metagRoot

F439714

General Info

Members	Datasets	Scaffolds	Average Seq Length
420	255	411	169

Family's Representative Sequence

Representative Sequence	3300005843\|Ga0068860_100350427\|Ga0068860_1003504272
Length	188
Sequence	MSMAPAIRILGIDPGLRTTGFGVIEAEGARLHYIASGTIRTDTVAIGQLPARLKIIFDGVREVTARYQPTCASLEIVFVNVNPQSTLLLGQARGAALTALVSNDLEVSEYTALQMKKAVVGHGQARKEQVQAMVARLLGLSAEPGKDAADALGLAICHAHAGASFAALAKHGTLTRRSHAQYRKGRSY

Samples

	Sample ID	Description	Type	Environment
1	2585428057	Methylibium sp. YR605	Isolate	Rhizosphere
2	2585428058	Methylibium sp. CF468	Isolate	Rhizosphere
3	2585428062	Methylibium sp. CF059	Isolate	Rhizosphere
4	2588253510	Rhizobacter sp. OV335	Isolate	Rhizosphere
5	2643221592	Rhizobacter sp. Root16D2	Isolate	Unclassified
6	2643221625	Rhizobacter sp. Root29	Isolate	Unclassified
7	2643221648	Rhizobacter sp. Root1238	Isolate	Unclassified
8	2831864461	Roseateles noduli HZ7	Isolate	Nodule
9	2886848708	Mitsuaria sp. TWR114	Isolate	Rhizosphere
10	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
11	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
12	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
13	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
14	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
15	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
16	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
17	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
18	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
19	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
20	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
21	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
22	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
23	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
24	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
25	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
26	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
27	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
28	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
29	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
30	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
31	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
32	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
33	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
34	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
35	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
36	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
37	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
38	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
39	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
40	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
41	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
42	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
43	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
44	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
45	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
46	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
47	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
48	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
49	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
50	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
51	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
52	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
53	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
54	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
55	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
56	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
57	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
58	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
59	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
60	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
61	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
62	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
63	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
64	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
65	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
66	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
68	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
69	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
70	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
71	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
72	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
73	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
74	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
75	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
76	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
77	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
79	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
80	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
81	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
82	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
83	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
84	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
85	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
86	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
87	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
88	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
89	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
90	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
91	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
92	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
93	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
94	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
95	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
96	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
97	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
98	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
99	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
100	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
101	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
102	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
103	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
104	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
105	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
106	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
107	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
147	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
156	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
157	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
158	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
159	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
160	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
161	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
162	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
163	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
164	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
165	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
166	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
167	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
168	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
169	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
170	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
171	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
172	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
173	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
174	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
175	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
176	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
177	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
178	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
179	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
180	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
181	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
182	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
183	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
184	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
185	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
186	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
187	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
188	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
189	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
190	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
191	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
192	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
193	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
194	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
195	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
196	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
197	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
198	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
199	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
200	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
201	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
202	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
203	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
204	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
205	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
206	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
207	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
208	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
209	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
210	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
211	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
212	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
213	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
214	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
215	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
216	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
217	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
218	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
219	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
220	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
221	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
222	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
223	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
224	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
225	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
226	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
227	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
228	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
229	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
230	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
231	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
232	3300049653	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control	Metagenome	Rhizosphere
233	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
234	3300049668	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought	Metagenome	Rhizosphere
235	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
236	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
237	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
238	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
239	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
240	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
241	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
242	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
243	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
244	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
245	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
246	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
247	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
248	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
249	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
250	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
251	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
252	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
253	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
254	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
255	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.86
Metatranscriptomes	0
Isolates	2.14

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	11.43
Nodule	0.71
Rhizoplane	3.33
Rhizosphere	76.67
Stem	0
Stem Tuber	0
Unclassified	7.86

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10017822	3300001979	Bacteria	2532
2	rootH1_10012732	3300003316	Bacteria	16383
3	rootH1_10029007	3300003316	Bacteria	5359
4	rootH1_10073131	3300003316	Bacteria	1456
5	rootH2_10008565	3300003320	Bacteria	3247
6	rootL2_10001240	3300003322	Bacteria	49675
7	rootL2_10036768	3300003322	Bacteria	5013
8	rootH1_10004543	3300003323	Bacteria	13850
9	rootH1_10020876	3300003323	Bacteria	4751
10	rootH1_10114536	3300003323	Bacteria	3091
11	Ga0055539_1000222	3300003752	Bacteria	40292
12	Ga0055533_1000016	3300003756	Bacteria	396179
13	Ga0055525_1001565	3300003759	Unclassified	3764
14	Ga0055526_1016751	3300003771	Bacteria	2846
15	Ga0055524_1001208	3300003775	Bacteria	15319
16	Ga0055524_1020305	3300003775	Bacteria	2242
17	Ga0055540_1018583	3300003792	Bacteria	1901
18	Ga0055531_10016340	3300003794	Bacteria	3206
19	Ga0055531_10020845	3300003794	Bacteria	2571
20	Ga0055543_1005869	3300004625	Bacteria	3066
21	Ga0065165_1000101	3300005262	Bacteria	141486
22	Ga0065165_1003212	3300005262	Bacteria	11913
23	Ga0070683_100081025	3300005329	Bacteria	3039
24	Ga0070670_100073176	3300005331	Bacteria	2944
25	Ga0070670_100090652	3300005331	Bacteria	2627
26	Ga0070670_100307830	3300005331	Bacteria	1386
27	Ga0070677_10069212	3300005333	Bacteria	1480
28	Ga0068869_100002073	3300005334	Bacteria	12041
29	Ga0070666_10619111	3300005335	Bacteria	791
30	Ga0068868_100028923	3300005338	Bacteria	4242
31	Ga0068868_100226270	3300005338	Bacteria	1568
32	Ga0068868_100422966	3300005338	Bacteria	1154
33	Ga0068868_101064377	3300005338	Bacteria	743
34	Ga0070660_100008567	3300005339	Bacteria	7161
35	Ga0070660_100129104	3300005339	Bacteria	2021
36	Ga0070661_100759093	3300005344	Bacteria	793
37	Ga0070669_100014598	3300005353	Bacteria	5591
38	Ga0070675_100013374	3300005354	Bacteria	6450
39	Ga0070675_100017521	3300005354	Bacteria	5692
40	Ga0070675_100155314	3300005354	Bacteria	1964
41	Ga0070675_100605402	3300005354	Bacteria	994
42	Ga0070671_100037288	3300005355	Bacteria	4031
43	Ga0070671_100489407	3300005355	Bacteria	1057
44	Ga0070671_101107225	3300005355	Bacteria	696
45	Ga0070674_100484646	3300005356	Bacteria	1027
46	Ga0070673_100244544	3300005364	Bacteria	1561
47	Ga0070659_100001014	3300005366	Bacteria	20566
48	Ga0070659_100036674	3300005366	Bacteria	3822
49	Ga0070659_100058246	3300005366	Bacteria	3048
50	Ga0070659_100660837	3300005366	Bacteria	902
51	Ga0070667_100005406	3300005367	Bacteria	10668
52	Ga0070667_100115482	3300005367	Bacteria	2331
53	Ga0070667_100649903	3300005367	Bacteria	974
54	Ga0070663_100069807	3300005455	Bacteria	2554
55	Ga0070663_100098591	3300005455	Bacteria	2177
56	Ga0070663_100470952	3300005455	Bacteria	1038
57	Ga0070678_100027486	3300005456	Bacteria	3863
58	Ga0070678_100085720	3300005456	Bacteria	2401
59	Ga0070678_100290236	3300005456	Bacteria	1386
60	Ga0070678_100309939	3300005456	Bacteria	1344
61	Ga0070678_100329939	3300005456	Bacteria	1305
62	Ga0070678_100608189	3300005456	Bacteria	977
63	Ga0070662_100001463	3300005457	Bacteria	14552
64	Ga0070662_100029212	3300005457	Bacteria	3847
65	Ga0070662_100770948	3300005457	Bacteria	816
66	Ga0068867_100000081	3300005459	Bacteria	59361
67	Ga0068867_100130650	3300005459	Bacteria	1951
68	Ga0068867_100259250	3300005459	Bacteria	1417
69	Ga0068867_100412845	3300005459	Bacteria	1141
70	Ga0070684_100009956	3300005535	Bacteria	7516
71	Ga0070684_100229615	3300005535	Bacteria	1694
72	Ga0068853_100014841	3300005539	Bacteria	6396
73	Ga0068853_100327725	3300005539	Bacteria	1420
74	Ga0068853_100810877	3300005539	Bacteria	897
75	Ga0070672_100000561	3300005543	Bacteria	21760
76	Ga0070672_100007343	3300005543	Bacteria	7473
77	Ga0070672_100128062	3300005543	Bacteria	2084
78	Ga0070672_100141505	3300005543	Bacteria	1985
79	Ga0070672_100142019	3300005543	Bacteria	1981
80	Ga0070696_100416091	3300005546	Bacteria	1054
81	Ga0070693_100010390	3300005547	Bacteria	4665
82	Ga0070693_100062743	3300005547	Bacteria	2163
83	Ga0070665_101091688	3300005548	Bacteria	809
84	Ga0068855_100015124	3300005563	Bacteria	9293
85	Ga0070664_100006317	3300005564	Bacteria	9561
86	Ga0070664_100017065	3300005564	Bacteria	5959
87	Ga0068857_100043587	3300005577	Bacteria	3979
88	Ga0068857_100150873	3300005577	Bacteria	2105
89	Ga0068854_100019891	3300005578	Bacteria	4532
90	Ga0068856_100025953	3300005614	Bacteria	5714
91	Ga0068856_100267419	3300005614	Bacteria	1725
92	Ga0070702_100029130	3300005615	Bacteria	2999
93	Ga0068852_100005075	3300005616	Bacteria	9367
94	Ga0068852_100010828	3300005616	Bacteria	6832
95	Ga0068852_100012059	3300005616	Bacteria	6542
96	Ga0068852_100039409	3300005616	Bacteria	3977
97	Ga0068852_100139075	3300005616	Bacteria	2245
98	Ga0068852_100354563	3300005616	Bacteria	1433
99	Ga0068852_100978250	3300005616	Bacteria	865
100	Ga0068859_100041195	3300005617	Bacteria	4640
101	Ga0068864_100010110	3300005618	Bacteria	7791
102	Ga0068864_100029161	3300005618	Bacteria	4669
103	Ga0068861_100037649	3300005719	Bacteria	3596
104	Ga0068861_100942130	3300005719	Bacteria	820
105	Ga0068851_10008878	3300005834	Bacteria	4661
106	Ga0068851_10058459	3300005834	Bacteria	1971
107	Ga0068851_10365253	3300005834	Bacteria	842
108	Ga0068863_100066821	3300005841	Bacteria	3401
109	Ga0068863_100161499	3300005841	Bacteria	2147
110	Ga0068858_100006772	3300005842	Bacteria	11149
111	Ga0068858_100010785	3300005842	Bacteria	8638
112	Ga0068860_100016235	3300005843	Bacteria	7260
113	Ga0068860_100350427	3300005843	Bacteria	1453
114	Ga0068862_100051041	3300005844	Bacteria	3537
115	Ga0075362_10075133	3300006177	Bacteria	1550
116	Ga0075366_10017250	3300006195	Bacteria	4154
117	Ga0075366_10048334	3300006195	Bacteria	2522
118	Ga0075366_10095312	3300006195	Bacteria	1784
119	Ga0075366_10131920	3300006195	Bacteria	1508
120	Ga0075366_10589950	3300006195	Bacteria	689
121	Ga0097621_100233066	3300006237	Bacteria	1608
122	Ga0075370_10025312	3300006353	Bacteria	3281
123	Ga0075370_10274214	3300006353	Bacteria	1001
124	Ga0068871_100038377	3300006358	Bacteria	3825
125	Ga0068871_100168082	3300006358	Bacteria	1878
126	Ga0068871_100568266	3300006358	Bacteria	1028
127	Ga0075430_100005009	3300006846	Bacteria	11150
128	Ga0075434_100136268	3300006871	Bacteria	2474
129	Ga0075429_100004433	3300006880	Bacteria	12064
130	Ga0068865_100122092	3300006881	Bacteria	1939
131	Ga0097620_100041196	3300006931	Bacteria	4640
132	Ga0099823_1003331	3300006944	Bacteria	15150
133	Ga0105240_10012261	3300009093	Bacteria	11845
134	Ga0105240_10515623	3300009093	Bacteria	1327
135	Ga0105245_10063572	3300009098	Bacteria	3333
136	Ga0114129_10033378	3300009147	Bacteria	7273
137	Ga0114129_10587260	3300009147	Bacteria	1445
138	Ga0105243_10019016	3300009148	Bacteria	5207
139	Ga0105243_10063371	3300009148	Bacteria	2962
140	Ga0105243_10983724	3300009148	Bacteria	845
141	Ga0105248_10200084	3300009177	Bacteria	2251
142	Ga0105237_10000407	3300009545	Bacteria	61234
143	Ga0105237_10074321	3300009545	Bacteria	3391
144	Ga0105238_10015817	3300009551	Bacteria	7638
145	Ga0105239_10000335	3300010375	Bacteria	68810
146	Ga0105246_10292976	3300011119	Bacteria	1310
147	Ga0157319_1000008	3300012497	Bacteria	315600
148	Ga0157370_10352910	3300013104	Bacteria	1355
149	Ga0157369_10020908	3300013105	Bacteria	7317
150	Ga0157374_10026288	3300013296	Bacteria	5236
151	Ga0157374_10037450	3300013296	Bacteria	4452
152	Ga0157378_10054411	3300013297	Bacteria	3563
153	Ga0157378_10320850	3300013297	Bacteria	1505
154	Ga0163162_10022700	3300013306	Bacteria	6187
155	Ga0157372_10071953	3300013307	Bacteria	3896
156	Ga0157372_10088826	3300013307	Bacteria	3510
157	Ga0157375_10026356	3300013308	Bacteria	5416
158	Ga0157375_10358498	3300013308	Bacteria	1624
159	Ga0163163_10571833	3300014325	Bacteria	1193
160	Ga0163163_11158660	3300014325	Bacteria	836
161	Ga0157380_10011366	3300014326	Bacteria	6433
162	Ga0157377_10000032	3300014745	Bacteria	121003
163	Ga0157379_10003468	3300014968	Bacteria	13351
164	Ga0157379_10011312	3300014968	Bacteria	7779
165	Ga0157379_10167268	3300014968	Bacteria	1985
166	Ga0157376_10017149	3300014969	Bacteria	5516
167	Ga0157376_10187443	3300014969	Bacteria	1895
168	Ga0163161_10007666	3300017792	Bacteria	7464
169	Ga0163161_10266429	3300017792	Bacteria	1339
170	Ga0209674_100041	3300025226	Bacteria	396231
171	Ga0209563_100043	3300025230	Bacteria	397271
172	Ga0209677_100096	3300025253	Bacteria	99089
173	Ga0209673_1006020	3300025273	Bacteria	5963
174	Ga0209673_1008957	3300025273	Bacteria	4397
175	Ga0209564_1000008	3300025295	Bacteria	953227
176	Ga0209050_1001143	3300025298	Bacteria	31915
177	Ga0209050_1001274	3300025298	Bacteria	28926
178	Ga0209256_1000413	3300025299	Bacteria	67123
179	Ga0209256_1003828	3300025299	Bacteria	10074
180	Ga0209051_1002377	3300025303	Bacteria	13590
181	Ga0209257_1002153	3300025304	Bacteria	20486
182	Ga0209257_1008878	3300025304	Bacteria	5548
183	Ga0207656_10010797	3300025321	Bacteria	3433
184	Ga0207656_10123071	3300025321	Bacteria	1209
185	Ga0207688_10034568	3300025901	Bacteria	2800
186	Ga0207680_10152307	3300025903	Bacteria	1543
187	Ga0207645_10126527	3300025907	Bacteria	1661
188	Ga0207645_10433611	3300025907	Bacteria	886
189	Ga0207705_10034357	3300025909	Bacteria	3625
190	Ga0207684_10084816	3300025910	Bacteria	2698
191	Ga0207671_10006217	3300025914	Bacteria	10713
192	Ga0207671_11028198	3300025914	Bacteria	649
193	Ga0207662_10124830	3300025918	Bacteria	1618
194	Ga0207657_10039936	3300025919	Bacteria	4163
195	Ga0207657_10254870	3300025919	Bacteria	1398
196	Ga0207649_10000951	3300025920	Bacteria	18067
197	Ga0207649_10010331	3300025920	Bacteria	5126
198	Ga0207649_10484767	3300025920	Bacteria	938
199	Ga0207649_10555511	3300025920	Bacteria	879
200	Ga0207681_10009855	3300025923	Bacteria	5844
201	Ga0207694_10023194	3300025924	Bacteria	4711
202	Ga0207694_10465634	3300025924	Bacteria	1056
203	Ga0207650_10009477	3300025925	Bacteria	6653
204	Ga0207650_10010846	3300025925	Bacteria	6262
205	Ga0207650_10169301	3300025925	Bacteria	1735
206	Ga0207650_10309401	3300025925	Bacteria	1292
207	Ga0207659_10003636	3300025926	Bacteria	9288
208	Ga0207659_10007851	3300025926	Bacteria	6595
209	Ga0207659_10243301	3300025926	Bacteria	1457
210	Ga0207687_10045195	3300025927	Bacteria	3043
211	Ga0207687_10736267	3300025927	Bacteria	838
212	Ga0207644_10727000	3300025931	Bacteria	828
213	Ga0207690_10000658	3300025932	Bacteria	22107
214	Ga0207690_10165038	3300025932	Bacteria	1654
215	Ga0207690_10281178	3300025932	Bacteria	1296
216	Ga0207706_10011820	3300025933	Bacteria	7950
217	Ga0207706_10069247	3300025933	Bacteria	3103
218	Ga0207706_10781748	3300025933	Bacteria	812
219	Ga0207709_10017165	3300025935	Bacteria	4036
220	Ga0207709_10030049	3300025935	Bacteria	3158
221	Ga0207691_10004379	3300025940	Bacteria	13691
222	Ga0207691_10008676	3300025940	Bacteria	9754
223	Ga0207691_10053656	3300025940	Bacteria	3680
224	Ga0207691_10241570	3300025940	Bacteria	1561
225	Ga0207691_10312694	3300025940	Bacteria	1348
226	Ga0207711_10048696	3300025941	Bacteria	3626
227	Ga0207711_10049262	3300025941	Bacteria	3607
228	Ga0207689_10031035	3300025942	Bacteria	4452
229	Ga0207661_10067819	3300025944	Bacteria	2902
230	Ga0207661_10133907	3300025944	Bacteria	2126
231	Ga0207679_10003109	3300025945	Bacteria	10278
232	Ga0207679_10044097	3300025945	Bacteria	3216
233	Ga0207679_10869898	3300025945	Bacteria	824
234	Ga0207667_10030541	3300025949	Bacteria	5829
235	Ga0207667_10378761	3300025949	Bacteria	1442
236	Ga0207640_10107798	3300025981	Bacteria	1968
237	Ga0207658_10045134	3300025986	Bacteria	3211
238	Ga0207658_10430467	3300025986	Bacteria	1165
239	Ga0207677_10074554	3300026023	Bacteria	2408
240	Ga0207677_10823586	3300026023	Bacteria	832
241	Ga0207703_10003521	3300026035	Bacteria	13096
242	Ga0207639_10005163	3300026041	Bacteria	8806
243	Ga0207639_10028226	3300026041	Bacteria	4095
244	Ga0207639_10083308	3300026041	Bacteria	2538
245	Ga0207639_10779034	3300026041	Bacteria	890
246	Ga0207678_10133052	3300026067	Bacteria	2122
247	Ga0207678_10154971	3300026067	Bacteria	1956
248	Ga0207678_10378868	3300026067	Bacteria	1223
249	Ga0207702_10017844	3300026078	Bacteria	5875
250	Ga0207641_10470520	3300026088	Bacteria	1217
251	Ga0207648_10001296	3300026089	Bacteria	27908
252	Ga0207648_10522033	3300026089	Bacteria	1088
253	Ga0207648_10683313	3300026089	Bacteria	950
254	Ga0207648_10877629	3300026089	Bacteria	837
255	Ga0207676_10005732	3300026095	Bacteria	8787
256	Ga0207676_10040483	3300026095	Bacteria	3571
257	Ga0207674_10011435	3300026116	Bacteria	9973
258	Ga0207674_10079074	3300026116	Bacteria	3293
259	Ga0207675_100063049	3300026118	Bacteria	3463
260	Ga0207675_100245072	3300026118	Bacteria	1733
261	Ga0207683_10036299	3300026121	Bacteria	4291
262	Ga0207683_10122074	3300026121	Bacteria	2340
263	Ga0207683_10269972	3300026121	Bacteria	1554
264	Ga0207683_10869652	3300026121	Bacteria	837
265	Ga0207698_10009766	3300026142	Bacteria	6129
266	Ga0207698_10017480	3300026142	Bacteria	4867
267	Ga0207698_10024114	3300026142	Bacteria	4264
268	Ga0207698_10106923	3300026142	Bacteria	2334
269	Ga0207698_10204334	3300026142	Bacteria	1772
270	Ga0209389_1002327	3300027296	Bacteria	14449
271	Ga0209981_1009144	3300027378	Bacteria	1353
272	Ga0209996_1001333	3300027395	Bacteria	2951
273	Ga0209995_1001463	3300027471	Bacteria	3647
274	Ga0209968_1000844	3300027526	Bacteria	4746
275	Ga0209966_1000309	3300027695	Bacteria	15889
276	Ga0209974_10014753	3300027876	Bacteria	2596
277	Ga0268265_10179089	3300028380	Bacteria	1820
278	Ga0268264_10004863	3300028381	Bacteria	11381
279	Ga0268264_10577706	3300028381	Bacteria	1105
280	Ga0268264_10775694	3300028381	Bacteria	956
281	Ga0307515_10000609	3300028794	Bacteria	83557
282	Ga0307515_10013045	3300028794	Bacteria	15569
283	Ga0307515_10035839	3300028794	Bacteria	8053
284	Ga0307515_10344904	3300028794	Bacteria	1139
285	Ga0268256_1037868	3300030500	Bacteria	1101
286	Ga0307512_10251299	3300030522	Bacteria	880
287	Ga0307513_10008116	3300031456	Bacteria	13478
288	Ga0307513_10093821	3300031456	Bacteria	3049
289	Ga0307513_10669509	3300031456	Bacteria	744
290	Ga0307509_10052528	3300031507	Bacteria	4350
291	Ga0307509_10241377	3300031507	Bacteria	1599
292	Ga0307408_100242317	3300031548	Bacteria	1482
293	Ga0307408_100275529	3300031548	Bacteria	1399
294	Ga0307508_10004265	3300031616	Bacteria	14031
295	Ga0307514_10023638	3300031649	Bacteria	4985
296	Ga0307405_10958469	3300031731	Bacteria	727
297	Ga0307413_10164467	3300031824	Bacteria	1563
298	Ga0307410_10018877	3300031852	Bacteria	4179
299	Ga0307406_10052508	3300031901	Bacteria	2593
300	Ga0307406_10294729	3300031901	Bacteria	1243
301	Ga0307412_10244626	3300031911	Bacteria	1390
302	Ga0307409_100375720	3300031995	Bacteria	1349
303	Ga0307416_100075710	3300032002	Bacteria	2818
304	Ga0307416_100502629	3300032002	Bacteria	1277
305	Ga0307411_10914847	3300032005	Bacteria	780
306	Ga0307507_10020165	3300033179	Bacteria	7478
307	Ga0373952_0006469	3300035092	Bacteria	2164
308	Ga0373932_0023814	3300035112	Bacteria	1642
309	Ga0373945_0371677	3300035116	Bacteria	623
310	Ga0373946_0523804	3300035171	Bacteria	610
311	Ga0373935_0768996	3300035692	Bacteria	710
312	Ga0373927_0066852	3300035695	Bacteria	2326
313	Ga0373947_0055986	3300035725	Bacteria	2383
314	Ga0373947_0230645	3300035725	Bacteria	1219
315	Ga0373937_0021907	3300036401	Bacteria	5738
316	Ga0373937_0140670	3300036401	Bacteria	2258
317	Ga0373937_0688594	3300036401	Bacteria	968
318	Ga0373925_0083763	3300037068	Bacteria	2429
319	Ga0395905_0041281	3300037471	Bacteria	4329
320	Ga0395905_0068368	3300037471	Bacteria	3327
321	Ga0436361_0869713	3300039447	Bacteria	3016
322	Ga0436361_1211597	3300039447	Bacteria	2762
323	Ga0451795_1564080	3300041456	Bacteria	1089
324	Ga0451800_1145861	3300041459	Bacteria	813
325	Ga0451802_1553398	3300041460	Bacteria	1526
326	Ga0451833_1000255	3300041491	Bacteria	1465
327	Ga0451833_1462293	3300041491	Bacteria	725
328	Ga0451847_0270602	3300041503	Bacteria	571
329	Ga0451843_0840498	3300041509	Bacteria	1311
330	Ga0451853_1659374	3300041512	Bacteria	1543
331	Ga0439450_019911	3300042008	Bacteria	1427
332	Ga0450898_007844	3300042134	Bacteria	1671
333	Ga0439459_0002793	3300042438	Bacteria	2722
334	Ga0439464_0025574	3300042439	Bacteria	1635
335	Ga0466963_0211530	3300044694	Bacteria	1357
336	Ga0453684_0016471	3300044712	Bacteria	11553
337	Ga0466968_0017780	3300044735	Bacteria	2846
338	Ga0451576_0051630	3300045051	Bacteria	4311
339	Ga0451576_0140364	3300045051	Bacteria	2520
340	Ga0451576_0528239	3300045051	Bacteria	1240
341	Ga0495650_0002349	3300046471	Bacteria	15614
342	Ga0495580_0064395	3300046472	Bacteria	2570
343	Ga0495580_0428726	3300046472	Bacteria	889
344	Ga0495630_0333439	3300046517	Bacteria	1160
345	Ga0495637_0122034	3300046520	Bacteria	1002
346	Ga0495644_0350444	3300046523	Bacteria	581
347	Ga0495587_0385282	3300046536	Bacteria	780
348	Ga0495621_0076381	3300046539	Bacteria	1242
349	Ga0495621_0115794	3300046539	Bacteria	1032
350	Ga0495667_0446157	3300046559	Bacteria	813
351	Ga0495667_0588839	3300046559	Bacteria	693
352	Ga0495668_0315559	3300046616	Bacteria	857
353	Ga0495625_0003970	3300046660	Bacteria	14185
354	Ga0495647_0015931	3300046681	Bacteria	2640
355	Ga0495647_0059987	3300046681	Bacteria	1499
356	Ga0495658_0129049	3300046683	Bacteria	1537
357	Ga0495613_0109353	3300046689	Bacteria	1993
358	Ga0495670_0009125	3300046691	Bacteria	4877
359	Ga0495600_0523866	3300046809	Bacteria	726
360	Ga0495677_0146175	3300047445	Bacteria	909
361	Ga0495686_0152421	3300047472	Bacteria	1356
362	Ga0496100_0483650	3300048903	Bacteria	952
363	Ga0496102_0020340	3300048905	Bacteria	5866
364	Ga0496102_0038755	3300048905	Bacteria	4303
365	Ga0496102_0147184	3300048905	Bacteria	2211
366	Ga0496105_0106834	3300048908	Bacteria	2311
367	Ga0496106_0027831	3300048909	Bacteria	4209
368	Ga0496108_0007144	3300048911	Bacteria	9052
369	Ga0496108_0037516	3300048911	Bacteria	4037
370	Ga0496111_0417013	3300048914	Bacteria	992
371	Ga0496113_0322877	3300048916	Bacteria	1237
372	Ga0496115_0026390	3300048918	Bacteria	4534
373	Ga0496121_0014590	3300048924	Bacteria	8320
374	Ga0496124_0039444	3300048927	Bacteria	4094
375	Ga0496125_0005030	3300048928	Bacteria	14929
376	Ga0501043_0000057	3300049579	Bacteria	103997
377	Ga0501046_0000075	3300049580	Bacteria	104000
378	Ga0501047_0000081	3300049581	Bacteria	122697
379	Ga0501048_0002921	3300049582	Bacteria	13057
380	Ga0501075_0592373	3300049591	Bacteria	846
381	Ga0501198_000012	3300049649	Bacteria	113529
382	Ga0501206_010370	3300049653	Bacteria	1247
383	Ga0501206_021838	3300049653	Bacteria	916
384	Ga0501222_000010	3300049662	Bacteria	113536
385	Ga0501222_015226	3300049662	Bacteria	1017
386	Ga0501233_122660	3300049668	Bacteria	704
387	Ga0501035_0277374	3300049822	Bacteria	1418
388	Ga0501044_0869039	3300049823	Bacteria	778
389	Ga0501045_0002738	3300049824	Bacteria	12043
390	nmdc:mga03683_443763_c1	3300050489	Bacteria	624
391	nmdc:mga0k408_194143_c1	3300050493	Bacteria	1212
392	nmdc:mga0k408_212969_c1	3300050493	Bacteria	1154
393	nmdc:mga0k408_36670_c1	3300050493	Bacteria	2814
394	nmdc:mga0k408_58976_c1	3300050493	Bacteria	2229
395	nmdc:mga0k408_59390_c1	3300050493	Bacteria	2222
396	nmdc:mga06z11_564636_c1	3300050494	Bacteria	691
397	nmdc:mga07m45_90301_c1	3300050496	Bacteria	1755
398	nmdc:mga05p37_268564_c1	3300050507	Bacteria	2039
399	nmdc:mga09592_3580_c1	3300050508	Bacteria	12538
400	nmdc:mga0qj67_83522_c1	3300050509	Bacteria	2560
401	nmdc:mga0n895_278173_c1	3300050512	Bacteria	1697
402	nmdc:mga0rr50_43851_c1	3300050513	Bacteria	3276
403	Ga0495601_0303183	3300053077	Bacteria	1040
404	Ga0495595_0139271	3300053084	Bacteria	1190
405	Ga0500578_0003036	3300053086	Bacteria	12981
406	Ga0500651_0358913	3300053093	Bacteria	826
407	Ga0500593_002996	3300053117	Bacteria	6295
408	Ga0500658_0161929	3300053134	Bacteria	1013
409	Ga0500604_0107591	3300053151	Bacteria	924
410	Ga0500622_0010080	3300053156	Bacteria	5205
411	Ga0500587_011481	3300053739	Bacteria	1118

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300041503	Ga0451847_0270602	Ga0451847_0270602_58_531	143
2	3300009147	Ga0114129_10033378	Ga0114129_100333782	145
3	3300050507	nmdc:mga05p37_268564_c1	nmdc:mga05p37_268564_c1_1396_1944	145
4	3300045051	Ga0451576_0051630	Ga0451576_0051630_2788_3336	148
5	3300005834	Ga0068851_10058459	Ga0068851_100584592	155
6	3300014968	Ga0157379_10167268	Ga0157379_101672682	155
7	3300025321	Ga0207656_10010797	Ga0207656_100107973	156
8	3300025986	Ga0207658_10430467	Ga0207658_104304672	156
9	3300048908	Ga0496105_0106834	Ga0496105_0106834_1684_2235	156
10	3300049653	Ga0501206_021838	Ga0501206_021838_126_674	156
11	3300005334	Ga0068869_100002073	Ga0068869_10000207313	159
12	3300005338	Ga0068868_100028923	Ga0068868_1000289232	159
13	3300005339	Ga0070660_100008567	Ga0070660_1000085673	159
14	3300005353	Ga0070669_100014598	Ga0070669_1000145981	159
15	3300005354	Ga0070675_100017521	Ga0070675_1000175213	159
16	3300005366	Ga0070659_100036674	Ga0070659_1000366742	159
17	3300005457	Ga0070662_100001463	Ga0070662_1000014633	159
18	3300005614	Ga0068856_100267419	Ga0068856_1002674192	159
19	3300005616	Ga0068852_100012059	Ga0068852_1000120598	159
20	3300005618	Ga0068864_100029161	Ga0068864_1000291615	159
21	3300005719	Ga0068861_100037649	Ga0068861_1000376492	159
22	3300006871	Ga0075434_100136268	Ga0075434_1001362682	159
23	3300009098	Ga0105245_10063572	Ga0105245_100635723	159
24	3300009545	Ga0105237_10074321	Ga0105237_100743212	159
25	3300013296	Ga0157374_10037450	Ga0157374_100374502	159
26	3300013306	Ga0163162_10022700	Ga0163162_100227006	159
27	3300013307	Ga0157372_10071953	Ga0157372_100719532	159
28	3300014969	Ga0157376_10017149	Ga0157376_100171492	159
29	3300025903	Ga0207680_10152307	Ga0207680_101523072	159
30	3300025914	Ga0207671_11028198	Ga0207671_110281981	159
31	3300025919	Ga0207657_10254870	Ga0207657_102548702	159
32	3300025926	Ga0207659_10003636	Ga0207659_1000363610	159
33	3300025927	Ga0207687_10045195	Ga0207687_100451952	159
34	3300025932	Ga0207690_10165038	Ga0207690_101650382	159
35	3300025933	Ga0207706_10011820	Ga0207706_100118207	159
36	3300025942	Ga0207689_10031035	Ga0207689_100310353	159
37	3300026023	Ga0207677_10074554	Ga0207677_100745542	159
38	3300026095	Ga0207676_10040483	Ga0207676_100404831	159
39	3300026118	Ga0207675_100063049	Ga0207675_1000630493	159
40	3300026142	Ga0207698_10106923	Ga0207698_101069232	159
41	3300048905	Ga0496102_0147184	Ga0496102_0147184_1077_1625	159
42	3300048909	Ga0496106_0027831	Ga0496106_0027831_395_943	159
43	3300048911	Ga0496108_0007144	Ga0496108_0007144_5901_6449	159
44	3300048916	Ga0496113_0322877	Ga0496113_0322877_19_567	159
45	3300050512	nmdc:mga0n895_278173_c1	nmdc:mga0n895_278173_c1_944_1492	159
46	3300050513	nmdc:mga0rr50_43851_c1	nmdc:mga0rr50_43851_c1_1874_2422	159
47	3300005329	Ga0070683_100081025	Ga0070683_1000810252	160
48	3300005333	Ga0070677_10069212	Ga0070677_100692121	160
49	3300005335	Ga0070666_10619111	Ga0070666_106191111	160
50	3300005338	Ga0068868_100226270	Ga0068868_1002262702	160
51	3300005339	Ga0070660_100129104	Ga0070660_1001291042	160
52	3300005344	Ga0070661_100759093	Ga0070661_1007590931	160
53	3300005366	Ga0070659_100058246	Ga0070659_1000582461	160
54	3300005367	Ga0070667_100005406	Ga0070667_1000054062	160
55	3300005455	Ga0070663_100069807	Ga0070663_1000698072	160
56	3300005535	Ga0070684_100009956	Ga0070684_1000099565	160
57	3300005535	Ga0070684_100229615	Ga0070684_1002296152	160
58	3300005539	Ga0068853_100810877	Ga0068853_1008108771	160
59	3300005543	Ga0070672_100007343	Ga0070672_1000073439	160
60	3300005546	Ga0070696_100416091	Ga0070696_1004160912	160
61	3300005547	Ga0070693_100010390	Ga0070693_1000103902	160
62	3300005564	Ga0070664_100017065	Ga0070664_1000170654	160
63	3300005577	Ga0068857_100043587	Ga0068857_1000435873	160
64	3300005577	Ga0068857_100150873	Ga0068857_1001508732	160
65	3300005578	Ga0068854_100019891	Ga0068854_1000198912	160
66	3300005614	Ga0068856_100025953	Ga0068856_1000259534	160
67	3300005615	Ga0070702_100029130	Ga0070702_1000291304	160
68	3300005616	Ga0068852_100010828	Ga0068852_1000108281	160
69	3300005616	Ga0068852_100039409	Ga0068852_1000394094	160
70	3300005617	Ga0068859_100041195	Ga0068859_1000411955	160
71	3300005834	Ga0068851_10008878	Ga0068851_100088782	160
72	3300005842	Ga0068858_100006772	Ga0068858_10000677213	160
73	3300005842	Ga0068858_100010785	Ga0068858_1000107852	160
74	3300005843	Ga0068860_100016235	Ga0068860_1000162358	160
75	3300006358	Ga0068871_100568266	Ga0068871_1005682662	160
76	3300006881	Ga0068865_100122092	Ga0068865_1001220922	160
77	3300006931	Ga0097620_100041196	Ga0097620_1000411962	160
78	3300009093	Ga0105240_10515623	Ga0105240_105156232	160
79	3300009177	Ga0105248_10200084	Ga0105248_102000842	160
80	3300013105	Ga0157369_10020908	Ga0157369_100209082	160
81	3300013307	Ga0157372_10088826	Ga0157372_100888262	160
82	3300013308	Ga0157375_10026356	Ga0157375_100263564	160
83	3300014326	Ga0157380_10011366	Ga0157380_100113663	160
84	3300014968	Ga0157379_10011312	Ga0157379_100113123	160
85	3300017792	Ga0163161_10007666	Ga0163161_100076666	160
86	3300025901	Ga0207688_10034568	Ga0207688_100345683	160
87	3300025907	Ga0207645_10126527	Ga0207645_101265272	160
88	3300025909	Ga0207705_10034357	Ga0207705_100343572	160
89	3300025918	Ga0207662_10124830	Ga0207662_101248302	160
90	3300025919	Ga0207657_10039936	Ga0207657_100399362	160
91	3300025920	Ga0207649_10010331	Ga0207649_100103314	160
92	3300025920	Ga0207649_10484767	Ga0207649_104847672	160
93	3300025923	Ga0207681_10009855	Ga0207681_100098553	160
94	3300025924	Ga0207694_10023194	Ga0207694_100231943	160
95	3300025940	Ga0207691_10008676	Ga0207691_100086766	160
96	3300025941	Ga0207711_10049262	Ga0207711_100492621	160
97	3300025944	Ga0207661_10067819	Ga0207661_100678194	160
98	3300025944	Ga0207661_10133907	Ga0207661_101339072	160
99	3300025945	Ga0207679_10044097	Ga0207679_100440972	160
100	3300025949	Ga0207667_10378761	Ga0207667_103787612	160
101	3300025981	Ga0207640_10107798	Ga0207640_101077982	160
102	3300025986	Ga0207658_10045134	Ga0207658_100451342	160
103	3300026035	Ga0207703_10003521	Ga0207703_1000352110	160
104	3300026041	Ga0207639_10005163	Ga0207639_100051633	160
105	3300026041	Ga0207639_10028226	Ga0207639_100282262	160
106	3300026041	Ga0207639_10083308	Ga0207639_100833084	160
107	3300026067	Ga0207678_10133052	Ga0207678_101330522	160
108	3300026078	Ga0207702_10017844	Ga0207702_100178442	160
109	3300026116	Ga0207674_10011435	Ga0207674_1001143512	160
110	3300026116	Ga0207674_10079074	Ga0207674_100790742	160
111	3300026142	Ga0207698_10017480	Ga0207698_100174804	160
112	3300026142	Ga0207698_10024114	Ga0207698_100241144	160
113	3300028380	Ga0268265_10179089	Ga0268265_101790892	160
114	3300028381	Ga0268264_10004863	Ga0268264_1000486311	160
115	3300028381	Ga0268264_10775694	Ga0268264_107756941	160
116	3300031548	Ga0307408_100275529	Ga0307408_1002755292	160
117	3300031731	Ga0307405_10958469	Ga0307405_109584691	160
118	3300031824	Ga0307413_10164467	Ga0307413_101644672	160
119	3300031852	Ga0307410_10018877	Ga0307410_100188772	160
120	3300031901	Ga0307406_10052508	Ga0307406_100525084	160
121	3300031911	Ga0307412_10244626	Ga0307412_102446262	160
122	3300031995	Ga0307409_100375720	Ga0307409_1003757202	160
123	3300032005	Ga0307411_10914847	Ga0307411_109148471	160
124	3300035092	Ga0373952_0006469	Ga0373952_0006469_477_1025	160
125	3300035112	Ga0373932_0023814	Ga0373932_0023814_215_763	160
126	3300045051	Ga0451576_0140364	Ga0451576_0140364_1593_2141	160
127	3300005456	Ga0070678_100027486	Ga0070678_1000274862	161
128	3300026121	Ga0207683_10036299	Ga0207683_100362994	161
129	3300005331	Ga0070670_100073176	Ga0070670_1000731763	162
130	3300005331	Ga0070670_100090652	Ga0070670_1000906524	162
131	3300005331	Ga0070670_100307830	Ga0070670_1003078302	162
132	3300005338	Ga0068868_101064377	Ga0068868_1010643771	162
133	3300005354	Ga0070675_100013374	Ga0070675_1000133742	162
134	3300005354	Ga0070675_100155314	Ga0070675_1001553141	162
135	3300005355	Ga0070671_100489407	Ga0070671_1004894072	162
136	3300005355	Ga0070671_101107225	Ga0070671_1011072251	162
137	3300005364	Ga0070673_100244544	Ga0070673_1002445442	162
138	3300005366	Ga0070659_100660837	Ga0070659_1006608371	162
139	3300005367	Ga0070667_100115482	Ga0070667_1001154823	162
140	3300005367	Ga0070667_100649903	Ga0070667_1006499032	162
141	3300005455	Ga0070663_100098591	Ga0070663_1000985912	162
142	3300005456	Ga0070678_100085720	Ga0070678_1000857203	162
143	3300005456	Ga0070678_100290236	Ga0070678_1002902362	162
144	3300005456	Ga0070678_100329939	Ga0070678_1003299392	162
145	3300005456	Ga0070678_100608189	Ga0070678_1006081892	162
146	3300005457	Ga0070662_100029212	Ga0070662_1000292123	162
147	3300005457	Ga0070662_100770948	Ga0070662_1007709481	162
148	3300005459	Ga0068867_100412845	Ga0068867_1004128451	162
149	3300005539	Ga0068853_100327725	Ga0068853_1003277252	162
150	3300005543	Ga0070672_100000561	Ga0070672_10000056114	162
151	3300005543	Ga0070672_100128062	Ga0070672_1001280622	162
152	3300005547	Ga0070693_100062743	Ga0070693_1000627432	162
153	3300005548	Ga0070665_101091688	Ga0070665_1010916881	162
154	3300005616	Ga0068852_100139075	Ga0068852_1001390753	162
155	3300005616	Ga0068852_100354563	Ga0068852_1003545632	162
156	3300005616	Ga0068852_100978250	Ga0068852_1009782502	162
157	3300005618	Ga0068864_100010110	Ga0068864_1000101108	162
158	3300005834	Ga0068851_10365253	Ga0068851_103652532	162
159	3300005841	Ga0068863_100066821	Ga0068863_1000668213	162
160	3300006237	Ga0097621_100233066	Ga0097621_1002330662	162
161	3300006358	Ga0068871_100038377	Ga0068871_1000383773	162
162	3300006358	Ga0068871_100168082	Ga0068871_1001680822	162
163	3300009148	Ga0105243_10983724	Ga0105243_109837242	162
164	3300013104	Ga0157370_10352910	Ga0157370_103529102	162
165	3300013297	Ga0157378_10320850	Ga0157378_103208502	162
166	3300013308	Ga0157375_10358498	Ga0157375_103584982	162
167	3300014325	Ga0163163_10571833	Ga0163163_105718332	162
168	3300014325	Ga0163163_11158660	Ga0163163_111586602	162
169	3300014969	Ga0157376_10187443	Ga0157376_101874432	162
170	3300025321	Ga0207656_10123071	Ga0207656_101230712	162
171	3300025920	Ga0207649_10555511	Ga0207649_105555112	162
172	3300025925	Ga0207650_10009477	Ga0207650_100094774	162
173	3300025925	Ga0207650_10010846	Ga0207650_100108462	162
174	3300025925	Ga0207650_10169301	Ga0207650_101693012	162
175	3300025926	Ga0207659_10007851	Ga0207659_100078516	162
176	3300025931	Ga0207644_10727000	Ga0207644_107270001	162
177	3300025932	Ga0207690_10281178	Ga0207690_102811782	162
178	3300025933	Ga0207706_10069247	Ga0207706_100692472	162
179	3300025933	Ga0207706_10781748	Ga0207706_107817482	162
180	3300025935	Ga0207709_10030049	Ga0207709_100300492	162
181	3300025940	Ga0207691_10004379	Ga0207691_100043794	162
182	3300025940	Ga0207691_10053656	Ga0207691_100536564	162
183	3300025945	Ga0207679_10869898	Ga0207679_108698982	162
184	3300026023	Ga0207677_10823586	Ga0207677_108235861	162
185	3300026067	Ga0207678_10154971	Ga0207678_101549712	162
186	3300026089	Ga0207648_10877629	Ga0207648_108776291	162
187	3300026095	Ga0207676_10005732	Ga0207676_100057324	162
188	3300026121	Ga0207683_10122074	Ga0207683_101220742	162
189	3300026121	Ga0207683_10269972	Ga0207683_102699722	162
190	3300026121	Ga0207683_10869652	Ga0207683_108696522	162
191	3300026142	Ga0207698_10204334	Ga0207698_102043342	162
192	3300035171	Ga0373946_0523804	Ga0373946_0523804_52_600	162
193	3300035695	Ga0373927_0066852	Ga0373927_0066852_604_1152	162
194	3300035725	Ga0373947_0055986	Ga0373947_0055986_367_915	162
195	3300036401	Ga0373937_0688594	Ga0373937_0688594_401_949	162
196	3300037068	Ga0373925_0083763	Ga0373925_0083763_1865_2413	162
197	3300041512	Ga0451853_1659374	Ga0451853_1659374_675_1223	162
198	3300046472	Ga0495580_0428726	Ga0495580_0428726_117_665	162
199	3300046536	Ga0495587_0385282	Ga0495587_0385282_85_633	162
200	3300046539	Ga0495621_0076381	Ga0495621_0076381_260_808	162
201	3300046559	Ga0495667_0588839	Ga0495667_0588839_114_662	162
202	3300046681	Ga0495647_0059987	Ga0495647_0059987_539_1087	162
203	3300048911	Ga0496108_0037516	Ga0496108_0037516_167_718	162
204	3300048914	Ga0496111_0417013	Ga0496111_0417013_287_835	162
205	3300053084	Ga0495595_0139271	Ga0495595_0139271_291_839	162
206	3300005539	Ga0068853_100014841	Ga0068853_1000148412	163
207	3300009093	Ga0105240_10012261	Ga0105240_100122619	163
208	3300009545	Ga0105237_10000407	Ga0105237_1000040711	163
209	3300009551	Ga0105238_10015817	Ga0105238_100158173	163
210	3300010375	Ga0105239_10000335	Ga0105239_1000033520	163
211	3300025914	Ga0207671_10006217	Ga0207671_100062174	163
212	3300025924	Ga0207694_10465634	Ga0207694_104656341	163
213	3300026041	Ga0207639_10779034	Ga0207639_107790341	163
214	3300035116	Ga0373945_0371677	Ga0373945_0371677_23_571	163
215	3300035692	Ga0373935_0768996	Ga0373935_0768996_81_629	163
216	3300035725	Ga0373947_0230645	Ga0373947_0230645_339_887	163
217	3300036401	Ga0373937_0021907	Ga0373937_0021907_667_1215	163
218	3300046517	Ga0495630_0333439	Ga0495630_0333439_232_780	163
219	3300046559	Ga0495667_0446157	Ga0495667_0446157_229_777	163
220	3300046681	Ga0495647_0015931	Ga0495647_0015931_801_1349	163
221	3300046689	Ga0495613_0109353	Ga0495613_0109353_16_564	163
222	3300046809	Ga0495600_0523866	Ga0495600_0523866_59_607	163
223	3300048924	Ga0496121_0014590	Ga0496121_0014590_7458_8000	163
224	3300053077	Ga0495601_0303183	Ga0495601_0303183_314_862	163
225	iso_pu_bacteria	2585428057	2587724967	164
226	iso_pu_bacteria	2585428058	2587731669	164
227	iso_pu_bacteria	2585428062	2587754170	164
228	iso_pu_bacteria	2588253510	2588292470	164
229	iso_pu_bacteria	2643221592	2643968152	164
230	iso_pu_bacteria	2643221625	2644142492	164
231	iso_pu_bacteria	2643221648	2644277009	164
232	iso_pu_bacteria	2831864461	2831869124	164
233	iso_pu_bacteria	2886848708	2886854727	164
234	3300005262	Ga0065165_1003212	Ga0065165_10032122	167
235	3300005355	Ga0070671_100037288	Ga0070671_1000372884	167
236	3300005456	Ga0070678_100309939	Ga0070678_1003099391	167
237	3300005543	Ga0070672_100141505	Ga0070672_1001415052	167
238	3300025273	Ga0209673_1008957	Ga0209673_10089574	167
239	3300025298	Ga0209050_1001143	Ga0209050_100114313	167
240	3300025927	Ga0207687_10736267	Ga0207687_107362671	167
241	3300025940	Ga0207691_10312694	Ga0207691_103126942	167
242	3300026089	Ga0207648_10522033	Ga0207648_105220332	167
243	3300046472	Ga0495580_0064395	Ga0495580_0064395_724_1281	167
244	3300046616	Ga0495668_0315559	Ga0495668_0315559_31_579	167
245	3300046683	Ga0495658_0129049	Ga0495658_0129049_267_815	167
246	3300053151	Ga0500604_0107591	Ga0500604_0107591_313_861	167
247	3300001979	JGI24740J21852_10017822	JGI24740J21852_100178222	168
248	3300003316	rootH1_10012732	rootH1_100127328	168
249	3300003316	rootH1_10029007	rootH1_100290073	168
250	3300003316	rootH1_10073131	rootH1_100731312	168
251	3300003320	rootH2_10008565	rootH2_100085654	168
252	3300003322	rootL2_10001240	rootL2_1000124013	168
253	3300003322	rootL2_10036768	rootL2_100367681	168
254	3300003323	rootH1_10004543	rootH1_100045437	168
255	3300003323	rootH1_10020876	rootH1_100208762	168
256	3300003323	rootH1_10114536	rootH1_101145363	168
257	3300003752	Ga0055539_1000222	Ga0055539_100022241	168
258	3300003756	Ga0055533_1000016	Ga0055533_1000016155	168
259	3300003759	Ga0055525_1001565	Ga0055525_10015652	168
260	3300003771	Ga0055526_1016751	Ga0055526_10167512	168
261	3300003775	Ga0055524_1001208	Ga0055524_10012082	168
262	3300003775	Ga0055524_1020305	Ga0055524_10203051	168
263	3300003792	Ga0055540_1018583	Ga0055540_10185834	168
264	3300003794	Ga0055531_10016340	Ga0055531_100163402	168
265	3300003794	Ga0055531_10020845	Ga0055531_100208454	168
266	3300004625	Ga0055543_1005869	Ga0055543_10058691	168
267	3300005262	Ga0065165_1000101	Ga0065165_1000101122	168
268	3300005338	Ga0068868_100422966	Ga0068868_1004229661	168
269	3300005354	Ga0070675_100605402	Ga0070675_1006054021	168
270	3300005356	Ga0070674_100484646	Ga0070674_1004846462	168
271	3300005366	Ga0070659_100001014	Ga0070659_10000101413	168
272	3300005455	Ga0070663_100470952	Ga0070663_1004709521	168
273	3300005459	Ga0068867_100000081	Ga0068867_10000008142	168
274	3300005459	Ga0068867_100130650	Ga0068867_1001306503	168
275	3300005459	Ga0068867_100259250	Ga0068867_1002592502	168
276	3300005543	Ga0070672_100142019	Ga0070672_1001420192	168
277	3300005563	Ga0068855_100015124	Ga0068855_1000151246	168
278	3300005564	Ga0070664_100006317	Ga0070664_1000063179	168
279	3300005616	Ga0068852_100005075	Ga0068852_1000050751	168
280	3300005719	Ga0068861_100942130	Ga0068861_1009421301	168
281	3300005841	Ga0068863_100161499	Ga0068863_1001614992	168
282	3300005843	Ga0068860_100350427	Ga0068860_1003504272	168
283	3300005844	Ga0068862_100051041	Ga0068862_1000510416	168
284	3300006177	Ga0075362_10075133	Ga0075362_100751332	168
285	3300006195	Ga0075366_10017250	Ga0075366_100172502	168
286	3300006195	Ga0075366_10048334	Ga0075366_100483343	168
287	3300006195	Ga0075366_10095312	Ga0075366_100953122	168
288	3300006195	Ga0075366_10131920	Ga0075366_101319202	168
289	3300006195	Ga0075366_10589950	Ga0075366_105899501	168
290	3300006353	Ga0075370_10025312	Ga0075370_100253126	168
291	3300006353	Ga0075370_10274214	Ga0075370_102742141	168
292	3300006846	Ga0075430_100005009	Ga0075430_10000500917	168
293	3300006880	Ga0075429_100004433	Ga0075429_1000044334	168
294	3300006944	Ga0099823_1003331	Ga0099823_10033314	168
295	3300009147	Ga0114129_10587260	Ga0114129_105872602	168
296	3300009148	Ga0105243_10019016	Ga0105243_100190164	168
297	3300009148	Ga0105243_10063371	Ga0105243_100633711	168
298	3300011119	Ga0105246_10292976	Ga0105246_102929762	168
299	3300012497	Ga0157319_1000008	Ga0157319_100000877	168
300	3300013296	Ga0157374_10026288	Ga0157374_100262887	168
301	3300013297	Ga0157378_10054411	Ga0157378_100544113	168
302	3300014745	Ga0157377_10000032	Ga0157377_10000032103	168
303	3300014968	Ga0157379_10003468	Ga0157379_100034684	168
304	3300017792	Ga0163161_10266429	Ga0163161_102664292	168
305	3300025226	Ga0209674_100041	Ga0209674_100041230	168
306	3300025230	Ga0209563_100043	Ga0209563_100043230	168
307	3300025253	Ga0209677_100096	Ga0209677_10009637	168
308	3300025273	Ga0209673_1006020	Ga0209673_10060207	168
309	3300025295	Ga0209564_1000008	Ga0209564_1000008650	168
310	3300025298	Ga0209050_1001274	Ga0209050_100127425	168
311	3300025299	Ga0209256_1000413	Ga0209256_100041324	168
312	3300025299	Ga0209256_1003828	Ga0209256_100382812	168
313	3300025303	Ga0209051_1002377	Ga0209051_100237715	168
314	3300025304	Ga0209257_1002153	Ga0209257_100215320	168
315	3300025304	Ga0209257_1008878	Ga0209257_10088783	168
316	3300025907	Ga0207645_10433611	Ga0207645_104336112	168
317	3300025910	Ga0207684_10084816	Ga0207684_100848162	168
318	3300025920	Ga0207649_10000951	Ga0207649_1000095114	168
319	3300025925	Ga0207650_10309401	Ga0207650_103094012	168
320	3300025926	Ga0207659_10243301	Ga0207659_102433012	168
321	3300025932	Ga0207690_10000658	Ga0207690_1000065813	168
322	3300025935	Ga0207709_10017165	Ga0207709_100171654	168
323	3300025940	Ga0207691_10241570	Ga0207691_102415702	168
324	3300025941	Ga0207711_10048696	Ga0207711_100486962	168
325	3300025945	Ga0207679_10003109	Ga0207679_100031098	168
326	3300025949	Ga0207667_10030541	Ga0207667_100305412	168
327	3300026067	Ga0207678_10378868	Ga0207678_103788682	168
328	3300026088	Ga0207641_10470520	Ga0207641_104705202	168
329	3300026089	Ga0207648_10001296	Ga0207648_1000129623	168
330	3300026089	Ga0207648_10683313	Ga0207648_106833131	168
331	3300026118	Ga0207675_100245072	Ga0207675_1002450722	168
332	3300026142	Ga0207698_10009766	Ga0207698_100097662	168
333	3300027296	Ga0209389_1002327	Ga0209389_10023274	168
334	3300027378	Ga0209981_1009144	Ga0209981_10091442	168
335	3300027395	Ga0209996_1001333	Ga0209996_10013332	168
336	3300027471	Ga0209995_1001463	Ga0209995_10014632	168
337	3300027526	Ga0209968_1000844	Ga0209968_10008441	168
338	3300027695	Ga0209966_1000309	Ga0209966_100030912	168
339	3300027876	Ga0209974_10014753	Ga0209974_100147533	168
340	3300028381	Ga0268264_10577706	Ga0268264_105777062	168
341	3300028794	Ga0307515_10000609	Ga0307515_1000060948	168
342	3300028794	Ga0307515_10013045	Ga0307515_1001304513	168
343	3300028794	Ga0307515_10035839	Ga0307515_100358391	168
344	3300028794	Ga0307515_10344904	Ga0307515_103449041	168
345	3300030500	Ga0268256_1037868	Ga0268256_10378682	168
346	3300030522	Ga0307512_10251299	Ga0307512_102512992	168
347	3300031456	Ga0307513_10008116	Ga0307513_1000811613	168
348	3300031456	Ga0307513_10093821	Ga0307513_100938212	168
349	3300031456	Ga0307513_10669509	Ga0307513_106695091	168
350	3300031507	Ga0307509_10052528	Ga0307509_100525285	168
351	3300031507	Ga0307509_10241377	Ga0307509_102413772	168
352	3300031548	Ga0307408_100242317	Ga0307408_1002423171	168
353	3300031616	Ga0307508_10004265	Ga0307508_1000426514	168
354	3300031649	Ga0307514_10023638	Ga0307514_100236384	168
355	3300031901	Ga0307406_10294729	Ga0307406_102947292	168
356	3300032002	Ga0307416_100075710	Ga0307416_1000757102	168
357	3300032002	Ga0307416_100502629	Ga0307416_1005026292	168
358	3300033179	Ga0307507_10020165	Ga0307507_100201654	168
359	3300036401	Ga0373937_0140670	Ga0373937_0140670_565_1113	168
360	3300037471	Ga0395905_0041281	Ga0395905_0041281_1138_1695	168
361	3300037471	Ga0395905_0068368	Ga0395905_0068368_2625_3173	168
362	3300039447	Ga0436361_0869713	Ga0436361_0869713_1174_1731	168
363	3300039447	Ga0436361_1211597	Ga0436361_1211597_492_1049	168
364	3300041456	Ga0451795_1564080	Ga0451795_1564080_411_959	168
365	3300041459	Ga0451800_1145861	Ga0451800_1145861_91_639	168
366	3300041460	Ga0451802_1553398	Ga0451802_1553398_19_567	168
367	3300041491	Ga0451833_1000255	Ga0451833_1000255_763_1314	168
368	3300041491	Ga0451833_1462293	Ga0451833_1462293_21_569	168
369	3300041509	Ga0451843_0840498	Ga0451843_0840498_353_901	168
370	3300042008	Ga0439450_019911	Ga0439450_019911_428_976	168
371	3300042134	Ga0450898_007844	Ga0450898_007844_825_1373	168
372	3300042438	Ga0439459_0002793	Ga0439459_0002793_474_1022	168
373	3300042439	Ga0439464_0025574	Ga0439464_0025574_121_669	168
374	3300044694	Ga0466963_0211530	Ga0466963_0211530_411_959	168
375	3300044712	Ga0453684_0016471	Ga0453684_0016471_3942_4490	168
376	3300044735	Ga0466968_0017780	Ga0466968_0017780_256_804	168
377	3300045051	Ga0451576_0528239	Ga0451576_0528239_205_753	168
378	3300046471	Ga0495650_0002349	Ga0495650_0002349_14379_14930	168
379	3300046520	Ga0495637_0122034	Ga0495637_0122034_16_564	168
380	3300046523	Ga0495644_0350444	Ga0495644_0350444_22_570	168
381	3300046539	Ga0495621_0115794	Ga0495621_0115794_168_716	168
382	3300046660	Ga0495625_0003970	Ga0495625_0003970_6321_6869	168
383	3300046691	Ga0495670_0009125	Ga0495670_0009125_1806_2354	168
384	3300047445	Ga0495677_0146175	Ga0495677_0146175_174_722	168
385	3300047472	Ga0495686_0152421	Ga0495686_0152421_780_1328	168
386	3300048903	Ga0496100_0483650	Ga0496100_0483650_10_573	168
387	3300048905	Ga0496102_0020340	Ga0496102_0020340_2485_3033	168
388	3300048905	Ga0496102_0038755	Ga0496102_0038755_2402_2950	168
389	3300048918	Ga0496115_0026390	Ga0496115_0026390_274_822	168
390	3300048927	Ga0496124_0039444	Ga0496124_0039444_1861_2409	168
391	3300048928	Ga0496125_0005030	Ga0496125_0005030_6632_7195	168
392	3300049579	Ga0501043_0000057	Ga0501043_0000057_88554_89117	168
393	3300049580	Ga0501046_0000075	Ga0501046_0000075_88554_89117	168
394	3300049581	Ga0501047_0000081	Ga0501047_0000081_88554_89117	168
395	3300049582	Ga0501048_0002921	Ga0501048_0002921_12127_12690	168
396	3300049591	Ga0501075_0592373	Ga0501075_0592373_190_738	168
397	3300049649	Ga0501198_000012	Ga0501198_000012_80347_80895	168
398	3300049653	Ga0501206_010370	Ga0501206_010370_469_1017	168
399	3300049662	Ga0501222_000010	Ga0501222_000010_80353_80901	168
400	3300049662	Ga0501222_015226	Ga0501222_015226_106_654	168
401	3300049668	Ga0501233_122660	Ga0501233_122660_44_592	168
402	3300049822	Ga0501035_0277374	Ga0501035_0277374_409_957	168
403	3300049823	Ga0501044_0869039	Ga0501044_0869039_220_768	168
404	3300049824	Ga0501045_0002738	Ga0501045_0002738_10239_10802	168
405	3300050489	nmdc:mga03683_443763_c1	nmdc:mga03683_443763_c1_16_564	168
406	3300050493	nmdc:mga0k408_194143_c1	nmdc:mga0k408_194143_c1_371_919	168
407	3300050493	nmdc:mga0k408_212969_c1	nmdc:mga0k408_212969_c1_522_1070	168
408	3300050493	nmdc:mga0k408_36670_c1	nmdc:mga0k408_36670_c1_772_1320	168
409	3300050493	nmdc:mga0k408_58976_c1	nmdc:mga0k408_58976_c1_1066_1614	168
410	3300050493	nmdc:mga0k408_59390_c1	nmdc:mga0k408_59390_c1_972_1520	168
411	3300050494	nmdc:mga06z11_564636_c1	nmdc:mga06z11_564636_c1_109_657	168
412	3300050496	nmdc:mga07m45_90301_c1	nmdc:mga07m45_90301_c1_1159_1707	168
413	3300050508	nmdc:mga09592_3580_c1	nmdc:mga09592_3580_c1_9857_10405	168
414	3300050509	nmdc:mga0qj67_83522_c1	nmdc:mga0qj67_83522_c1_650_1198	168
415	3300053086	Ga0500578_0003036	Ga0500578_0003036_5026_5574	168
416	3300053093	Ga0500651_0358913	Ga0500651_0358913_109_657	168
417	3300053117	Ga0500593_002996	Ga0500593_002996_2645_3193	168
418	3300053134	Ga0500658_0161929	Ga0500658_0161929_159_707	168
419	3300053156	Ga0500622_0010080	Ga0500622_0010080_2952_3500	168
420	3300053739	Ga0500587_011481	Ga0500587_011481_158_706	168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02075

RuvC

Crossover junction endodeoxyribonuclease RuvC

9

158

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6vlc-assembly1.cif.gz_B	crystal structure of udp-glcnac 2-epimerase from neisseria meningitidis bound to udp-glcnac	0.7767	39	101
4q3v-assembly3.cif.gz_C	crystal structure of schistosoma mansoni arginase in complex with inhibitor bec	0.7102	40	97
8cwo-assembly1.cif.gz_K	cutibacterium acnes 30s ribosomal subunit with sarecycline bound, body domain only in the local refined map	0.6813	2	105
6q1i-assembly1.cif.gz_A	gh5-4 broad specificity endoglucanase from clostrdium longisporum	0.674	40	106
7pal-assembly1.cif.gz_J	70s ribosome with a- and p-site trnas in mycoplasma pneumoniae cells	0.6736	3	103

ID	Description	Score	Start	End	Superfamily
af_Q7KWM7_19_160_2.60.40.150	Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain	0.694	9	41	2.60.40.150
af_O86374_10_144_3.40.120.10	Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3	0.6794	47	116	3.40.120.10
af_Q5AK66_25_194_2.60.40.150	Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain	0.6739	11	41	2.60.40.150
af_Q91W97_514_654_3.30.420.40	Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain	0.6709	2	74	3.30.420.40
1xmxA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Hypothetical protein VC1899 like domain (Restriction endonuclease-like)	0.6688	47	101	3.40.50.10770

ID	Description	Score	Start	End	GO Terms
AF-A0A7V9BFS8-F1-model_v4	Crossover junction endodeoxyribonuclease RuvC	0.7312	2	113	GO:0003677 GO:0004520 GO:0006281 GO:0006310 GO:0046872
AF-A0A357R3Y6-F1-model_v4	Crossover junction endodeoxyribonuclease RuvC	0.7282	2	108	GO:0003677 GO:0004520 GO:0006281 GO:0006310 GO:0046872
AF-A0A1W9SNB7-F1-model_v4	Crossover junction endodeoxyribonuclease RuvC (EC 3.1.21.10) (Holliday junction nuclease RuvC) (Holliday junction resolvase RuvC)	0.7054	2	125	GO:0000287 GO:0003677 GO:0005737 GO:0006281 GO:0006310 GO:0008821 GO:0048476
AF-A0A357R3Y6-F1-model_v4	Crossover junction endodeoxyribonuclease RuvC	0.7048	2	108	GO:0003677 GO:0004520 GO:0006281 GO:0006310 GO:0046872
AF-A0A7V9BFS8-F1-model_v4	Crossover junction endodeoxyribonuclease RuvC	0.704	2	113	GO:0003677 GO:0004520 GO:0006281 GO:0006310 GO:0046872

Feature Viewer

pLDDT	pTM	Quality
60.84	0.53	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F439714

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02075

RuvC

Crossover junction endodeoxyribonuclease RuvC

9

158

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map