264 Ga0495659_0051139 3300046664 Bacteria 1504
265 Ga0495661_0005739 3300046665 Bacteria 8788
266 Ga0495670_0000112 3300046691 Bacteria 36057
267 Ga0495670_0007568 3300046691 Bacteria 5338
268 Ga0495671_0000160 3300046692 Bacteria 59259
269 Ga0495649_0000013 3300046694 Bacteria 316013
270 Ga0495649_0040404 3300046694 Bacteria 2554
271 Ga0495589_0000123 3300046794 Bacteria 72582
272 Ga0495589_0008445 3300046794 Bacteria 5378
273 Ga0495660_0023253 3300046810 Bacteria 3535
274 Ga0495581_0249386 3300047315 Bacteria 1038
275 Ga0495636_0000509 3300047318 Bacteria 14300
276 Ga0495672_0000773 3300047320 Bacteria 34808
277 Ga0495672_0001686 3300047320 Bacteria 21392
278 Ga0495672_0017970 3300047320 Bacteria 4710
279 Ga0495683_0002700 3300047323 Bacteria 10588
280 Ga0495683_0010376 3300047323 Bacteria 4923
281 Ga0495687_001399 3300047443 Bacteria 22271
282 Ga0495687_004710 3300047443 Bacteria 9045
283 Ga0495685_004423 3300047447 Bacteria 4541
284 Ga0495673_0001694 3300047469 Bacteria 16897
285 Ga0495593_0010536 3300047673 Bacteria 5335
286 Ga0495626_0000031 3300048091 Bacteria 197930
287 Ga0495626_0000631 3300048091 Bacteria 34169
288 Ga0495626_0007799 3300048091 Bacteria 5929
289 Ga0496106_0054502 3300048909 Bacteria 3021
290 Ga0496107_0342615 3300048910 Bacteria 1112
291 Ga0496110_0010019 3300048913 Bacteria 7691
292 Ga0496111_0115168 3300048914 Bacteria 1982
293 Ga0496112_0163312 3300048915 Bacteria 2193
294 Ga0496114_0002999 3300048917 Bacteria 12940
295 Ga0496114_0010046 3300048917 Bacteria 7526
296 Ga0496116_0002307 3300048919 Bacteria 20229
297 Ga0496116_0069253 3300048919 Bacteria 2244
298 Ga0496117_0000001 3300048920 Bacteria 2526244
299 Ga0496117_0005256 3300048920 Bacteria 13737
300 Ga0496117_0008714 3300048920 Bacteria 9585
301 Ga0496117_0027543 3300048920 Bacteria 4425
302 Ga0496117_0030122 3300048920 Bacteria 4170
303 Ga0496118_0000002 3300048921 Bacteria 1690764
304 Ga0496118_0002113 3300048921 Bacteria 27843
305 Ga0496118_0005087 3300048921 Bacteria 15130
306 Ga0496118_0009868 3300048921 Bacteria 9548
307 Ga0496118_0018468 3300048921 Bacteria 6292
308 Ga0496118_0043810 3300048921 Bacteria 3512
309 Ga0496119_0030703 3300048922 Bacteria 3618
310 Ga0496120_0020769 3300048923 Bacteria 4164
311 Ga0496121_0002366 3300048924 Bacteria 29022
312 Ga0496121_0004709 3300048924 Bacteria 18050
313 Ga0496122_0001785 3300048925 Bacteria 32973
314 Ga0496122_0002729 3300048925 Bacteria 24434
315 Ga0496122_0002892 3300048925 Bacteria 23489
316 Ga0496122_0038877 3300048925 Bacteria 3802
317 Ga0496122_0120172 3300048925 Bacteria 1696
318 Ga0496122_0189507 3300048925 Bacteria 1216
319 Ga0496123_0000136 3300048926 Bacteria 152399
320 Ga0496123_0000676 3300048926 Bacteria 56312
321 Ga0496123_0001347 3300048926 Bacteria 34616
322 Ga0496123_0007417 3300048926 Bacteria 10340
323 Ga0496123_0011341 3300048926 Bacteria 7740
324 Ga0496123_0028086 3300048926 Bacteria 4173
325 Ga0496123_0137536 3300048926 Bacteria 1341
326 Ga0496124_0001317 3300048927 Bacteria 37470
327 Ga0496124_0004098 3300048927 Bacteria 17235
328 Ga0496124_0028201 3300048927 Bacteria 5025
329 Ga0496124_0051919 3300048927 Bacteria 3486
330 Ga0496124_0078431 3300048927 Bacteria 2722
331 Ga0496124_0224607 3300048927 Bacteria 1409
332 Ga0496125_0000536 3300048928 Bacteria 65389
333 Ga0496125_0017412 3300048928 Bacteria 6851
334 Ga0496125_0102744 3300048928 Bacteria 2099
335 Ga0496125_0207370 3300048928 Bacteria 1276
336 Ga0496126_0007964 3300048929 Bacteria 11512
337 Ga0496126_0014011 3300048929 Bacteria 8125
338 Ga0496126_0021965 3300048929 Bacteria 6223
339 Ga0496126_0060408 3300048929 Bacteria 3409
340 Ga0495678_000420 3300049459 Bacteria 42717
341 Ga0495678_002036 3300049459 Bacteria 14478
342 Ga0495678_017898 3300049459 Bacteria 3198
343 Ga0495682_0003332 3300049460 Bacteria 7171
344 Ga0495682_0052746 3300049460 Bacteria 1477
345 Ga0495682_0095323 3300049460 Bacteria 1068
346 Ga0501034_0000969 3300049571 Bacteria 41330
347 Ga0501034_0199640 3300049571 Bacteria 1959
348 Ga0500608_062635 3300053122 Bacteria 1776
349 Ga0500659_0001037 3300053135 Bacteria 17855

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042993 Ga0439440_0003972 Ga0439440_0003972_391_1170 226
2 3300031548 Ga0307408_100010209 Ga0307408_1000102093 227
3 3300014497 Ga0182008_10000114 Ga0182008_1000011427 228
4 3300017792 Ga0163161_10031470 Ga0163161_100314702 228
5 3300025230 Ga0209563_100747 Ga0209563_1007474 228
6 3300039438 Ga0436360_0599364 Ga0436360_0599364_4113_4901 229
7 3300039447 Ga0436361_0478700 Ga0436361_0478700_671_1459 229
8 3300039447 Ga0436361_1077701 Ga0436361_1077701_1875_2663 229
9 3300005445 Ga0070708_100339059 Ga0070708_1003390592 238
10 3300048921 Ga0496118_0018468 Ga0496118_0018468_4439_5191 239
11 3300049571 Ga0501034_0199640 Ga0501034_0199640_212_988 239
12 3300003781 Ga0055536_1002193 Ga0055536_10021935 240
13 3300009036 Ga0105244_10004469 Ga0105244_100044699 240
14 3300013102 Ga0157371_10000045 Ga0157371_1000004554 240
15 3300025728 Ga0207655_1013557 Ga0207655_10135573 240
16 3300039447 Ga0436361_0008537 Ga0436361_0008537_8307_9071 240
17 3300046453 Ga0495627_000098 Ga0495627_000098_97401_98168 240
18 3300046519 Ga0495632_0019019 Ga0495632_0019019_766_1533 240
19 3300046530 Ga0495654_0001422 Ga0495654_0001422_5287_6054 240
20 3300047320 Ga0495672_0001686 Ga0495672_0001686_646_1413 240
21 3300031344 Ga0265316_10055879 Ga0265316_100558792 243
22 3300042006 Ga0439432_003047 Ga0439432_003047_53_820 243
23 3300042146 Ga0450907_000661 Ga0450907_000661_1021_1788 243
24 3300003856 Ga0058692_1000061 Ga0058692_100006175 244
25 3300027312 Ga0209371_1000168 Ga0209371_100016872 244
26 3300030500 Ga0268256_1000140 Ga0268256_100014072 244
27 3300039447 Ga0436361_0937046 Ga0436361_0937046_2749_3525 244
28 3300044683 Ga0466965_0068166 Ga0466965_0068166_961_1695 244
29 3300045049 Ga0466959_0116595 Ga0466959_0116595_79_813 244
30 3300039447 Ga0436361_0911100 Ga0436361_0911100_319_1083 245
31 3300042876 Ga0451577_0312608 Ga0451577_0312608_77_838 245
32 3300044656 Ga0466969_0007183 Ga0466969_0007183_3874_4614 245
33 3300009148 Ga0105243_10002910 Ga0105243_100029108 246
34 3300009148 Ga0105243_10142388 Ga0105243_101423882 246
35 3300025728 Ga0207655_1000014 Ga0207655_1000014270 246
36 3300025735 Ga0207713_1001535 Ga0207713_10015354 246
37 3300025935 Ga0207709_10001842 Ga0207709_100018428 246
38 3300025935 Ga0207709_10056979 Ga0207709_100569793 246
39 3300041405 Ga0439438_006059 Ga0439438_006059_448_1215 246
40 3300046471 Ga0495650_0027569 Ga0495650_0027569_466_1233 246
41 3300046519 Ga0495632_0058202 Ga0495632_0058202_919_1686 246
42 3300048929 Ga0496126_0021965 Ga0496126_0021965_1050_1823 246
43 3300014497 Ga0182008_10040095 Ga0182008_100400953 247
44 3300053122 Ga0500608_062635 Ga0500608_062635_50_805 247
45 iso_pu_bacteria 2526164512 2526212014 247
46 3300015261 Ga0182006_1026661 Ga0182006_10266613 248
47 iso_pu_bacteria 2511231004 2511257501 248
48 iso_pu_bacteria 2511231007 2511270374 248
49 iso_pu_bacteria 2511231016 2511325544 248
50 iso_pu_bacteria 2511231022 2511364714 248
51 iso_pu_bacteria 2599185288 2599878324 248
52 iso_pu_bacteria 2599185303 2599947525 248
53 iso_pu_bacteria 2600255292 2601668111 248
54 iso_pu_bacteria 2623620446 2624491255 248
55 iso_pu_bacteria 2738541294 2738808594 248
56 iso_pu_bacteria 2738541309 2738895954 248
57 iso_pu_bacteria 2808606385 2808977262 248
58 iso_pu_bacteria 2808606388 2808992417 248
59 iso_pu_bacteria 2844665904 2844670356 248
60 iso_pu_bacteria 2852612431 2852613380 248
61 iso_pu_bacteria 2852667396 2852668884 248
62 iso_pu_bacteria 2857547612 2857549844 248
63 iso_pu_bacteria 2885080285 2885082938 248
64 iso_pu_bacteria 2912963787 2912964438 248
65 iso_pu_bacteria 2919697872 2919701231 248
66 iso_pu_bacteria 2932410948 2932411816 248
67 iso_pu_bacteria 2932416698 2932418617 248
68 iso_pu_bacteria 2939651529 2939651946 248
69 iso_pu_bacteria 2945928738 2945928787 248
70 iso_pu_bacteria 8019775933 8019778149 248
71 iso_pu_bacteria 8054929484 8054930172 248
72 iso_pu_bacteria 8056155041 8056160208 248
73 iso_pu_bacteria 8056161164 8056165127 248
74 iso_pu_bacteria 2511231024 2511372858 249
75 iso_pu_bacteria 2554235231 2555247340 249
76 iso_pu_bacteria 2765235841 2765583119 249
77 iso_pu_bacteria 2806310737 2807407821 249
78 iso_pu_bacteria 2806310745 2807456124 249
79 iso_pu_bacteria 2998344455 2998346583 249
80 iso_pu_bacteria 3007803356 3007808025 249
81 iso_pu_bacteria 3007872151 3007876596 249
82 iso_pu_bacteria 8052494512 8052498063 249
83 iso_pu_bacteria 8056115690 8056118384 249
84 iso_pu_bacteria 8056120720 8056123977 249
85 iso_pu_bacteria 8056137416 8056139717 249
86 3300031238 Ga0265332_10002918 Ga0265332_100029182 250
87 3300031616 Ga0307508_10008679 Ga0307508_1000867912 250
88 3300044712 Ga0453684_0023821 Ga0453684_0023821_2598_3353 250
89 3300044712 Ga0453684_0315658 Ga0453684_0315658_977_1732 250
90 3300045051 Ga0451576_0326362 Ga0451576_0326362_142_897 250
91 3300045051 Ga0451576_0381105 Ga0451576_0381105_46_801 250
92 iso_pu_bacteria 2547132103 2547373858 250
93 iso_pu_bacteria 2599185248 2599769742 250
94 iso_pu_bacteria 2599185289 2599889064 250
95 iso_pu_bacteria 2599185291 2599901575 250
96 iso_pu_bacteria 2599185305 2599959233 250
97 iso_pu_bacteria 2599185306 2599964501 250
98 iso_pu_bacteria 2599185308 2599975626 250
99 iso_pu_bacteria 2599185313 2600007221 250
100 iso_pu_bacteria 2599185314 2600009737 250
101 iso_pu_bacteria 2599185315 2600020544 250
102 iso_pu_bacteria 2599185321 2600055057 250
103 iso_pu_bacteria 2599185324 2600071706 250
104 iso_pu_bacteria 2643221650 2644285599 250
105 iso_pu_bacteria 2643221665 2644364340 250
106 iso_pu_bacteria 2667528170 2671093515 250
107 iso_pu_bacteria 2744054655 2745159831 250
108 iso_pu_bacteria 2825651385 2825656848 250
109 iso_pu_bacteria 2843690924 2843693440 250
110 iso_pu_bacteria 2928515477 2928516732 250
111 iso_pu_bacteria 3007419365 3007423744 250
112 3300046452 Ga0495617_000106 Ga0495617_000106_24450_25205 251
113 3300046457 Ga0495590_0002968 Ga0495590_0002968_5288_6043 251
114 3300046471 Ga0495650_0000911 Ga0495650_0000911_32963_33718 251
115 3300046474 Ga0495605_0000114 Ga0495605_0000114_22744_23499 251
116 3300046491 Ga0495584_0001357 Ga0495584_0001357_4309_5064 251
117 3300046492 Ga0495585_0176343 Ga0495585_0176343_190_945 251
118 3300046501 Ga0495607_0004537 Ga0495607_0004537_1075_1830 251
119 3300046506 Ga0495583_0015740 Ga0495583_0015740_321_1076 251
120 3300046513 Ga0495616_0006099 Ga0495616_0006099_4889_5644 251
121 3300046519 Ga0495632_0000322 Ga0495632_0000322_16414_17169 251
122 3300046522 Ga0495643_0018850 Ga0495643_0018850_1075_1830 251
123 3300046524 Ga0495648_0037242 Ga0495648_0037242_1878_2633 251
124 3300046528 Ga0495642_0000130 Ga0495642_0000130_15220_15975 251
125 3300046530 Ga0495654_0004399 Ga0495654_0004399_7041_7796 251
126 3300046538 Ga0495609_0009473 Ga0495609_0009473_1075_1830 251
127 3300046542 Ga0495597_0013595 Ga0495597_0013595_1318_2073 251
128 3300046648 Ga0495611_0047722 Ga0495611_0047722_23_778 251
129 3300046664 Ga0495659_0051139 Ga0495659_0051139_619_1374 251
130 3300046694 Ga0495649_0000013 Ga0495649_0000013_58837_59592 251
131 3300046794 Ga0495589_0000123 Ga0495589_0000123_14209_14964 251
132 3300047318 Ga0495636_0000509 Ga0495636_0000509_1075_1830 251
133 3300047320 Ga0495672_0017970 Ga0495672_0017970_2881_3636 251
134 3300047443 Ga0495687_001399 Ga0495687_001399_3802_4557 251
135 3300047447 Ga0495685_004423 Ga0495685_004423_318_1073 251
136 3300047469 Ga0495673_0001694 Ga0495673_0001694_14017_14772 251
137 3300048091 Ga0495626_0000631 Ga0495626_0000631_12585_13340 251
138 3300049459 Ga0495678_000420 Ga0495678_000420_21526_22281 251
139 iso_pu_bacteria 2916699645 2916700316 251
140 iso_pu_bacteria 2919506607 2919507620 251
141 iso_pu_bacteria 2984568884 2984571808 251
142 iso_pu_bacteria 8033232454 8033234190 251
143 3300002737 JGI25162J39368_1000045 JGI25162J39368_100004522 252
144 3300002771 JGI25163J39215_1000286 JGI25163J39215_100028610 252
145 3300002772 JGI25164J39214_1000147 JGI25164J39214_100014748 252
146 3300003214 JGI25165J46597_1000086 JGI25165J46597_100008622 252
147 3300003322 rootL2_10000116 rootL2_1000011629 252
148 3300003781 Ga0055536_1020649 Ga0055536_10206492 252
149 3300003856 Ga0058692_1015011 Ga0058692_10150112 252
150 3300005288 Ga0065714_10002075 Ga0065714_100020753 252
151 3300005288 Ga0065714_10013264 Ga0065714_100132645 252
152 3300005289 Ga0065704_10004354 Ga0065704_100043543 252
153 3300005290 Ga0065712_10072326 Ga0065712_100723264 252
154 3300009092 Ga0105250_10000034 Ga0105250_1000003495 252
155 3300011119 Ga0105246_10101959 Ga0105246_101019592 252
156 3300013306 Ga0163162_10366829 Ga0163162_103668291 252
157 3300014497 Ga0182008_10000355 Ga0182008_100003553 252
158 3300015261 Ga0182006_1000067 Ga0182006_100006762 252
159 3300015261 Ga0182006_1000083 Ga0182006_100008369 252
160 3300015262 Ga0182007_10000086 Ga0182007_1000008655 252
161 3300015262 Ga0182007_10000123 Ga0182007_1000012312 252
162 3300015265 Ga0182005_1000002 Ga0182005_100000271 252
163 3300015265 Ga0182005_1001499 Ga0182005_100149911 252
164 3300017792 Ga0163161_10001818 Ga0163161_1000181814 252
165 3300017792 Ga0163161_10221791 Ga0163161_102217911 252
166 3300021361 Ga0213872_10000192 Ga0213872_100001922 252
167 3300021361 Ga0213872_10000425 Ga0213872_1000042516 252
168 3300025207 Ga0209760_100019 Ga0209760_100019147 252
169 3300025231 Ga0207427_100011 Ga0207427_100011147 252
170 3300025233 Ga0209437_100044 Ga0209437_100044147 252
171 3300025261 Ga0209233_1000057 Ga0209233_1000057147 252
172 3300025711 Ga0207696_1000107 Ga0207696_100010762 252
173 3300025728 Ga0207655_1000481 Ga0207655_100048130 252
174 3300025735 Ga0207713_1002863 Ga0207713_10028635 252
175 3300027312 Ga0209371_1001284 Ga0209371_100128413 252
176 3300027907 Ga0207428_10202425 Ga0207428_102024252 252
177 3300030500 Ga0268256_1001098 Ga0268256_10010982 252
178 3300031731 Ga0307405_10000087 Ga0307405_1000008735 252
179 3300031911 Ga0307412_10058589 Ga0307412_100585892 252
180 3300032004 Ga0307414_10345387 Ga0307414_103453872 252
181 3300039447 Ga0436361_0466567 Ga0436361_0466567_14196_14954 252
182 3300039447 Ga0436361_0776927 Ga0436361_0776927_6044_6802 252
183 3300041405 Ga0439438_015581 Ga0439438_015581_1072_1830 252
184 3300041407 Ga0439447_002760 Ga0439447_002760_4874_5632 252
185 3300041411 Ga0439466_0003404 Ga0439466_0003404_302_1060 252
186 3300042006 Ga0439432_034211 Ga0439432_034211_340_1098 252
187 3300042009 Ga0439451_003580 Ga0439451_003580_1184_1942 252
188 3300042009 Ga0439451_004351 Ga0439451_004351_536_1294 252
189 3300042010 Ga0439452_014510 Ga0439452_014510_194_952 252
190 3300042013 Ga0439456_000013 Ga0439456_000013_16974_17732 252
191 3300042013 Ga0439456_011621 Ga0439456_011621_663_1421 252
192 3300042127 Ga0450890_000102 Ga0450890_000102_8407_9165 252
193 3300042131 Ga0450894_000678 Ga0450894_000678_2461_3219 252
194 3300042134 Ga0450898_000021 Ga0450898_000021_10286_11044 252
195 3300042145 Ga0450906_000420 Ga0450906_000420_2706_3464 252
196 3300042146 Ga0450907_000791 Ga0450907_000791_6551_7309 252
197 3300042156 Ga0439446_0006376 Ga0439446_0006376_498_1256 252
198 3300042185 Ga0450909_000211 Ga0450909_000211_667_1425 252
199 3300042435 Ga0439434_0040945 Ga0439434_0040945_610_1368 252
200 3300042439 Ga0439464_0004284 Ga0439464_0004284_1529_2287 252
201 3300042993 Ga0439440_0000207 Ga0439440_0000207_535_1293 252
202 3300044684 Ga0466966_0008473 Ga0466966_0008473_1734_2495 252
203 3300044693 Ga0466961_0000034 Ga0466961_0000034_5147_5908 252
204 3300046460 Ga0495638_0220201 Ga0495638_0220201_50_808 252
205 3300046474 Ga0495605_0003516 Ga0495605_0003516_8239_8997 252
206 3300046474 Ga0495605_0017352 Ga0495605_0017352_2362_3120 252
207 3300046475 Ga0495639_0000001 Ga0495639_0000001_118424_119182 252
208 3300046491 Ga0495584_0000568 Ga0495584_0000568_21531_22289 252
209 3300046499 Ga0495594_0000316 Ga0495594_0000316_6607_7365 252
210 3300046501 Ga0495607_0000540 Ga0495607_0000540_3716_4474 252
211 3300046501 Ga0495607_0002462 Ga0495607_0002462_10020_10778 252
212 3300046506 Ga0495583_0015737 Ga0495583_0015737_2253_3011 252
213 3300046520 Ga0495637_0000499 Ga0495637_0000499_27496_28254 252
214 3300046524 Ga0495648_0149539 Ga0495648_0149539_97_855 252
215 3300046530 Ga0495654_0000088 Ga0495654_0000088_63631_64389 252
216 3300046530 Ga0495654_0015477 Ga0495654_0015477_2397_3158 252
217 3300046557 Ga0495622_0000347 Ga0495622_0000347_13797_14555 252
218 3300046557 Ga0495622_0064346 Ga0495622_0064346_722_1483 252
219 3300046558 Ga0495633_0000348 Ga0495633_0000348_15852_16613 252
220 3300046648 Ga0495611_0038780 Ga0495611_0038780_19_777 252
221 3300046660 Ga0495625_0015261 Ga0495625_0015261_3429_4187 252
222 3300046664 Ga0495659_0000002 Ga0495659_0000002_117856_118614 252
223 3300046664 Ga0495659_0001572 Ga0495659_0001572_4093_4851 252
224 3300046665 Ga0495661_0005739 Ga0495661_0005739_4366_5124 252
225 3300046691 Ga0495670_0000112 Ga0495670_0000112_20184_20942 252
226 3300046691 Ga0495670_0007568 Ga0495670_0007568_2894_3652 252
227 3300046692 Ga0495671_0000160 Ga0495671_0000160_36971_37729 252
228 3300046794 Ga0495589_0008445 Ga0495589_0008445_1931_2689 252
229 3300046810 Ga0495660_0023253 Ga0495660_0023253_1579_2337 252
230 3300047315 Ga0495581_0249386 Ga0495581_0249386_40_798 252
231 3300047320 Ga0495672_0000773 Ga0495672_0000773_15302_16060 252
232 3300047323 Ga0495683_0002700 Ga0495683_0002700_1266_2024 252
233 3300047323 Ga0495683_0010376 Ga0495683_0010376_1519_2277 252
234 3300047443 Ga0495687_004710 Ga0495687_004710_6419_7177 252
235 3300047673 Ga0495593_0010536 Ga0495593_0010536_324_1082 252
236 3300048091 Ga0495626_0000031 Ga0495626_0000031_129370_130128 252
237 3300048091 Ga0495626_0007799 Ga0495626_0007799_1559_2317 252
238 3300048909 Ga0496106_0054502 Ga0496106_0054502_76_834 252
239 3300048910 Ga0496107_0342615 Ga0496107_0342615_218_976 252
240 3300048914 Ga0496111_0115168 Ga0496111_0115168_1101_1862 252
241 3300048915 Ga0496112_0163312 Ga0496112_0163312_1240_1998 252
242 3300048919 Ga0496116_0002307 Ga0496116_0002307_17533_18291 252
243 3300048919 Ga0496116_0069253 Ga0496116_0069253_1216_1977 252
244 3300048920 Ga0496117_0000001 Ga0496117_0000001_939472_940233 252
245 3300048920 Ga0496117_0030122 Ga0496117_0030122_2901_3659 252
246 3300048921 Ga0496118_0000002 Ga0496118_0000002_939472_940233 252
247 3300048921 Ga0496118_0005087 Ga0496118_0005087_1193_1951 252
248 3300048921 Ga0496118_0043810 Ga0496118_0043810_1193_1951 252
249 3300048922 Ga0496119_0030703 Ga0496119_0030703_2641_3399 252
250 3300048923 Ga0496120_0020769 Ga0496120_0020769_237_995 252
251 3300048924 Ga0496121_0002366 Ga0496121_0002366_9844_10605 252
252 3300048924 Ga0496121_0004709 Ga0496121_0004709_4995_5756 252
253 3300048925 Ga0496122_0002729 Ga0496122_0002729_2007_2765 252
254 3300048925 Ga0496122_0002892 Ga0496122_0002892_16591_17436 252
255 3300048925 Ga0496122_0038877 Ga0496122_0038877_167_925 252
256 3300048926 Ga0496123_0001347 Ga0496123_0001347_10894_11739 252
257 3300048926 Ga0496123_0007417 Ga0496123_0007417_3323_4081 252
258 3300048926 Ga0496123_0028086 Ga0496123_0028086_447_1205 252
259 3300048927 Ga0496124_0051919 Ga0496124_0051919_722_1480 252
260 3300048928 Ga0496125_0207370 Ga0496125_0207370_298_1056 252
261 3300048929 Ga0496126_0014011 Ga0496126_0014011_2667_3425 252
262 3300049459 Ga0495678_002036 Ga0495678_002036_2473_3231 252
263 3300049460 Ga0495682_0003332 Ga0495682_0003332_2661_3422 252
264 3300049460 Ga0495682_0052746 Ga0495682_0052746_239_997 252
265 3300049460 Ga0495682_0095323 Ga0495682_0095323_159_917 252
266 iso_pu_bacteria 2639762793 2640735897 252
267 iso_pu_bacteria 2675903507 2678229169 252
268 iso_pu_bacteria 2773857761 2774390302 252
269 iso_pu_bacteria 2773857770 2774437843 252
270 iso_pu_bacteria 2846033681 2846033891 252
271 iso_pu_bacteria 2846037992 2846038879 252
272 iso_pu_bacteria 2919182534 2919184658 252
273 2162886007 SwRhRL2b_contig_3325370 SwRhRL2b_0159.00006300 253
274 2162886007 SwRhRL2b_contig_938429 SwRhRL2b_0122.00004870 253
275 3300005289 Ga0065704_10070431 Ga0065704_1007043120 253
276 3300005289 Ga0065704_10070585 Ga0065704_100705853 253
277 3300005339 Ga0070660_100104571 Ga0070660_1001045712 253
278 3300005366 Ga0070659_100102304 Ga0070659_1001023041 253
279 3300005564 Ga0070664_100341893 Ga0070664_1003418932 253
280 3300006051 Ga0075364_10006630 Ga0075364_100066305 253
281 3300006051 Ga0075364_10063633 Ga0075364_100636334 253
282 3300006944 Ga0099823_1000006 Ga0099823_1000006118 253
283 3300009011 Ga0105251_10005420 Ga0105251_100054205 253
284 3300009011 Ga0105251_10081602 Ga0105251_100816022 253
285 3300009036 Ga0105244_10001830 Ga0105244_100018309 253
286 3300009036 Ga0105244_10002834 Ga0105244_100028348 253
287 3300009036 Ga0105244_10003046 Ga0105244_100030466 253
288 3300009036 Ga0105244_10018008 Ga0105244_100180084 253
289 3300009036 Ga0105244_10037841 Ga0105244_100378412 253
290 3300009092 Ga0105250_10006006 Ga0105250_100060064 253
291 3300009092 Ga0105250_10024879 Ga0105250_100248791 253
292 3300009092 Ga0105250_10040142 Ga0105250_100401421 253
293 3300009148 Ga0105243_10142205 Ga0105243_101422051 253
294 3300009553 Ga0105249_10000066 Ga0105249_1000006631 253
295 3300013102 Ga0157371_10011307 Ga0157371_100113074 253
296 3300021361 Ga0213872_10008655 Ga0213872_100086554 253
297 3300025292 Ga0209676_1000292 Ga0209676_100029220 253
298 3300025711 Ga0207696_1000018 Ga0207696_1000018379 253
299 3300025711 Ga0207696_1019592 Ga0207696_10195922 253
300 3300025711 Ga0207696_1022162 Ga0207696_10221622 253
301 3300025728 Ga0207655_1000081 Ga0207655_1000081134 253
302 3300025728 Ga0207655_1000180 Ga0207655_100018030 253
303 3300025728 Ga0207655_1000613 Ga0207655_100061339 253
304 3300025728 Ga0207655_1005084 Ga0207655_10050846 253
305 3300025728 Ga0207655_1043712 Ga0207655_10437122 253
306 3300025735 Ga0207713_1013034 Ga0207713_10130342 253
307 3300025735 Ga0207713_1030764 Ga0207713_10307643 253
308 3300025735 Ga0207713_1051544 Ga0207713_10515442 253
309 3300025919 Ga0207657_10112484 Ga0207657_101124841 253
310 3300025920 Ga0207649_10074652 Ga0207649_100746522 253
311 3300025932 Ga0207690_10082743 Ga0207690_100827431 253
312 3300025935 Ga0207709_10082852 Ga0207709_100828521 253
313 3300025945 Ga0207679_10001517 Ga0207679_100015173 253
314 3300025961 Ga0207712_10000365 Ga0207712_100003659 253
315 3300027296 Ga0209389_1000030 Ga0209389_1000030113 253
316 3300028666 Ga0265336_10055785 Ga0265336_100557852 253
317 3300029957 Ga0265324_10000005 Ga0265324_1000000560 253
318 3300031241 Ga0265325_10008862 Ga0265325_100088622 253
319 3300031711 Ga0265314_10102649 Ga0265314_101026493 253
320 3300039447 Ga0436361_0148838 Ga0436361_0148838_10507_11268 253
321 3300039447 Ga0436361_0165048 Ga0436361_0165048_823_1656 253
322 3300039447 Ga0436361_0871895 Ga0436361_0871895_1352_2113 253
323 3300042006 Ga0439432_002247 Ga0439432_002247_3697_4527 253
324 3300042136 Ga0450900_000420 Ga0450900_000420_2467_3228 253
325 3300042137 Ga0450902_008878 Ga0450902_008878_380_1141 253
326 3300042142 Ga0450905_008594 Ga0450905_008594_77_838 253
327 3300042142 Ga0450905_015900 Ga0450905_015900_23_784 253
328 3300042533 Ga0450901_001132 Ga0450901_001132_2178_2939 253
329 3300044656 Ga0466969_0162668 Ga0466969_0162668_137_904 253
330 3300044684 Ga0466966_0085724 Ga0466966_0085724_959_1726 253
331 3300046515 Ga0495620_0000037 Ga0495620_0000037_8904_9665 253
332 3300046519 Ga0495632_0000376 Ga0495632_0000376_30605_31366 253
333 3300046522 Ga0495643_0000508 Ga0495643_0000508_24306_25136 253
334 3300046522 Ga0495643_0002114 Ga0495643_0002114_3384_4145 253
335 3300046524 Ga0495648_0004207 Ga0495648_0004207_4080_4841 253
336 3300046660 Ga0495625_0072342 Ga0495625_0072342_70_837 253
337 3300048913 Ga0496110_0010019 Ga0496110_0010019_6316_7077 253
338 3300048917 Ga0496114_0002999 Ga0496114_0002999_6134_6928 253
339 3300048917 Ga0496114_0010046 Ga0496114_0010046_2170_3000 253
340 3300048920 Ga0496117_0005256 Ga0496117_0005256_11819_12580 253
341 3300048920 Ga0496117_0008714 Ga0496117_0008714_7707_8468 253
342 3300048920 Ga0496117_0027543 Ga0496117_0027543_1411_2241 253
343 3300048921 Ga0496118_0002113 Ga0496118_0002113_14509_15270 253
344 3300048921 Ga0496118_0009868 Ga0496118_0009868_4532_5362 253
345 3300048925 Ga0496122_0001785 Ga0496122_0001785_331_1161 253
346 3300048925 Ga0496122_0120172 Ga0496122_0120172_331_1161 253
347 3300048925 Ga0496122_0189507 Ga0496122_0189507_381_1142 253
348 3300048926 Ga0496123_0000136 Ga0496123_0000136_12906_13736 253
349 3300048926 Ga0496123_0011341 Ga0496123_0011341_4676_5437 253
350 3300048926 Ga0496123_0137536 Ga0496123_0137536_471_1232 253
351 3300048927 Ga0496124_0001317 Ga0496124_0001317_3961_4722 253
352 3300048927 Ga0496124_0004098 Ga0496124_0004098_9626_10387 253
353 3300048927 Ga0496124_0028201 Ga0496124_0028201_3065_3895 253
354 3300048927 Ga0496124_0078431 Ga0496124_0078431_720_1481 253
355 3300048927 Ga0496124_0224607 Ga0496124_0224607_282_1112 253
356 3300048928 Ga0496125_0000536 Ga0496125_0000536_33788_34549 253
357 3300048928 Ga0496125_0017412 Ga0496125_0017412_5329_6090 253
358 3300048928 Ga0496125_0102744 Ga0496125_0102744_1044_1874 253
359 3300048929 Ga0496126_0007964 Ga0496126_0007964_2031_2792 253
360 3300048929 Ga0496126_0060408 Ga0496126_0060408_699_1466 253
361 3300049571 Ga0501034_0000969 Ga0501034_0000969_36894_37724 253
362 3300053135 Ga0500659_0001037 Ga0500659_0001037_10702_11463 253
363 2162886007 SwRhRL2b_contig_1738858 SwRhRL2b_0416.00004640 254
364 3300003856 Ga0058692_1000007 Ga0058692_100000726 254
365 3300005272 Ga0065703_1000503 Ga0065703_10005034 254
366 3300005288 Ga0065714_10003804 Ga0065714_100038047 254
367 3300005289 Ga0065704_10022617 Ga0065704_100226171 254
368 3300005289 Ga0065704_10075826 Ga0065704_100758266 254
369 3300005289 Ga0065704_10123544 Ga0065704_101235441 254
370 3300005353 Ga0070669_100002127 Ga0070669_1000021275 254
371 3300005364 Ga0070673_100074480 Ga0070673_1000744803 254
372 3300005548 Ga0070665_100023617 Ga0070665_1000236175 254
373 3300009011 Ga0105251_10064698 Ga0105251_100646981 254
374 3300009011 Ga0105251_10162950 Ga0105251_101629501 254
375 3300009036 Ga0105244_10042874 Ga0105244_100428742 254
376 3300009036 Ga0105244_10138914 Ga0105244_101389142 254
377 3300009093 Ga0105240_10003913 Ga0105240_1000391315 254
378 3300009101 Ga0105247_10033531 Ga0105247_100335312 254
379 3300009101 Ga0105247_10203066 Ga0105247_102030661 254
380 3300009148 Ga0105243_10000835 Ga0105243_100008356 254
381 3300009148 Ga0105243_10138709 Ga0105243_101387092 254
382 3300011119 Ga0105246_10074021 Ga0105246_100740211 254
383 3300017792 Ga0163161_10133585 Ga0163161_101335852 254
384 3300017792 Ga0163161_10150070 Ga0163161_101500701 254
385 3300025256 Ga0209759_1020617 Ga0209759_10206172 254
386 3300025711 Ga0207696_1008887 Ga0207696_10088873 254
387 3300025728 Ga0207655_1000094 Ga0207655_100009491 254
388 3300025728 Ga0207655_1011118 Ga0207655_10111183 254
389 3300025728 Ga0207655_1015549 Ga0207655_10155494 254
390 3300025735 Ga0207713_1002900 Ga0207713_100290010 254
391 3300025735 Ga0207713_1103430 Ga0207713_11034301 254
392 3300025900 Ga0207710_10000018 Ga0207710_1000001810 254
393 3300025900 Ga0207710_10173721 Ga0207710_101737211 254
394 3300025913 Ga0207695_10010322 Ga0207695_100103226 254
395 3300025923 Ga0207681_10001656 Ga0207681_1000165612 254
396 3300025935 Ga0207709_10000016 Ga0207709_10000016152 254
397 3300025960 Ga0207651_10052391 Ga0207651_100523913 254
398 3300027312 Ga0209371_1000024 Ga0209371_1000024327 254
399 3300028379 Ga0268266_10007314 Ga0268266_100073145 254
400 3300029957 Ga0265324_10000120 Ga0265324_1000012029 254
401 3300030500 Ga0268256_1000026 Ga0268256_1000026327 254
402 3300031241 Ga0265325_10019448 Ga0265325_100194485 254
403 3300031711 Ga0265314_10000371 Ga0265314_1000037133 254
404 3300041411 Ga0439466_0035945 Ga0439466_0035945_482_1258 254
405 3300042009 Ga0439451_000967 Ga0439451_000967_2616_3380 254
406 3300042009 Ga0439451_002470 Ga0439451_002470_1126_1890 254
407 3300042009 Ga0439451_011617 Ga0439451_011617_818_1582 254
408 3300042013 Ga0439456_001614 Ga0439456_001614_218_982 254
409 3300042013 Ga0439456_007066 Ga0439456_007066_1212_1976 254
410 3300042145 Ga0450906_003609 Ga0450906_003609_220_984 254
411 3300046453 Ga0495627_041164 Ga0495627_041164_430_1206 254
412 3300046501 Ga0495607_0025288 Ga0495607_0025288_2632_3408 254
413 3300046507 Ga0495606_0029645 Ga0495606_0029645_2656_3420 254
414 3300046519 Ga0495632_0068838 Ga0495632_0068838_320_1096 254
415 3300046522 Ga0495643_0143317 Ga0495643_0143317_231_1007 254
416 3300046525 Ga0495663_0036198 Ga0495663_0036198_495_1271 254
417 3300046530 Ga0495654_0020233 Ga0495654_0020233_2445_3209 254
418 3300046694 Ga0495649_0040404 Ga0495649_0040404_1609_2373 254
419 3300048926 Ga0496123_0000676 Ga0496123_0000676_4929_5708 254
420 3300049459 Ga0495678_017898 Ga0495678_017898_2326_3090 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

47

286

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.6729 1 246
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.6293 1 251
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.6215 1 251
1knc-assembly1.cif.gz_A structure of ahpd from mycobacterium tuberculosis, a novel enzyme with thioredoxin-like activity. 0.3503 47 197
4jre-assembly1.cif.gz_A crystal structure of nitrate/nitrite exchanger nark with nitrite bound 0.3275 7 249
ID Description Score Start End Superfamily
af_B7YZU1_345_528_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4675 1 253 1.20.1250.20
af_Q54E81_92_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4668 39 253 1.20.1250.20
af_Q54E81_92_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4548 39 253 1.20.1250.20
af_B7YZU1_345_528_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4531 1 253 1.20.1250.20
af_Q5U419_3_402_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4462 38 243 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A318UVR3-F1-model_v4 Probable membrane transporter protein 0.9902 2 254 GO:0005886
AF-A0A0C1WQT6-F1-model_v4 deleted 0.9895 3 253
AF-A0A838ZYJ0-F1-model_v4 deleted 0.9834 2 250
AF-A0A1I4ZJV8-F1-model_v4 Probable membrane transporter protein 0.9826 2 251 GO:0005886
AF-A0A318UVR3-F1-model_v4 Probable membrane transporter protein 0.9825 2 254 GO:0005886

Feature Viewer

pLDDT pTM Quality
88.9 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map