F439727

General Info

Members Datasets Scaffolds Average Seq Length
420 263 840 175

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10218557|Ga0075366_102185572
Length 199
Sequence MREPEKGHAMSAGPRLSGTSVSVRDSEPAEIGAICDIYAHHVSHGFASFEEAPPDRAEMERRRAEILARGLPYLVAILPGRGPRDGDVAGYAYASPFRTRSAYRFTLENSVYVAPNMQRRSVGRALLAALLPRCAALGYRQMIAVIGDSANHASIGLHADVGFVEVGRLRAVGFKLGRWVDSVLMERALGPGDSTLPVS

Samples

Sample ID Description Type Environment
1 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
125 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
126 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
131 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
132 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
137 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
166 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
167 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
168 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
169 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
174 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
262 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
263 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 0.24
Rhizosphere 97.86
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075366_10218557 3300006195 Bacteria 1161
2 Ga0065707_10029294 3300005295 Bacteria 1117
3 Ga0065707_10213659 3300005295 Bacteria 1254
4 Ga0070658_10240494 3300005327 Bacteria 1534
5 Ga0070690_100249227 3300005330 Bacteria 1255
6 Ga0070690_100343654 3300005330 Bacteria 1081
7 Ga0068869_100000046 3300005334 Bacteria 51500
8 Ga0070680_100018820 3300005336 Bacteria 5463
9 Ga0070680_100128539 3300005336 Bacteria 2118
10 Ga0070680_100142969 3300005336 Bacteria 2006
11 Ga0070680_100196190 3300005336 Bacteria 1702
12 Ga0068868_100003952 3300005338 Bacteria 10349
13 Ga0068868_100006164 3300005338 Bacteria 8478
14 Ga0068868_100972624 3300005338 Bacteria 775
15 Ga0070660_100035940 3300005339 Bacteria 3751
16 Ga0070660_100051737 3300005339 Bacteria 3164
17 Ga0070689_100000735 3300005340 Bacteria 20024
18 Ga0070689_100014350 3300005340 Bacteria 5752
19 Ga0070691_10000467 3300005341 Bacteria 15058
20 Ga0070687_100000259 3300005343 Bacteria 17996
21 Ga0070692_10002149 3300005345 Bacteria 7552
22 Ga0070692_10230559 3300005345 Bacteria 1099
23 Ga0070692_10348542 3300005345 Bacteria 919
24 Ga0070668_100833007 3300005347 Bacteria 821
25 Ga0070669_100069662 3300005353 Bacteria 2598
26 Ga0070671_100707222 3300005355 Bacteria 874
27 Ga0070671_101424457 3300005355 Bacteria 612
28 Ga0070673_100091060 3300005364 Bacteria 2492
29 Ga0070688_100026742 3300005365 Bacteria 3431
30 Ga0070659_100001079 3300005366 Bacteria 19921
31 Ga0070659_100054654 3300005366 Bacteria 3145
32 Ga0070667_100080501 3300005367 Bacteria 2786
33 Ga0070709_10943795 3300005434 Bacteria 684
34 Ga0070710_10496250 3300005437 Unclassified 835
35 Ga0070710_10581515 3300005437 Bacteria 777
36 Ga0070705_100000479 3300005440 Bacteria 23052
37 Ga0070705_100958763 3300005440 Bacteria 692
38 Ga0070700_100001100 3300005441 Bacteria 13376
39 Ga0070700_100013803 3300005441 Bacteria 4544
40 Ga0070694_100000062 3300005444 Bacteria 51304
41 Ga0070694_100065432 3300005444 Bacteria 2490
42 Ga0070694_100360661 3300005444 Bacteria 1128
43 Ga0070708_100073087 3300005445 Bacteria 3090
44 Ga0070708_100917950 3300005445 Bacteria 822
45 Ga0070678_100091265 3300005456 Bacteria 2337
46 Ga0070662_100488291 3300005457 Unclassified 1026
47 Ga0070681_10003186 3300005458 Bacteria 15274
48 Ga0070681_10017133 3300005458 Bacteria 7243
49 Ga0070681_10020810 3300005458 Bacteria 6570
50 Ga0070681_10226819 3300005458 Bacteria 1783
51 Ga0070681_10609825 3300005458 Bacteria 1006
52 Ga0068867_100001951 3300005459 Bacteria 14377
53 Ga0068867_100002217 3300005459 Bacteria 13637
54 Ga0070707_100197526 3300005468 Bacteria 1961
55 Ga0070707_100331410 3300005468 Bacteria 1479
56 Ga0070698_100034476 3300005471 Bacteria 5238
57 Ga0070679_100009240 3300005530 Bacteria 9318
58 Ga0070679_100032506 3300005530 Bacteria 5162
59 Ga0070679_100033200 3300005530 Bacteria 5110
60 Ga0070679_100192768 3300005530 Bacteria 2006
61 Ga0070684_100699035 3300005535 Bacteria 945
62 Ga0070697_100196228 3300005536 Bacteria 1714
63 Ga0068853_100268561 3300005539 Bacteria 1570
64 Ga0070686_100000257 3300005544 Bacteria 36214
65 Ga0070686_100012974 3300005544 Bacteria 4757
66 Ga0070695_100000721 3300005545 Bacteria 17637
67 Ga0070695_100909062 3300005545 Bacteria 711
68 Ga0070696_100000126 3300005546 Bacteria 40723
69 Ga0070696_100150477 3300005546 Bacteria 1708
70 Ga0070696_100364313 3300005546 Bacteria 1123
71 Ga0070696_100501272 3300005546 Unclassified 966
72 Ga0070693_100001337 3300005547 Bacteria 11093
73 Ga0070693_100090989 3300005547 Bacteria 1839
74 Ga0070693_100098599 3300005547 Bacteria 1776
75 Ga0070704_100000394 3300005549 Bacteria 20035
76 Ga0070704_100022518 3300005549 Bacteria 4102
77 Ga0070704_100076388 3300005549 Bacteria 2450
78 Ga0070704_100229602 3300005549 Bacteria 1513
79 Ga0070704_101226620 3300005549 Bacteria 685
80 Ga0068855_100001752 3300005563 Bacteria 27089
81 Ga0068855_100143243 3300005563 Bacteria 2722
82 Ga0068855_100401055 3300005563 Bacteria 1503
83 Ga0070664_101088726 3300005564 Bacteria 752
84 Ga0068857_100622663 3300005577 Bacteria 1021
85 Ga0068854_100004710 3300005578 Bacteria 8597
86 Ga0068856_100021593 3300005614 Bacteria 6256
87 Ga0068856_100088759 3300005614 Bacteria 3074
88 Ga0068856_100946420 3300005614 Bacteria 880
89 Ga0068856_101527677 3300005614 Bacteria 681
90 Ga0070702_100000026 3300005615 Bacteria 42816
91 Ga0068859_100003441 3300005617 Bacteria 16089
92 Ga0068864_100151866 3300005618 Bacteria 2098
93 Ga0068864_100232408 3300005618 Bacteria 1706
94 Ga0068864_100450134 3300005618 Bacteria 1231
95 Ga0068866_10028055 3300005718 Bacteria 2679
96 Ga0068861_100001779 3300005719 Bacteria 13854
97 Ga0068861_100011483 3300005719 Bacteria 6162
98 Ga0068861_100374500 3300005719 Bacteria 1256
99 Ga0068861_100579176 3300005719 Bacteria 1027
100 Ga0068870_10144334 3300005840 Bacteria 1396
101 Ga0068870_10188436 3300005840 Bacteria 1243
102 Ga0068863_100462666 3300005841 Bacteria 1246
103 Ga0068858_100002607 3300005842 Bacteria 18166
104 Ga0068858_100176664 3300005842 Bacteria 2015
105 Ga0068858_100210893 3300005842 Bacteria 1838
106 Ga0068862_100001177 3300005844 Bacteria 24652
107 Ga0068862_100036949 3300005844 Bacteria 4139
108 Ga0075367_10032330 3300006178 Bacteria 3010
109 Ga0097621_100000759 3300006237 Bacteria 22639
110 Ga0097621_100007239 3300006237 Bacteria 7922
111 Ga0097621_100563258 3300006237 Bacteria 1038
112 Ga0068871_100002707 3300006358 Bacteria 12093
113 Ga0068871_100086031 3300006358 Bacteria 2612
114 Ga0075428_100062352 3300006844 Bacteria 4082
115 Ga0075428_100212315 3300006844 Bacteria 2091
116 Ga0075430_100767389 3300006846 Unclassified 795
117 Ga0075431_100119370 3300006847 Bacteria 2721
118 Ga0075431_100146435 3300006847 Bacteria 2434
119 Ga0075431_100176367 3300006847 Bacteria 2195
120 Ga0075433_10034370 3300006852 Bacteria 4354
121 Ga0075434_100000065 3300006871 Bacteria 54115
122 Ga0075434_100000108 3300006871 Bacteria 47506
123 Ga0075434_100016926 3300006871 Bacteria 7013
124 Ga0075434_100334437 3300006871 Bacteria 1535
125 Ga0075429_100045033 3300006880 Bacteria 3839
126 Ga0075429_100099746 3300006880 Bacteria 2534
127 Ga0068865_100000559 3300006881 Bacteria 20688
128 Ga0068865_100029764 3300006881 Bacteria 3627
129 Ga0075436_100000392 3300006914 Bacteria 28103
130 Ga0075436_100001247 3300006914 Bacteria 17286
131 Ga0075436_100002541 3300006914 Bacteria 12559
132 Ga0075436_100048360 3300006914 Bacteria 2935
133 Ga0097620_100003441 3300006931 Bacteria 16089
134 Ga0075435_100000853 3300007076 Bacteria 19069
135 Ga0075435_100012710 3300007076 Bacteria 6236
136 Ga0105240_10084999 3300009093 Bacteria 3878
137 Ga0105240_11013980 3300009093 Bacteria 887
138 Ga0111539_10027825 3300009094 Bacteria 6904
139 Ga0111539_10054092 3300009094 Bacteria 4777
140 Ga0111539_10147663 3300009094 Bacteria 2753
141 Ga0111539_10379907 3300009094 Bacteria 1645
142 Ga0111539_10690891 3300009094 Bacteria 1188
143 Ga0105245_10034774 3300009098 Bacteria 4470
144 Ga0105245_10093035 3300009098 Bacteria 2777
145 Ga0114129_10056667 3300009147 Bacteria 5487
146 Ga0114129_10129570 3300009147 Bacteria 3467
147 Ga0114129_10557575 3300009147 Bacteria 1489
148 Ga0114129_11929024 3300009147 Bacteria 716
149 Ga0105241_10036676 3300009174 Bacteria 3690
150 Ga0105242_10002623 3300009176 Bacteria 14103
151 Ga0105242_10146974 3300009176 Bacteria 2051
152 Ga0105238_10051514 3300009551 Bacteria 4141
153 Ga0105238_10113460 3300009551 Bacteria 2690
154 Ga0105249_10002411 3300009553 Bacteria 16230
155 Ga0105239_10074022 3300010375 Bacteria 3745
156 Ga0157370_10010465 3300013104 Bacteria 9769
157 Ga0157378_10098998 3300013297 Bacteria 2660
158 Ga0157378_10439198 3300013297 Bacteria 1293
159 Ga0163162_10230539 3300013306 Bacteria 1982
160 Ga0163162_11354004 3300013306 Bacteria 809
161 Ga0157375_10262058 3300013308 Bacteria 1890
162 Ga0157375_10886768 3300013308 Bacteria 1037
163 Ga0157375_11001729 3300013308 Bacteria 975
164 Ga0157380_10001411 3300014326 Bacteria 15707
165 Ga0157380_10203735 3300014326 Bacteria 1757
166 Ga0157377_10133203 3300014745 Bacteria 1520
167 Ga0157377_10167868 3300014745 Bacteria 1370
168 Ga0157377_10217957 3300014745 Bacteria 1220
169 Ga0157376_10249372 3300014969 Bacteria 1657
170 Ga0213872_10168908 3300021361 Bacteria 949
171 Ga0207699_10802706 3300025906 Bacteria 692
172 Ga0207645_10133262 3300025907 Bacteria 1618
173 Ga0207705_10001793 3300025909 Bacteria 16928
174 Ga0207707_10000964 3300025912 Bacteria 27667
175 Ga0207660_10003006 3300025917 Bacteria 11037
176 Ga0207660_10215370 3300025917 Bacteria 1505
177 Ga0207660_10405450 3300025917 Bacteria 1098
178 Ga0207660_10678841 3300025917 Bacteria 840
179 Ga0207662_10108113 3300025918 Bacteria 1731
180 Ga0207657_10004370 3300025919 Bacteria 14958
181 Ga0207657_10450465 3300025919 Bacteria 1010
182 Ga0207649_10502436 3300025920 Bacteria 922
183 Ga0207652_10065866 3300025921 Bacteria 3138
184 Ga0207646_10221655 3300025922 Bacteria 1709
185 Ga0207681_10001563 3300025923 Bacteria 14728
186 Ga0207659_10617442 3300025926 Bacteria 925
187 Ga0207687_10028013 3300025927 Bacteria 3783
188 Ga0207644_10466430 3300025931 Bacteria 1039
189 Ga0207690_10002092 3300025932 Bacteria 12220
190 Ga0207690_10063262 3300025932 Bacteria 2522
191 Ga0207706_10060747 3300025933 Bacteria 3328
192 Ga0207709_10008173 3300025935 Bacteria 5794
193 Ga0207670_10277045 3300025936 Bacteria 1306
194 Ga0207669_10854922 3300025937 Unclassified 757
195 Ga0207665_10491156 3300025939 Bacteria 947
196 Ga0207667_10047415 3300025949 Bacteria 4548
197 Ga0207667_11147259 3300025949 Bacteria 759
198 Ga0207651_10059470 3300025960 Bacteria 2648
199 Ga0207658_10233379 3300025986 Bacteria 1554
200 Ga0207677_10049882 3300026023 Bacteria 2827
201 Ga0207677_10936625 3300026023 Bacteria 783
202 Ga0207703_10300389 3300026035 Bacteria 1464
203 Ga0207708_10076504 3300026075 Bacteria 2567
204 Ga0207708_10401525 3300026075 Bacteria 1133
205 Ga0207648_10003499 3300026089 Bacteria 16448
206 Ga0207676_10198750 3300026095 Bacteria 1770
207 Ga0207676_11316974 3300026095 Bacteria 717
208 Ga0207674_10510313 3300026116 Bacteria 1161
209 Ga0207675_100010682 3300026118 Bacteria 8602
210 Ga0207675_100360555 3300026118 Bacteria 1426
211 Ga0209981_1007099 3300027378 Bacteria 1506
212 Ga0209981_1022492 3300027378 Bacteria 904
213 Ga0209996_1001480 3300027395 Bacteria 2842
214 Ga0210000_1008034 3300027462 Bacteria 1547
215 Ga0209995_1011717 3300027471 Bacteria 1427
216 Ga0209968_1000512 3300027526 Bacteria 6097
217 Ga0209968_1007489 3300027526 Bacteria 1652
218 Ga0209966_1000382 3300027695 Bacteria 13432
219 Ga0207428_10038672 3300027907 Bacteria 3877
220 Ga0207428_10057475 3300027907 Bacteria 3088
221 Ga0268265_10003205 3300028380 Bacteria 11875
222 Ga0307408_100386623 3300031548 Bacteria 1198
223 Ga0316575_10007869 3300031665 Bacteria 3868
224 Ga0316579_10008918 3300031691 Bacteria 4203
225 Ga0316578_10002596 3300031728 Bacteria 7997
226 Ga0307412_10775253 3300031911 Bacteria 830
227 Ga0307416_100086929 3300032002 Bacteria 2667
228 Ga0307416_100311156 3300032002 Bacteria 1572
229 Ga0307411_10524285 3300032005 Bacteria 1006
230 Ga0316583_10004286 3300032133 Bacteria 5086
231 Ga0373948_0064397 3300034817 Bacteria 811
232 Ga0373958_0051149 3300034819 Bacteria 873
233 Ga0373958_0076748 3300034819 Bacteria 750
234 Ga0373958_0079146 3300034819 Bacteria 741
235 Ga0373926_0080465 3300035083 Bacteria 1204
236 Ga0373929_0119511 3300035085 Bacteria 681
237 Ga0373934_0068926 3300035086 Bacteria 1413
238 Ga0373949_0032375 3300035090 Bacteria 1251
239 Ga0373951_0175332 3300035091 Bacteria 613
240 Ga0373923_0040228 3300035111 Bacteria 1923
241 Ga0373923_0140310 3300035111 Bacteria 1092
242 Ga0373932_0004265 3300035112 Bacteria 3393
243 Ga0373936_0272091 3300035113 Bacteria 760
244 Ga0373939_0010741 3300035114 Bacteria 2297
245 Ga0373939_0061956 3300035114 Bacteria 1194
246 Ga0373941_0007037 3300035115 Bacteria 2735
247 Ga0373941_0022977 3300035115 Bacteria 1776
248 Ga0373945_0008454 3300035116 Bacteria 3354
249 Ga0373953_0130117 3300035117 Bacteria 1073
250 Ga0373953_0171999 3300035117 Bacteria 933
251 Ga0373954_0000137 3300035118 Bacteria 25393
252 Ga0373954_0394309 3300035118 Bacteria 684
253 Ga0373956_0010027 3300035119 Bacteria 3867
254 Ga0373957_0021902 3300035120 Bacteria 2273
255 Ga0373960_0033598 3300035121 Bacteria 1447
256 Ga0373960_0092637 3300035121 Bacteria 968
257 Ga0373943_0020652 3300035170 Bacteria 3038
258 Ga0373942_0155081 3300035207 Bacteria 738
259 Ga0316574_0415342 3300035398 Bacteria 846
260 Ga0373924_0006800 3300035410 Bacteria 4108
261 Ga0373924_0027812 3300035410 Bacteria 2250
262 Ga0373924_0311354 3300035410 Bacteria 699
263 Ga0373931_0001402 3300035691 Bacteria 10313
264 Ga0373931_0024157 3300035691 Bacteria 3075
265 Ga0373931_0026776 3300035691 Bacteria 2938
266 Ga0373931_0041456 3300035691 Bacteria 2418
267 Ga0373931_0203408 3300035691 Bacteria 1184
268 Ga0373931_0820640 3300035691 Bacteria 621
269 Ga0373935_0013223 3300035692 Bacteria 4977
270 Ga0373927_0043502 3300035695 Bacteria 2907
271 Ga0373933_0001635 3300035724 Bacteria 13056
272 Ga0373933_0019900 3300035724 Bacteria 3799
273 Ga0373937_0075632 3300036401 Bacteria 3109
274 Ga0373937_0178516 3300036401 Bacteria 1994
275 Ga0373937_0237290 3300036401 Bacteria 1717
276 Ga0316582_0056184 3300036647 Bacteria 2510
277 Ga0373925_0043050 3300037068 Bacteria 3350
278 Ga0395905_0410871 3300037471 Bacteria 1249
279 Ga0436360_0833339 3300039438 Bacteria 3811
280 Ga0436361_0329701 3300039447 Bacteria 2409
281 Ga0436361_0690503 3300039447 Bacteria 1154
282 Ga0436363_0031132 3300039450 Bacteria 5585
283 Ga0436362_1270268 3300039453 Bacteria 1129
284 Ga0439461_0006049 3300041410 Bacteria 2094
285 Ga0451807_2354107 3300041486 Bacteria 2595
286 Ga0439431_0048559 3300041997 Bacteria 1096
287 Ga0439441_067284 3300042001 Bacteria 763
288 Ga0450896_013988 3300042133 Bacteria 1144
289 Ga0439434_0000708 3300042435 Bacteria 9598
290 Ga0439459_0029775 3300042438 Bacteria 1103
291 Ga0451577_0018749 3300042876 Bacteria 6367
292 Ga0466977_0000354 3300044666 Bacteria 14062
293 Ga0453683_0015663 3300044673 Bacteria 4905
294 Ga0466961_0060871 3300044693 Bacteria 2400
295 Ga0466963_0195790 3300044694 Bacteria 1413
296 Ga0453684_0159257 3300044712 Bacteria 2672
297 Ga0451576_0000493 3300045051 Bacteria 87000
298 Ga0451576_0026022 3300045051 Bacteria 6296
299 Ga0451576_0034790 3300045051 Bacteria 5349
300 Ga0451576_0151084 3300045051 Bacteria 2422
301 Ga0451576_0966451 3300045051 Bacteria 893
302 Ga0466958_0423286 3300045836 Bacteria 861
303 Ga0466967_0005524 3300045976 Bacteria 8778
304 Ga0466967_0118749 3300045976 Bacteria 2440
305 Ga0495603_0147878 3300046455 Bacteria 1365
306 Ga0495653_0221058 3300046463 Bacteria 1273
307 Ga0495580_0157295 3300046472 Bacteria 1573
308 Ga0495582_0031254 3300046473 Bacteria 2926
309 Ga0495639_0026770 3300046475 Bacteria 2550
310 Ga0495639_0074601 3300046475 Bacteria 1572
311 Ga0495662_0007371 3300046476 Bacteria 5436
312 Ga0495662_0014090 3300046476 Bacteria 3892
313 Ga0495594_0104566 3300046499 Bacteria 1594
314 Ga0495608_0004006 3300046511 Bacteria 10571
315 Ga0495628_0004512 3300046516 Bacteria 12336
316 Ga0495666_0007796 3300046526 Bacteria 5361
317 Ga0495642_0172894 3300046528 Bacteria 939
318 Ga0495665_0209083 3300046531 Bacteria 1010
319 Ga0495640_0013295 3300046533 Bacteria 6258
320 Ga0495586_0000357 3300046535 Bacteria 28588
321 Ga0495586_0006148 3300046535 Bacteria 6417
322 Ga0495586_0067472 3300046535 Bacteria 1951
323 Ga0495587_0033890 3300046536 Bacteria 3080
324 Ga0495621_0037414 3300046539 Bacteria 1688
325 Ga0495645_0059929 3300046543 Bacteria 2759
326 Ga0495622_0074294 3300046557 Bacteria 1568
327 Ga0495667_0264761 3300046559 Bacteria 1093
328 Ga0495635_0044103 3300046663 Bacteria 3077
329 Ga0495588_0085697 3300046674 Bacteria 1647
330 Ga0495599_0006228 3300046678 Bacteria 7191
331 Ga0495623_0288273 3300046679 Bacteria 911
332 Ga0495647_0002281 3300046681 Bacteria 6017
333 Ga0495658_0000597 3300046683 Bacteria 19759
334 Ga0495658_0009162 3300046683 Bacteria 4921
335 Ga0495658_0096720 3300046683 Bacteria 1757
336 Ga0495669_0002228 3300046684 Bacteria 7955
337 Ga0495624_0038445 3300046690 Bacteria 3074
338 Ga0495624_0091865 3300046690 Bacteria 1872
339 Ga0495600_0008355 3300046809 Bacteria 6357
340 Ga0495581_0105842 3300047315 Bacteria 1635
341 Ga0495636_0011849 3300047318 Bacteria 3455
342 Ga0495676_0082481 3300047321 Bacteria 2433
343 Ga0495680_0031782 3300047322 Bacteria 4292
344 Ga0495680_0120452 3300047322 Bacteria 1938
345 Ga0495675_0139390 3300047444 Bacteria 1504
346 Ga0495684_0038559 3300047471 Bacteria 3663
347 Ga0496121_0053203 3300048924 Bacteria 3394
348 Ga0496122_0117990 3300048925 Bacteria 1721
349 Ga0501291_038725 3300049514 Bacteria 831
350 Ga0501032_0096170 3300049569 Bacteria 1963
351 Ga0501033_0001712 3300049570 Bacteria 19215
352 Ga0501034_0159792 3300049571 Bacteria 2225
353 Ga0501034_0284207 3300049571 Bacteria 1594
354 Ga0501036_0000136 3300049572 Bacteria 47600
355 Ga0501037_0101643 3300049573 Bacteria 2074
356 Ga0501038_0000957 3300049574 Bacteria 25820
357 Ga0501039_0016421 3300049575 Bacteria 5670
358 Ga0501039_0262622 3300049575 Bacteria 1357
359 Ga0501040_0000610 3300049576 Bacteria 21868
360 Ga0501040_0380068 3300049576 Bacteria 1013
361 Ga0501041_0008051 3300049577 Bacteria 6202
362 Ga0501042_0002520 3300049578 Bacteria 11277
363 Ga0501042_0260185 3300049578 Bacteria 1253
364 Ga0501043_0014667 3300049579 Bacteria 6135
365 Ga0501046_0005254 3300049580 Bacteria 11577
366 Ga0501047_0474511 3300049581 Bacteria 1079
367 Ga0501048_0000446 3300049582 Bacteria 29088
368 Ga0501048_0155819 3300049582 Bacteria 1616
369 Ga0501068_0046779 3300049584 Bacteria 2608
370 Ga0501070_0120504 3300049586 Bacteria 2168
371 Ga0501070_0157313 3300049586 Bacteria 1874
372 Ga0501071_0021108 3300049587 Bacteria 4535
373 Ga0501072_0004725 3300049588 Bacteria 10376
374 Ga0501073_0099540 3300049589 Bacteria 2019
375 Ga0501073_0374386 3300049589 Bacteria 984
376 Ga0501074_0005326 3300049590 Bacteria 9249
377 Ga0501075_0001739 3300049591 Bacteria 14314
378 Ga0501076_0026774 3300049592 Bacteria 4469
379 Ga0501077_0000204 3300049593 Bacteria 34422
380 Ga0501079_0000105 3300049741 Bacteria 43031
381 Ga0501079_0256539 3300049741 Bacteria 1367
382 Ga0501080_0071301 3300049742 Bacteria 3232
383 Ga0501081_0006817 3300049743 Bacteria 7427
384 Ga0501083_0030360 3300049744 Bacteria 3714
385 Ga0501283_023823 3300049779 Bacteria 995
386 Ga0501044_0287684 3300049823 Bacteria 1576
387 Ga0501045_0025721 3300049824 Bacteria 4232
388 Ga0501045_0267455 3300049824 Bacteria 1273
389 nmdc:mga06z11_56886_c1 3300050494 Bacteria 2024
390 nmdc:mga05p37_1324146_c1 3300050507 Bacteria 732
391 nmdc:mga05p37_42418_c1 3300050507 Bacteria 5589
392 nmdc:mga05p37_559688_c1 3300050507 Bacteria 1299
393 nmdc:mga05p37_614801_c1 3300050507 Bacteria 1224
394 nmdc:mga09592_316746_c1 3300050508 Bacteria 1352
395 nmdc:mga09592_61399_c1 3300050508 Bacteria 3179
396 nmdc:mga0qj67_52480_c1 3300050509 Bacteria 3227
397 nmdc:mga06r32_112666_c1 3300050510 Bacteria 2677
398 nmdc:mga06r32_160108_c1 3300050510 Bacteria 2233
399 nmdc:mga06r32_992596_c1 3300050510 Bacteria 793
400 nmdc:mga08y16_26724_c1 3300050511 Bacteria 6082
401 nmdc:mga08y16_65163_c1 3300050511 Bacteria 3804
402 nmdc:mga08y16_79970_c1 3300050511 Bacteria 3408
403 nmdc:mga0n895_151892_c1 3300050512 Bacteria 2346
404 nmdc:mga0n895_40347_c1 3300050512 Bacteria 4534
405 nmdc:mga0n895_84_c1 3300050512 Bacteria 54345
406 nmdc:mga0n895_94999_c1 3300050512 Bacteria 2986
407 nmdc:mga0rr50_2051_c1 3300050513 Bacteria 11237
408 nmdc:mga08x19_1187_c1 3300050514 Bacteria 16310
409 nmdc:mga08x19_164555_c1 3300050514 Bacteria 1508
410 nmdc:mga08x19_29548_c1 3300050514 Bacteria 3438
411 nmdc:mga0a205_364917_c1 3300050515 Bacteria 1310
412 nmdc:mga0a205_404254_c1 3300050515 Bacteria 1229
413 nmdc:mga0a205_877881_c1 3300050515 Bacteria 744
414 Ga0500637_0168698 3300053178 Bacteria 1259
415 Ga0501084_0003846 3300054114 Bacteria 12221
416 Ga0501082_0007655 3300060353 Bacteria 9319
417 Ga0501082_0157644 3300060353 Bacteria 1972
418 Ga0530510_0001821 3300061734 Bacteria 14540
419 2512035925 2511231221 Bacteria 6846400
420 2894773231 2894772417 Bacteria 5305674
421 Ga0075366_10218557
422 Ga0065707_10029294
423 Ga0065707_10213659
424 Ga0070658_10240494
425 Ga0070690_100249227
426 Ga0070690_100343654
427 Ga0068869_100000046
428 Ga0070680_100018820
429 Ga0070680_100128539
430 Ga0070680_100142969
431 Ga0070680_100196190
432 Ga0068868_100003952
433 Ga0068868_100006164
434 Ga0068868_100972624
435 Ga0070660_100035940
436 Ga0070660_100051737
437 Ga0070689_100000735
438 Ga0070689_100014350
439 Ga0070691_10000467
440 Ga0070687_100000259
441 Ga0070692_10002149
442 Ga0070692_10230559
443 Ga0070692_10348542
444 Ga0070668_100833007
445 Ga0070669_100069662
446 Ga0070671_100707222
447 Ga0070671_101424457
448 Ga0070673_100091060
449 Ga0070688_100026742
450 Ga0070659_100001079
451 Ga0070659_100054654
452 Ga0070667_100080501
453 Ga0070709_10943795
454 Ga0070710_10496250
455 Ga0070710_10581515
456 Ga0070705_100000479
457 Ga0070705_100958763
458 Ga0070700_100001100
459 Ga0070700_100013803
460 Ga0070694_100000062
461 Ga0070694_100065432
462 Ga0070694_100360661
463 Ga0070708_100073087
464 Ga0070708_100917950
465 Ga0070678_100091265
466 Ga0070662_100488291
467 Ga0070681_10003186
468 Ga0070681_10017133
469 Ga0070681_10020810
470 Ga0070681_10226819
471 Ga0070681_10609825
472 Ga0068867_100001951
473 Ga0068867_100002217
474 Ga0070707_100197526
475 Ga0070707_100331410
476 Ga0070698_100034476
477 Ga0070679_100009240
478 Ga0070679_100032506
479 Ga0070679_100033200
480 Ga0070679_100192768
481 Ga0070684_100699035
482 Ga0070697_100196228
483 Ga0068853_100268561
484 Ga0070686_100000257
485 Ga0070686_100012974
486 Ga0070695_100000721
487 Ga0070695_100909062
488 Ga0070696_100000126
489 Ga0070696_100150477
490 Ga0070696_100364313
491 Ga0070696_100501272
492 Ga0070693_100001337
493 Ga0070693_100090989
494 Ga0070693_100098599
495 Ga0070704_100000394
496 Ga0070704_100022518
497 Ga0070704_100076388
498 Ga0070704_100229602
499 Ga0070704_101226620
500 Ga0068855_100001752
501 Ga0068855_100143243
502 Ga0068855_100401055
503 Ga0070664_101088726
504 Ga0068857_100622663
505 Ga0068854_100004710
506 Ga0068856_100021593
507 Ga0068856_100088759
508 Ga0068856_100946420
509 Ga0068856_101527677
510 Ga0070702_100000026
511 Ga0068859_100003441
512 Ga0068864_100151866
513 Ga0068864_100232408
514 Ga0068864_100450134
515 Ga0068866_10028055
516 Ga0068861_100001779
517 Ga0068861_100011483
518 Ga0068861_100374500
519 Ga0068861_100579176
520 Ga0068870_10144334
521 Ga0068870_10188436
522 Ga0068863_100462666
523 Ga0068858_100002607
524 Ga0068858_100176664
525 Ga0068858_100210893
526 Ga0068862_100001177
527 Ga0068862_100036949
528 Ga0075367_10032330
529 Ga0097621_100000759
530 Ga0097621_100007239
531 Ga0097621_100563258
532 Ga0068871_100002707
533 Ga0068871_100086031
534 Ga0075428_100062352
535 Ga0075428_100212315
536 Ga0075430_100767389
537 Ga0075431_100119370
538 Ga0075431_100146435
539 Ga0075431_100176367
540 Ga0075433_10034370
541 Ga0075434_100000065
542 Ga0075434_100000108
543 Ga0075434_100016926
544 Ga0075434_100334437
545 Ga0075429_100045033
546 Ga0075429_100099746
547 Ga0068865_100000559
548 Ga0068865_100029764
549 Ga0075436_100000392
550 Ga0075436_100001247
551 Ga0075436_100002541
552 Ga0075436_100048360
553 Ga0097620_100003441
554 Ga0075435_100000853
555 Ga0075435_100012710
556 Ga0105240_10084999
557 Ga0105240_11013980
558 Ga0111539_10027825
559 Ga0111539_10054092
560 Ga0111539_10147663
561 Ga0111539_10379907
562 Ga0111539_10690891
563 Ga0105245_10034774
564 Ga0105245_10093035
565 Ga0114129_10056667
566 Ga0114129_10129570
567 Ga0114129_10557575
568 Ga0114129_11929024
569 Ga0105241_10036676
570 Ga0105242_10002623
571 Ga0105242_10146974
572 Ga0105238_10051514
573 Ga0105238_10113460
574 Ga0105249_10002411
575 Ga0105239_10074022
576 Ga0157370_10010465
577 Ga0157378_10098998
578 Ga0157378_10439198
579 Ga0163162_10230539
580 Ga0163162_11354004
581 Ga0157375_10262058
582 Ga0157375_10886768
583 Ga0157375_11001729
584 Ga0157380_10001411
585 Ga0157380_10203735
586 Ga0157377_10133203
587 Ga0157377_10167868
588 Ga0157377_10217957
589 Ga0157376_10249372
590 Ga0213872_10168908
591 Ga0207699_10802706
592 Ga0207645_10133262
593 Ga0207705_10001793
594 Ga0207707_10000964
595 Ga0207660_10003006
596 Ga0207660_10215370
597 Ga0207660_10405450
598 Ga0207660_10678841
599 Ga0207662_10108113
600 Ga0207657_10004370
601 Ga0207657_10450465
602 Ga0207649_10502436
603 Ga0207652_10065866
604 Ga0207646_10221655
605 Ga0207681_10001563
606 Ga0207659_10617442
607 Ga0207687_10028013
608 Ga0207644_10466430
609 Ga0207690_10002092
610 Ga0207690_10063262
611 Ga0207706_10060747
612 Ga0207709_10008173
613 Ga0207670_10277045
614 Ga0207669_10854922
615 Ga0207665_10491156
616 Ga0207667_10047415
617 Ga0207667_11147259
618 Ga0207651_10059470
619 Ga0207658_10233379
620 Ga0207677_10049882
621 Ga0207677_10936625
622 Ga0207703_10300389
623 Ga0207708_10076504
624 Ga0207708_10401525
625 Ga0207648_10003499
626 Ga0207676_10198750
627 Ga0207676_11316974
628 Ga0207674_10510313
629 Ga0207675_100010682
630 Ga0207675_100360555
631 Ga0209981_1007099
632 Ga0209981_1022492
633 Ga0209996_1001480
634 Ga0210000_1008034
635 Ga0209995_1011717
636 Ga0209968_1000512
637 Ga0209968_1007489
638 Ga0209966_1000382
639 Ga0207428_10038672
640 Ga0207428_10057475
641 Ga0268265_10003205
642 Ga0307408_100386623
643 Ga0316575_10007869
644 Ga0316579_10008918
645 Ga0316578_10002596
646 Ga0307412_10775253
647 Ga0307416_100086929
648 Ga0307416_100311156
649 Ga0307411_10524285
650 Ga0316583_10004286
651 Ga0373948_0064397
652 Ga0373958_0051149
653 Ga0373958_0076748
654 Ga0373958_0079146
655 Ga0373926_0080465
656 Ga0373929_0119511
657 Ga0373934_0068926
658 Ga0373949_0032375
659 Ga0373951_0175332
660 Ga0373923_0040228
661 Ga0373923_0140310
662 Ga0373932_0004265
663 Ga0373936_0272091
664 Ga0373939_0010741
665 Ga0373939_0061956
666 Ga0373941_0007037
667 Ga0373941_0022977
668 Ga0373945_0008454
669 Ga0373953_0130117
670 Ga0373953_0171999
671 Ga0373954_0000137
672 Ga0373954_0394309
673 Ga0373956_0010027
674 Ga0373957_0021902
675 Ga0373960_0033598
676 Ga0373960_0092637
677 Ga0373943_0020652
678 Ga0373942_0155081
679 Ga0316574_0415342
680 Ga0373924_0006800
681 Ga0373924_0027812
682 Ga0373924_0311354
683 Ga0373931_0001402
684 Ga0373931_0024157
685 Ga0373931_0026776
686 Ga0373931_0041456
687 Ga0373931_0203408
688 Ga0373931_0820640
689 Ga0373935_0013223
690 Ga0373927_0043502
691 Ga0373933_0001635
692 Ga0373933_0019900
693 Ga0373937_0075632
694 Ga0373937_0178516
695 Ga0373937_0237290
696 Ga0316582_0056184
697 Ga0373925_0043050
698 Ga0395905_0410871
699 Ga0436360_0833339
700 Ga0436361_0329701
701 Ga0436361_0690503
702 Ga0436363_0031132
703 Ga0436362_1270268
704 Ga0439461_0006049
705 Ga0451807_2354107
706 Ga0439431_0048559
707 Ga0439441_067284
708 Ga0450896_013988
709 Ga0439434_0000708
710 Ga0439459_0029775
711 Ga0451577_0018749
712 Ga0466977_0000354
713 Ga0453683_0015663
714 Ga0466961_0060871
715 Ga0466963_0195790
716 Ga0453684_0159257
717 Ga0451576_0000493
718 Ga0451576_0026022
719 Ga0451576_0034790
720 Ga0451576_0151084
721 Ga0451576_0966451
722 Ga0466958_0423286
723 Ga0466967_0005524
724 Ga0466967_0118749
725 Ga0495603_0147878
726 Ga0495653_0221058
727 Ga0495580_0157295
728 Ga0495582_0031254
729 Ga0495639_0026770
730 Ga0495639_0074601
731 Ga0495662_0007371
732 Ga0495662_0014090
733 Ga0495594_0104566
734 Ga0495608_0004006
735 Ga0495628_0004512
736 Ga0495666_0007796
737 Ga0495642_0172894
738 Ga0495665_0209083
739 Ga0495640_0013295
740 Ga0495586_0000357
741 Ga0495586_0006148
742 Ga0495586_0067472
743 Ga0495587_0033890
744 Ga0495621_0037414
745 Ga0495645_0059929
746 Ga0495622_0074294
747 Ga0495667_0264761
748 Ga0495635_0044103
749 Ga0495588_0085697
750 Ga0495599_0006228
751 Ga0495623_0288273
752 Ga0495647_0002281
753 Ga0495658_0000597
754 Ga0495658_0009162
755 Ga0495658_0096720
756 Ga0495669_0002228
757 Ga0495624_0038445
758 Ga0495624_0091865
759 Ga0495600_0008355
760 Ga0495581_0105842
761 Ga0495636_0011849
762 Ga0495676_0082481
763 Ga0495680_0031782
764 Ga0495680_0120452
765 Ga0495675_0139390
766 Ga0495684_0038559
767 Ga0496121_0053203
768 Ga0496122_0117990
769 Ga0501291_038725
770 Ga0501032_0096170
771 Ga0501033_0001712
772 Ga0501034_0159792
773 Ga0501034_0284207
774 Ga0501036_0000136
775 Ga0501037_0101643
776 Ga0501038_0000957
777 Ga0501039_0016421
778 Ga0501039_0262622
779 Ga0501040_0000610
780 Ga0501040_0380068
781 Ga0501041_0008051
782 Ga0501042_0002520
783 Ga0501042_0260185
784 Ga0501043_0014667
785 Ga0501046_0005254
786 Ga0501047_0474511
787 Ga0501048_0000446
788 Ga0501048_0155819
789 Ga0501068_0046779
790 Ga0501070_0120504
791 Ga0501070_0157313
792 Ga0501071_0021108
793 Ga0501072_0004725
794 Ga0501073_0099540
795 Ga0501073_0374386
796 Ga0501074_0005326
797 Ga0501075_0001739
798 Ga0501076_0026774
799 Ga0501077_0000204
800 Ga0501079_0000105
801 Ga0501079_0256539
802 Ga0501080_0071301
803 Ga0501081_0006817
804 Ga0501083_0030360
805 Ga0501283_023823
806 Ga0501044_0287684
807 Ga0501045_0025721
808 Ga0501045_0267455
809 nmdc:mga06z11_56886_c1
810 nmdc:mga05p37_1324146_c1
811 nmdc:mga05p37_42418_c1
812 nmdc:mga05p37_559688_c1
813 nmdc:mga05p37_614801_c1
814 nmdc:mga09592_316746_c1
815 nmdc:mga09592_61399_c1
816 nmdc:mga0qj67_52480_c1
817 nmdc:mga06r32_112666_c1
818 nmdc:mga06r32_160108_c1
819 nmdc:mga06r32_992596_c1
820 nmdc:mga08y16_26724_c1
821 nmdc:mga08y16_65163_c1
822 nmdc:mga08y16_79970_c1
823 nmdc:mga0n895_151892_c1
824 nmdc:mga0n895_40347_c1
825 nmdc:mga0n895_84_c1
826 nmdc:mga0n895_94999_c1
827 nmdc:mga0rr50_2051_c1
828 nmdc:mga08x19_1187_c1
829 nmdc:mga08x19_164555_c1
830 nmdc:mga08x19_29548_c1
831 nmdc:mga0a205_364917_c1
832 nmdc:mga0a205_404254_c1
833 nmdc:mga0a205_877881_c1
834 Ga0500637_0168698
835 Ga0501084_0003846
836 Ga0501082_0007655
837 Ga0501082_0157644
838 Ga0530510_0001821
839 2512035925
840 2894773231

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

33

184

0.91

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

27

163

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dwn-assembly2.cif.gz_C crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa <structure_details = 0.9887 2 170
1yr0-assembly2.cif.gz_D crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens 0.9867 2 161
4j3g-assembly2.cif.gz_C crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis 0.9843 2 161
4mbu-assembly1.cif.gz_A crystal structure of n-acetyltransferase from staphylococcus aureus mu50 0.9822 2 162
5dwn-assembly2.cif.gz_C crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa <structure_details = 0.9772 2 170
ID Description Score Start End Superfamily
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9858 2 170 3.40.630.30
4mbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9817 2 162 3.40.630.30
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9744 2 170 3.40.630.30
4mbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9639 2 162 3.40.630.30
3dr6B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9619 2 167 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A537T1M5-F1-model_v4 N-acetyltransferase family protein 0.9998 62 169 GO:0016747
AF-A0A537RLT3-F1-model_v4 N-acetyltransferase family protein 0.9993 2 169 GO:0016747
AF-A0A7W4PBU3-F1-model_v4 N-acetyltransferase 0.999 2 170 GO:0016747
AF-A0A1F3YD81-F1-model_v4 GNAT family N-acetyltransferase 0.9986 2 169 GO:0016747
AF-H0FFQ9-F1-model_v4 GNAT family acetyltransferase 0.9986 2 170 GO:0016747

Map