F439705

General Info

Members Datasets Scaffolds Average Seq Length
420 232 420 168

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100189979|Ga0070696_1001899792
Length 202
Sequence MRNDRPTSVRPELVEGPSFLRAVRKNRAGLRQAQPERFGVVATLSLSLLLAGCGLQPLYSGGGKGPVAQSLRSVAVAPIEGRSGWLVRTALEDRLGVPAAGGARYRLEVLLDDDITGFGIRSDDAVTRERRTLRARYRLVDAARGTVLLDATAGSDAGIDVVGSEYATVAAEQTALERLSKEVADQIVTRIALYARRSGSRP

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
157 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
158 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
159 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
160 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
161 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
162 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
163 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
167 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
183 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
184 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
185 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
210 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
211 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
212 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
213 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
214 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
217 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
223 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
226 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
229 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.48
Nodule 0
Rhizoplane 1.19
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 7.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10002757 3300001990 Bacteria 6215
2 JGI24737J22298_10005238 3300001990 Bacteria 4489
3 JGI24735J21928_10000375 3300002067 Bacteria 15639
4 JGI25157J39369_1023103 3300002741 Bacteria 732
5 JGI25164J39214_1011644 3300002772 Bacteria 840
6 JGI25165J46597_1000350 3300003214 Bacteria 52046
7 Ga0065704_10075953 3300005289 Bacteria 5338
8 Ga0070658_10006307 3300005327 Bacteria 9607
9 Ga0070658_10014281 3300005327 Bacteria 6373
10 Ga0070676_10004604 3300005328 Bacteria 7274
11 Ga0070676_10081762 3300005328 Bacteria 1961
12 Ga0070670_100001565 3300005331 Bacteria 18443
13 Ga0070670_100024630 3300005331 Bacteria 5175
14 Ga0070677_10000160 3300005333 Bacteria 22947
15 Ga0068869_100001299 3300005334 Bacteria 14779
16 Ga0070680_100000642 3300005336 Bacteria 24330
17 Ga0070682_100230256 3300005337 Bacteria 1324
18 Ga0068868_100000032 3300005338 Bacteria 75803
19 Ga0068868_100001207 3300005338 Bacteria 17740
20 Ga0070660_100001901 3300005339 Bacteria 14387
21 Ga0070660_100003184 3300005339 Bacteria 11277
22 Ga0070660_100004877 3300005339 Bacteria 9271
23 Ga0070660_100032282 3300005339 Bacteria 3939
24 Ga0070660_100072144 3300005339 Bacteria 2697
25 Ga0070660_100281558 3300005339 Bacteria 1361
26 Ga0070661_100000003 3300005344 Bacteria 254653
27 Ga0070668_100000001 3300005347 Bacteria 275905
28 Ga0070668_100000007 3300005347 Bacteria 150621
29 Ga0070668_100001305 3300005347 Bacteria 17832
30 Ga0070669_100020675 3300005353 Bacteria 4702
31 Ga0070669_100112106 3300005353 Bacteria 2071
32 Ga0070669_100165677 3300005353 Bacteria 1720
33 Ga0070675_100215903 3300005354 Bacteria 1669
34 Ga0070675_101001603 3300005354 Bacteria 767
35 Ga0070675_101289986 3300005354 Bacteria 673
36 Ga0070671_100000046 3300005355 Bacteria 84967
37 Ga0070671_100004606 3300005355 Bacteria 10934
38 Ga0070671_100016182 3300005355 Bacteria 6031
39 Ga0070671_100868902 3300005355 Bacteria 787
40 Ga0070671_101261138 3300005355 Bacteria 651
41 Ga0070674_100117701 3300005356 Bacteria 1962
42 Ga0070673_100000029 3300005364 Bacteria 64228
43 Ga0070659_100000005 3300005366 Bacteria 259902
44 Ga0070659_100194804 3300005366 Bacteria 1667
45 Ga0070659_100229617 3300005366 Bacteria 1533
46 Ga0070667_100029219 3300005367 Bacteria 4592
47 Ga0070705_100787460 3300005440 Bacteria 755
48 Ga0070678_100061165 3300005456 Bacteria 2775
49 Ga0070681_10044787 3300005458 Bacteria 4430
50 Ga0068867_100000044 3300005459 Bacteria 76426
51 Ga0070685_10842395 3300005466 Bacteria 679
52 Ga0070679_100000001 3300005530 Bacteria 764811
53 Ga0068853_100028934 3300005539 Bacteria 4664
54 Ga0068853_100248059 3300005539 Bacteria 1633
55 Ga0070672_100149653 3300005543 Bacteria 1930
56 Ga0070672_100481867 3300005543 Bacteria 1071
57 Ga0070672_100612225 3300005543 Bacteria 949
58 Ga0070686_100493122 3300005544 Bacteria 949
59 Ga0070696_100189979 3300005546 Bacteria 1528
60 Ga0070696_100822245 3300005546 Bacteria 766
61 Ga0070693_100024200 3300005547 Bacteria 3254
62 Ga0070665_100000079 3300005548 Bacteria 186925
63 Ga0070665_100004425 3300005548 Bacteria 14760
64 Ga0070665_100069646 3300005548 Bacteria 3526
65 Ga0070665_100304304 3300005548 Bacteria 1597
66 Ga0070665_100505231 3300005548 Bacteria 1220
67 Ga0068855_100301097 3300005563 Bacteria 1776
68 Ga0068857_100249422 3300005577 Bacteria 1627
69 Ga0068854_100588075 3300005578 Bacteria 949
70 Ga0068856_100257615 3300005614 Bacteria 1760
71 Ga0068856_100641068 3300005614 Bacteria 1083
72 Ga0068856_100937487 3300005614 Bacteria 884
73 Ga0068852_100001909 3300005616 Bacteria 14186
74 Ga0068859_101717426 3300005617 Bacteria 693
75 Ga0068866_10176219 3300005718 Bacteria 1259
76 Ga0068861_100039323 3300005719 Bacteria 3529
77 Ga0068863_100000027 3300005841 Bacteria 181884
78 Ga0068863_100014434 3300005841 Bacteria 7609
79 Ga0068863_100034345 3300005841 Bacteria 4832
80 Ga0068858_100077187 3300005842 Bacteria 3094
81 Ga0068858_100597705 3300005842 Bacteria 1070
82 Ga0068860_100014907 3300005843 Bacteria 7600
83 Ga0068860_100023451 3300005843 Bacteria 5963
84 Ga0068862_100000898 3300005844 Bacteria 28838
85 Ga0068862_100009303 3300005844 Bacteria 8134
86 Ga0068862_100031234 3300005844 Bacteria 4494
87 Ga0075370_10157463 3300006353 Bacteria 1332
88 Ga0068865_100000405 3300006881 Bacteria 24003
89 Ga0097620_101716738 3300006931 Bacteria 693
90 Ga0075435_100263344 3300007076 Bacteria 1469
91 Ga0105251_10002745 3300009011 Bacteria 13482
92 Ga0105240_10263231 3300009093 Bacteria 1988
93 Ga0105240_10789122 3300009093 Bacteria 1030
94 Ga0105245_10004355 3300009098 Bacteria 12530
95 Ga0105245_10466877 3300009098 Bacteria 1273
96 Ga0105247_10239818 3300009101 Bacteria 1235
97 Ga0105243_10000267 3300009148 Bacteria 58724
98 Ga0105242_10003607 3300009176 Bacteria 12039
99 Ga0105248_10222552 3300009177 Bacteria 2125
100 Ga0105249_10002539 3300009553 Bacteria 15800
101 Ga0105249_10076063 3300009553 Bacteria 3111
102 Ga0105249_10167332 3300009553 Bacteria 2129
103 Ga0105249_10984754 3300009553 Bacteria 912
104 Ga0105246_10001740 3300011119 Bacteria 13020
105 Ga0157371_10402985 3300013102 Bacteria 1001
106 Ga0157371_10644126 3300013102 Bacteria 790
107 Ga0157370_10000140 3300013104 Bacteria 87498
108 Ga0157370_10125999 3300013104 Bacteria 2390
109 Ga0157370_10344192 3300013104 Bacteria 1374
110 Ga0157369_10039174 3300013105 Bacteria 5180
111 Ga0157374_10002642 3300013296 Bacteria 15099
112 Ga0157378_10003125 3300013297 Bacteria 14717
113 Ga0163162_10782734 3300013306 Bacteria 1072
114 Ga0163162_11187945 3300013306 Bacteria 865
115 Ga0157372_10069573 3300013307 Bacteria 3958
116 Ga0157372_11897138 3300013307 Bacteria 685
117 Ga0157375_10007514 3300013308 Bacteria 9530
118 Ga0157375_10035932 3300013308 Bacteria 4733
119 Ga0157375_11679993 3300013308 Bacteria 752
120 Ga0163163_10591136 3300014325 Bacteria 1173
121 Ga0157377_10033833 3300014745 Bacteria 2792
122 Ga0157376_10000595 3300014969 Bacteria 23367
123 Ga0163161_10031491 3300017792 Bacteria 3779
124 Ga0206354_10726863 3300020081 Bacteria 4596
125 Ga0206353_11331210 3300020082 Bacteria 7970
126 Ga0213873_10000016 3300021358 Bacteria 124829
127 Ga0213876_10000056 3300021384 Bacteria 135017
128 Ga0213876_10000258 3300021384 Bacteria 49441
129 Ga0207427_100635 3300025231 Bacteria 17043
130 Ga0209026_1007027 3300025250 Bacteria 2622
131 Ga0209148_1000114 3300025254 Bacteria 192073
132 Ga0209148_1000867 3300025254 Bacteria 21151
133 Ga0209233_1000319 3300025261 Bacteria 52404
134 Ga0209455_1000599 3300025272 Bacteria 23019
135 Ga0209455_1011083 3300025272 Bacteria 2243
136 Ga0207713_1000673 3300025735 Bacteria 32203
137 Ga0207682_10000258 3300025893 Bacteria 23899
138 Ga0207642_10144368 3300025899 Bacteria 1259
139 Ga0207710_10112457 3300025900 Bacteria 1294
140 Ga0207688_10264473 3300025901 Bacteria 1045
141 Ga0207647_10001049 3300025904 Bacteria 21361
142 Ga0207647_10047839 3300025904 Bacteria 2658
143 Ga0207647_10049825 3300025904 Bacteria 2596
144 Ga0207645_10002995 3300025907 Bacteria 13047
145 Ga0207645_10712832 3300025907 Bacteria 682
146 Ga0207705_10000014 3300025909 Bacteria 434286
147 Ga0207705_10000583 3300025909 Bacteria 30635
148 Ga0207705_10008707 3300025909 Bacteria 7395
149 Ga0207707_10020047 3300025912 Bacteria 5834
150 Ga0207695_10095072 3300025913 Bacteria 2985
151 Ga0207671_10056309 3300025914 Bacteria 2913
152 Ga0207660_10001365 3300025917 Bacteria 16351
153 Ga0207657_10001518 3300025919 Bacteria 24871
154 Ga0207657_10005887 3300025919 Bacteria 12766
155 Ga0207657_10011544 3300025919 Bacteria 8769
156 Ga0207657_10019472 3300025919 Bacteria 6443
157 Ga0207657_10048240 3300025919 Bacteria 3719
158 Ga0207657_10073445 3300025919 Bacteria 2890
159 Ga0207657_10093522 3300025919 Bacteria 2504
160 Ga0207649_10000016 3300025920 Bacteria 243843
161 Ga0207652_10000002 3300025921 Bacteria 878035
162 Ga0207681_10000261 3300025923 Bacteria 40384
163 Ga0207681_10004717 3300025923 Bacteria 8387
164 Ga0207681_10105317 3300025923 Bacteria 2042
165 Ga0207681_10219326 3300025923 Bacteria 1471
166 Ga0207681_10245714 3300025923 Bacteria 1395
167 Ga0207681_11295455 3300025923 Bacteria 612
168 Ga0207650_10015162 3300025925 Bacteria 5363
169 Ga0207650_10337699 3300025925 Bacteria 1237
170 Ga0207659_10130592 3300025926 Bacteria 1938
171 Ga0207659_10698481 3300025926 Bacteria 868
172 Ga0207687_10014408 3300025927 Bacteria 5173
173 Ga0207644_10000111 3300025931 Bacteria 60737
174 Ga0207644_10001037 3300025931 Bacteria 17807
175 Ga0207644_10114231 3300025931 Bacteria 2046
176 Ga0207644_10192467 3300025931 Bacteria 1604
177 Ga0207644_10477912 3300025931 Bacteria 1026
178 Ga0207690_10000020 3300025932 Bacteria 218439
179 Ga0207690_10135992 3300025932 Bacteria 1805
180 Ga0207690_10145954 3300025932 Bacteria 1749
181 Ga0207690_10162291 3300025932 Bacteria 1667
182 Ga0207690_10451606 3300025932 Bacteria 1033
183 Ga0207706_10056056 3300025933 Bacteria 3475
184 Ga0207686_10001120 3300025934 Bacteria 15512
185 Ga0207709_10001754 3300025935 Bacteria 14597
186 Ga0207669_10111718 3300025937 Bacteria 1833
187 Ga0207669_10296785 3300025937 Bacteria 1226
188 Ga0207669_10465464 3300025937 Bacteria 1005
189 Ga0207669_10846837 3300025937 Bacteria 761
190 Ga0207704_10000002 3300025938 Bacteria 303025
191 Ga0207691_10116756 3300025940 Bacteria 2368
192 Ga0207691_10421166 3300025940 Bacteria 1138
193 Ga0207691_10548526 3300025940 Bacteria 980
194 Ga0207711_10005137 3300025941 Bacteria 11096
195 Ga0207689_10003341 3300025942 Bacteria 14700
196 Ga0207661_10674204 3300025944 Bacteria 951
197 Ga0207667_10027645 3300025949 Bacteria 6170
198 Ga0207667_10536469 3300025949 Bacteria 1184
199 Ga0207651_10000023 3300025960 Bacteria 76488
200 Ga0207712_10146108 3300025961 Bacteria 1820
201 Ga0207712_10505275 3300025961 Bacteria 1034
202 Ga0207668_10000009 3300025972 Bacteria 188071
203 Ga0207668_10000054 3300025972 Bacteria 95426
204 Ga0207668_10004544 3300025972 Bacteria 8164
205 Ga0207640_10059555 3300025981 Bacteria 2520
206 Ga0207677_10000100 3300026023 Bacteria 70908
207 Ga0207677_10000168 3300026023 Bacteria 52215
208 Ga0207703_10744200 3300026035 Bacteria 934
209 Ga0207639_10343678 3300026041 Bacteria 1331
210 Ga0207639_10348757 3300026041 Bacteria 1321
211 Ga0207639_11425977 3300026041 Bacteria 650
212 Ga0207678_10746191 3300026067 Bacteria 863
213 Ga0207708_10203693 3300026075 Bacteria 1579
214 Ga0207702_10008154 3300026078 Bacteria 8860
215 Ga0207702_10220782 3300026078 Bacteria 1766
216 Ga0207702_10276529 3300026078 Bacteria 1586
217 Ga0207702_10786477 3300026078 Bacteria 940
218 Ga0207641_10000045 3300026088 Bacteria 181882
219 Ga0207641_10006245 3300026088 Bacteria 10080
220 Ga0207648_10000120 3300026089 Bacteria 76384
221 Ga0207674_10015972 3300026116 Bacteria 8225
222 Ga0207674_10084798 3300026116 Bacteria 3165
223 Ga0207674_10826222 3300026116 Bacteria 894
224 Ga0207675_100006332 3300026118 Bacteria 11222
225 Ga0207683_10078323 3300026121 Bacteria 2929
226 Ga0207698_10004199 3300026142 Bacteria 8765
227 Ga0207698_10180165 3300026142 Bacteria 1871
228 Ga0268266_10000130 3300028379 Bacteria 147912
229 Ga0268266_10000175 3300028379 Bacteria 115897
230 Ga0268266_10003755 3300028379 Bacteria 14909
231 Ga0268266_10032027 3300028379 Bacteria 4467
232 Ga0268266_10345937 3300028379 Bacteria 1396
233 Ga0268266_10581628 3300028379 Bacteria 1075
234 Ga0268265_10000803 3300028380 Bacteria 29861
235 Ga0268265_10065726 3300028380 Bacteria 2800
236 Ga0268264_10010960 3300028381 Bacteria 7487
237 Ga0268264_10025177 3300028381 Bacteria 4861
238 Ga0268264_10063611 3300028381 Bacteria 3102
239 Ga0268264_10334712 3300028381 Bacteria 1436
240 Ga0265331_10020163 3300031250 Bacteria 3428
241 Ga0307408_100017066 3300031548 Bacteria 4855
242 Ga0307408_100082185 3300031548 Bacteria 2411
243 Ga0307408_100175767 3300031548 Bacteria 1713
244 Ga0307408_100200167 3300031548 Bacteria 1616
245 Ga0307408_100813543 3300031548 Bacteria 849
246 Ga0307405_10092162 3300031731 Bacteria 2010
247 Ga0307405_10099374 3300031731 Bacteria 1947
248 Ga0307405_10185135 3300031731 Unclassified 1499
249 Ga0307405_10585100 3300031731 Bacteria 908
250 Ga0307405_11018214 3300031731 Bacteria 707
251 Ga0307413_10074536 3300031824 Bacteria 2150
252 Ga0307413_11521836 3300031824 Bacteria 592
253 Ga0307410_10006775 3300031852 Bacteria 6213
254 Ga0307410_10093968 3300031852 Bacteria 2135
255 Ga0307410_10389614 3300031852 Bacteria 1123
256 Ga0307410_10438910 3300031852 Bacteria 1062
257 Ga0307410_10601131 3300031852 Bacteria 917
258 Ga0307410_10756565 3300031852 Bacteria 823
259 Ga0307410_11450711 3300031852 Bacteria 603
260 Ga0307406_10059890 3300031901 Bacteria 2453
261 Ga0307406_10213389 3300031901 Bacteria 1429
262 Ga0307407_10010565 3300031903 Bacteria 4360
263 Ga0307407_10042583 3300031903 Bacteria 2547
264 Ga0307407_10190771 3300031903 Bacteria 1366
265 Ga0307407_10386514 3300031903 Bacteria 1000
266 Ga0307407_10798910 3300031903 Bacteria 718
267 Ga0307412_10000454 3300031911 Bacteria 24665
268 Ga0307412_10021885 3300031911 Bacteria 3911
269 Ga0307412_10040123 3300031911 Bacteria 3027
270 Ga0307412_10063286 3300031911 Bacteria 2495
271 Ga0307412_10818251 3300031911 Bacteria 810
272 Ga0307412_11189590 3300031911 Bacteria 682
273 Ga0307409_100064827 3300031995 Bacteria 2872
274 Ga0307409_100097248 3300031995 Bacteria 2431
275 Ga0307409_100197231 3300031995 Bacteria 1798
276 Ga0307409_102381819 3300031995 Bacteria 558
277 Ga0307416_100013683 3300032002 Bacteria 5524
278 Ga0307416_100018856 3300032002 Bacteria 4875
279 Ga0307416_100042324 3300032002 Bacteria 3554
280 Ga0307416_100145103 3300032002 Bacteria 2165
281 Ga0307416_100284376 3300032002 Bacteria 1633
282 Ga0307416_100302820 3300032002 Bacteria 1590
283 Ga0307416_101489335 3300032002 Bacteria 782
284 Ga0307414_10020000 3300032004 Bacteria 4162
285 Ga0307414_10024870 3300032004 Bacteria 3825
286 Ga0307414_10033888 3300032004 Bacteria 3380
287 Ga0307414_10043199 3300032004 Bacteria 3068
288 Ga0307414_10173894 3300032004 Bacteria 1725
289 Ga0307414_10323091 3300032004 Bacteria 1314
290 Ga0307414_10396188 3300032004 Bacteria 1198
291 Ga0307414_10587433 3300032004 Bacteria 997
292 Ga0307414_10659364 3300032004 Bacteria 944
293 Ga0307411_10023693 3300032005 Bacteria 3642
294 Ga0307411_10141928 3300032005 Bacteria 1772
295 Ga0307411_10185144 3300032005 Bacteria 1584
296 Ga0307411_10392717 3300032005 Bacteria 1144
297 Ga0307411_10552855 3300032005 Bacteria 982
298 Ga0307415_100154910 3300032126 Bacteria 1768
299 Ga0307415_100585249 3300032126 Bacteria 991
300 Ga0307415_100612395 3300032126 Bacteria 971
301 Ga0373932_0014778 3300035112 Bacteria 1969
302 Ga0373931_0272751 3300035691 Bacteria 1036
303 Ga0373947_0049928 3300035725 Bacteria 2514
304 Ga0373925_0038509 3300037068 Bacteria 3536
305 Ga0395899_0000730 3300037312 Bacteria 32812
306 Ga0395900_0132024 3300037418 Bacteria 2559
307 Ga0395900_0196167 3300037418 Bacteria 2045
308 Ga0395898_0933928 3300037466 Bacteria 805
309 Ga0395898_1436128 3300037466 Bacteria 617
310 Ga0395905_0378107 3300037471 Bacteria 1310
311 Ga0395905_0664662 3300037471 Bacteria 944
312 Ga0436365_0869628 3300039437 Bacteria 66366
313 Ga0436365_0881241 3300039437 Bacteria 1056
314 Ga0436365_1503647 3300039437 Bacteria 38811
315 Ga0436362_0580304 3300039453 Bacteria 124869
316 Ga0439436_0034554 3300041404 Bacteria 1462
317 Ga0439465_0128915 3300041413 Bacteria 892
318 Ga0451793_0561142 3300041452 Bacteria 869
319 Ga0451800_1552524 3300041459 Unclassified 1642
320 Ga0451802_0082328 3300041460 Bacteria 3188
321 Ga0451806_036250 3300041462 Bacteria 1831
322 Ga0451841_0647617 3300041498 Bacteria 1541
323 Ga0439448_0001093 3300042005 Bacteria 6818
324 Ga0439432_013450 3300042006 Bacteria 2785
325 Ga0439449_0015947 3300042007 Bacteria 2824
326 Ga0450923_084288 3300042125 Bacteria 718
327 Ga0439458_0000368 3300042157 Bacteria 11329
328 Ga0466965_0014812 3300044683 Bacteria 3695
329 Ga0466966_0395534 3300044684 Bacteria 830
330 Ga0466961_0008751 3300044693 Bacteria 6455
331 Ga0466961_0217487 3300044693 Bacteria 1178
332 Ga0466963_0004926 3300044694 Bacteria 7788
333 Ga0466963_0868853 3300044694 Bacteria 636
334 Ga0466964_0034449 3300044706 Bacteria 2021
335 Ga0466964_0042035 3300044706 Bacteria 1851
336 Ga0466971_0003710 3300044719 Bacteria 6533
337 Ga0466971_0056132 3300044719 Bacteria 1776
338 Ga0466968_0004036 3300044735 Bacteria 5458
339 Ga0466968_0435826 3300044735 Bacteria 646
340 Ga0466970_0029400 3300044765 Bacteria 2892
341 Ga0466970_0074801 3300044765 Bacteria 1824
342 Ga0466957_0029141 3300044842 Bacteria 3290
343 Ga0466957_0224700 3300044842 Bacteria 1241
344 Ga0466959_0039310 3300045049 Bacteria 3495
345 Ga0466958_0003930 3300045836 Bacteria 7791
346 Ga0466958_0056184 3300045836 Bacteria 2390
347 Ga0466967_0010112 3300045976 Bacteria 7053
348 Ga0466967_0261982 3300045976 Bacteria 1654
349 Ga0466967_0301745 3300045976 Bacteria 1541
350 Ga0495605_0249486 3300046474 Bacteria 760
351 Ga0495606_0107785 3300046507 Bacteria 1685
352 Ga0495610_0000418 3300046512 Bacteria 43639
353 Ga0495616_0049321 3300046513 Bacteria 2111
354 Ga0495620_0042099 3300046515 Bacteria 1998
355 Ga0495637_0013603 3300046520 Bacteria 3859
356 Ga0495643_0000126 3300046522 Bacteria 123807
357 Ga0495643_0023040 3300046522 Bacteria 3544
358 Ga0495609_0056161 3300046538 Bacteria 1745
359 Ga0495597_0002079 3300046542 Bacteria 13347
360 Ga0495633_0051354 3300046558 Bacteria 1943
361 Ga0495625_0044418 3300046660 Bacteria 3217
362 Ga0495625_0387357 3300046660 Bacteria 876
363 Ga0495649_0167964 3300046694 Bacteria 1149
364 Ga0495686_0003763 3300047472 Bacteria 12898
365 Ga0495686_0006588 3300047472 Bacteria 8856
366 Ga0496113_0965518 3300048916 Bacteria 672
367 Ga0496117_0008571 3300048920 Bacteria 9695
368 Ga0496117_0135850 3300048920 Bacteria 1481
369 Ga0496118_0011266 3300048921 Bacteria 8750
370 Ga0496118_0013942 3300048921 Bacteria 7559
371 Ga0496118_0047653 3300048921 Bacteria 3319
372 Ga0496119_0022403 3300048922 Bacteria 4523
373 Ga0496119_0227887 3300048922 Bacteria 950
374 Ga0496120_0015483 3300048923 Bacteria 5025
375 Ga0496120_0052243 3300048923 Bacteria 2329
376 Ga0496120_0089600 3300048923 Bacteria 1646
377 Ga0496121_0007252 3300048924 Bacteria 13420
378 Ga0496121_0011369 3300048924 Bacteria 9895
379 Ga0496121_0028884 3300048924 Bacteria 5150
380 Ga0496122_0043107 3300048925 Bacteria 3539
381 Ga0496122_0478984 3300048925 Bacteria 610
382 Ga0496123_0005045 3300048926 Bacteria 13507
383 Ga0496124_0062534 3300048927 Bacteria 3114
384 Ga0496124_0099729 3300048927 Bacteria 2355
385 Ga0496124_0405658 3300048927 Bacteria 944
386 Ga0496125_0006050 3300048928 Bacteria 13227
387 Ga0496125_0162377 3300048928 Bacteria 1515
388 Ga0496126_0044798 3300048929 Bacteria 4071
389 Ga0496126_0184869 3300048929 Bacteria 1768
390 Ga0496126_0442133 3300048929 Bacteria 1048
391 Ga0501314_001179 3300049530 Bacteria 1843
392 Ga0501034_0009756 3300049571 Bacteria 10040
393 Ga0501069_0016864 3300049585 Bacteria 3924
394 Ga0501070_0106750 3300049586 Bacteria 2314
395 Ga0501074_0611843 3300049590 Bacteria 770
396 Ga0501198_029448 3300049649 Bacteria 910
397 Ga0501223_000170 3300049663 Bacteria 16976
398 Ga0501224_000100 3300049664 Bacteria 9083
399 Ga0501233_007363 3300049668 Bacteria 2091
400 Ga0501235_035498 3300049669 Bacteria 1132
401 Ga0501225_0000927 3300049705 Bacteria 9139
402 Ga0501080_0531916 3300049742 Bacteria 1048
403 Ga0501226_000031 3300049853 Bacteria 74305
404 nmdc:mga03683_74173_c1 3300050489 Bacteria 1459
405 nmdc:mga0k408_73927_c1 3300050493 Bacteria 1991
406 nmdc:mga0rr50_903370_c1 3300050513 Bacteria 753
407 Ga0500646_0027913 3300053090 Bacteria 1538
408 Ga0500651_0004262 3300053093 Bacteria 7988
409 Ga0500642_0027175 3300053130 Bacteria 2346
410 Ga0500559_0022972 3300053136 Bacteria 2646
411 Ga0500568_0002468 3300053139 Bacteria 10868
412 Ga0500577_0095323 3300053142 Bacteria 1209
413 Ga0500604_0000102 3300053151 Bacteria 26419
414 Ga0500616_0000161 3300053153 Bacteria 111424
415 Ga0500639_153514 3300053163 Bacteria 1058
416 Ga0500570_000958 3300053724 Bacteria 12450
417 Ga0500645_115389 3300053730 Bacteria 751
418 Ga0500552_001947 3300053733 Bacteria 1986
419 Ga0466962_0001969 3300061719 Bacteria 9693
420 Ga0466962_0176130 3300061719 Bacteria 1042

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_100028934 Ga0068853_1000289345 161
2 3300005539 Ga0068853_100248059 Ga0068853_1002480592 161
3 3300013307 Ga0157372_11897138 Ga0157372_118971381 161
4 3300025923 Ga0207681_10105317 Ga0207681_101053172 161
5 3300025944 Ga0207661_10674204 Ga0207661_106742042 161
6 3300026041 Ga0207639_10348757 Ga0207639_103487572 161
7 3300026142 Ga0207698_10180165 Ga0207698_101801652 161
8 3300028379 Ga0268266_10000130 Ga0268266_1000013051 161
9 3300031903 Ga0307407_10798910 Ga0307407_107989102 161
10 3300039437 Ga0436365_0881241 Ga0436365_0881241_281_796 161
11 3300046694 Ga0495649_0167964 Ga0495649_0167964_430_930 161
12 3300005289 Ga0065704_10075953 Ga0065704_100759534 162
13 3300005336 Ga0070680_100000642 Ga0070680_1000006425 162
14 3300005337 Ga0070682_100230256 Ga0070682_1002302562 162
15 3300005339 Ga0070660_100004877 Ga0070660_1000048773 162
16 3300005344 Ga0070661_100000003 Ga0070661_100000003237 162
17 3300005354 Ga0070675_101289986 Ga0070675_1012899861 162
18 3300005367 Ga0070667_100029219 Ga0070667_1000292192 162
19 3300005458 Ga0070681_10044787 Ga0070681_100447872 162
20 3300005530 Ga0070679_100000001 Ga0070679_100000001244 162
21 3300005841 Ga0068863_100014434 Ga0068863_1000144343 162
22 3300005843 Ga0068860_100023451 Ga0068860_1000234513 162
23 3300005844 Ga0068862_100009303 Ga0068862_1000093032 162
24 3300009011 Ga0105251_10002745 Ga0105251_100027453 162
25 3300009101 Ga0105247_10239818 Ga0105247_102398182 162
26 3300009553 Ga0105249_10076063 Ga0105249_100760632 162
27 3300025912 Ga0207707_10020047 Ga0207707_100200476 162
28 3300025917 Ga0207660_10001365 Ga0207660_100013655 162
29 3300025919 Ga0207657_10005887 Ga0207657_1000588712 162
30 3300025920 Ga0207649_10000016 Ga0207649_10000016142 162
31 3300025921 Ga0207652_10000002 Ga0207652_10000002805 162
32 3300025926 Ga0207659_10698481 Ga0207659_106984812 162
33 3300025961 Ga0207712_10146108 Ga0207712_101461082 162
34 3300025972 Ga0207668_10004544 Ga0207668_100045448 162
35 3300026088 Ga0207641_10006245 Ga0207641_100062454 162
36 3300028381 Ga0268264_10025177 Ga0268264_100251773 162
37 3300032002 Ga0307416_100284376 Ga0307416_1002843761 162
38 3300046507 Ga0495606_0107785 Ga0495606_0107785_97_591 162
39 3300046515 Ga0495620_0042099 Ga0495620_0042099_843_1337 162
40 3300048920 Ga0496117_0135850 Ga0496117_0135850_71_580 162
41 3300048921 Ga0496118_0013942 Ga0496118_0013942_3115_3624 162
42 3300048922 Ga0496119_0227887 Ga0496119_0227887_65_574 162
43 3300048923 Ga0496120_0052243 Ga0496120_0052243_1170_1679 162
44 3300048924 Ga0496121_0011369 Ga0496121_0011369_2291_2800 162
45 3300048925 Ga0496122_0478984 Ga0496122_0478984_38_547 162
46 3300048927 Ga0496124_0062534 Ga0496124_0062534_914_1423 162
47 3300048927 Ga0496124_0405658 Ga0496124_0405658_401_910 162
48 3300048928 Ga0496125_0006050 Ga0496125_0006050_11458_11967 162
49 3300048929 Ga0496126_0044798 Ga0496126_0044798_3008_3517 162
50 3300005338 Ga0068868_100000032 Ga0068868_10000003213 163
51 3300005339 Ga0070660_100003184 Ga0070660_1000031844 163
52 3300005353 Ga0070669_100165677 Ga0070669_1001656772 163
53 3300005354 Ga0070675_101001603 Ga0070675_1010016032 163
54 3300005356 Ga0070674_100117701 Ga0070674_1001177012 163
55 3300005366 Ga0070659_100000005 Ga0070659_100000005204 163
56 3300005440 Ga0070705_100787460 Ga0070705_1007874601 163
57 3300005543 Ga0070672_100612225 Ga0070672_1006122252 163
58 3300005546 Ga0070696_100822245 Ga0070696_1008222451 163
59 3300007076 Ga0075435_100263344 Ga0075435_1002633442 163
60 3300009098 Ga0105245_10466877 Ga0105245_104668772 163
61 3300021384 Ga0213876_10000258 Ga0213876_1000025828 163
62 3300025907 Ga0207645_10712832 Ga0207645_107128322 163
63 3300025919 Ga0207657_10001518 Ga0207657_1000151816 163
64 3300025923 Ga0207681_10219326 Ga0207681_102193262 163
65 3300025926 Ga0207659_10130592 Ga0207659_101305922 163
66 3300025932 Ga0207690_10000020 Ga0207690_1000002020 163
67 3300025937 Ga0207669_10296785 Ga0207669_102967852 163
68 3300025940 Ga0207691_10548526 Ga0207691_105485262 163
69 3300026023 Ga0207677_10000100 Ga0207677_1000010050 163
70 3300026075 Ga0207708_10203693 Ga0207708_102036932 163
71 3300031824 Ga0307413_11521836 Ga0307413_115218361 163
72 3300032002 Ga0307416_100013683 Ga0307416_1000136833 163
73 3300032004 Ga0307414_10020000 Ga0307414_100200002 163
74 3300032005 Ga0307411_10552855 Ga0307411_105528551 163
75 3300032126 Ga0307415_100585249 Ga0307415_1005852492 163
76 3300039437 Ga0436365_1503647 Ga0436365_1503647_12738_13238 163
77 3300046474 Ga0495605_0249486 Ga0495605_0249486_82_576 163
78 3300046512 Ga0495610_0000418 Ga0495610_0000418_18470_18964 163
79 3300046522 Ga0495643_0000126 Ga0495643_0000126_25317_25811 163
80 3300046558 Ga0495633_0051354 Ga0495633_0051354_1144_1638 163
81 3300050513 nmdc:mga0rr50_903370_c1 nmdc:mga0rr50_903370_c1_114_626 163
82 3300005333 Ga0070677_10000160 Ga0070677_100001604 164
83 3300005347 Ga0070668_100000001 Ga0070668_10000000182 164
84 3300005353 Ga0070669_100020675 Ga0070669_1000206754 164
85 3300005353 Ga0070669_100112106 Ga0070669_1001121062 164
86 3300005355 Ga0070671_100000046 Ga0070671_10000004698 164
87 3300005548 Ga0070665_100004425 Ga0070665_10000442514 164
88 3300005548 Ga0070665_100304304 Ga0070665_1003043042 164
89 3300005617 Ga0068859_101717426 Ga0068859_1017174261 164
90 3300005719 Ga0068861_100039323 Ga0068861_1000393232 164
91 3300005841 Ga0068863_100034345 Ga0068863_1000343452 164
92 3300005844 Ga0068862_100000898 Ga0068862_1000008982 164
93 3300006931 Ga0097620_101716738 Ga0097620_1017167381 164
94 3300009177 Ga0105248_10222552 Ga0105248_102225522 164
95 3300009553 Ga0105249_10984754 Ga0105249_109847542 164
96 3300013104 Ga0157370_10125999 Ga0157370_101259992 164
97 3300013306 Ga0163162_10782734 Ga0163162_107827342 164
98 3300013308 Ga0157375_10035932 Ga0157375_100359322 164
99 3300013308 Ga0157375_11679993 Ga0157375_116799932 164
100 3300025893 Ga0207682_10000258 Ga0207682_100002582 164
101 3300025923 Ga0207681_10004717 Ga0207681_100047172 164
102 3300025923 Ga0207681_10245714 Ga0207681_102457142 164
103 3300025931 Ga0207644_10001037 Ga0207644_1000103712 164
104 3300025931 Ga0207644_10477912 Ga0207644_104779122 164
105 3300025937 Ga0207669_10846837 Ga0207669_108468372 164
106 3300025972 Ga0207668_10000009 Ga0207668_1000000975 164
107 3300026118 Ga0207675_100006332 Ga0207675_1000063329 164
108 3300028379 Ga0268266_10003755 Ga0268266_100037552 164
109 3300028379 Ga0268266_10581628 Ga0268266_105816282 164
110 3300028380 Ga0268265_10000803 Ga0268265_1000080333 164
111 3300031250 Ga0265331_10020163 Ga0265331_100201632 164
112 3300031731 Ga0307405_10099374 Ga0307405_100993742 164
113 3300031852 Ga0307410_10006775 Ga0307410_100067756 164
114 3300031852 Ga0307410_10389614 Ga0307410_103896141 164
115 3300031995 Ga0307409_100097248 Ga0307409_1000972482 164
116 3300032002 Ga0307416_101489335 Ga0307416_1014893352 164
117 3300032004 Ga0307414_10659364 Ga0307414_106593642 164
118 3300044694 Ga0466963_0868853 Ga0466963_0868853_118_612 164
119 3300044842 Ga0466957_0224700 Ga0466957_0224700_474_968 164
120 3300005331 Ga0070670_100001565 Ga0070670_10000156512 165
121 3300005355 Ga0070671_101261138 Ga0070671_1012611381 165
122 3300005466 Ga0070685_10842395 Ga0070685_108423951 165
123 3300005544 Ga0070686_100493122 Ga0070686_1004931222 165
124 3300005546 Ga0070696_100189979 Ga0070696_1001899792 165
125 3300005548 Ga0070665_100505231 Ga0070665_1005052312 165
126 3300005577 Ga0068857_100249422 Ga0068857_1002494221 165
127 3300005578 Ga0068854_100588075 Ga0068854_1005880752 165
128 3300005842 Ga0068858_100077187 Ga0068858_1000771872 165
129 3300005843 Ga0068860_100014907 Ga0068860_1000149074 165
130 3300014325 Ga0163163_10591136 Ga0163163_105911362 165
131 3300020081 Ga0206354_10726863 Ga0206354_107268633 165
132 3300020082 Ga0206353_11331210 Ga0206353_113312107 165
133 3300021358 Ga0213873_10000016 Ga0213873_1000001610 165
134 3300021384 Ga0213876_10000056 Ga0213876_10000056128 165
135 3300025923 Ga0207681_11295455 Ga0207681_112954551 165
136 3300025937 Ga0207669_10465464 Ga0207669_104654642 165
137 3300025981 Ga0207640_10059555 Ga0207640_100595552 165
138 3300026116 Ga0207674_10084798 Ga0207674_100847982 165
139 3300026116 Ga0207674_10826222 Ga0207674_108262222 165
140 3300028379 Ga0268266_10345937 Ga0268266_103459372 165
141 3300028381 Ga0268264_10010960 Ga0268264_100109606 165
142 3300031548 Ga0307408_100082185 Ga0307408_1000821852 165
143 3300031548 Ga0307408_100175767 Ga0307408_1001757672 165
144 3300031548 Ga0307408_100200167 Ga0307408_1002001672 165
145 3300031548 Ga0307408_100813543 Ga0307408_1008135432 165
146 3300031731 Ga0307405_10092162 Ga0307405_100921622 165
147 3300031731 Ga0307405_10185135 Ga0307405_101851352 165
148 3300031852 Ga0307410_10601131 Ga0307410_106011312 165
149 3300031852 Ga0307410_10756565 Ga0307410_107565651 165
150 3300031852 Ga0307410_11450711 Ga0307410_114507112 165
151 3300031901 Ga0307406_10059890 Ga0307406_100598902 165
152 3300031903 Ga0307407_10042583 Ga0307407_100425832 165
153 3300031903 Ga0307407_10190771 Ga0307407_101907712 165
154 3300031903 Ga0307407_10386514 Ga0307407_103865142 165
155 3300031911 Ga0307412_10021885 Ga0307412_100218852 165
156 3300031911 Ga0307412_10063286 Ga0307412_100632863 165
157 3300031911 Ga0307412_10818251 Ga0307412_108182512 165
158 3300031911 Ga0307412_11189590 Ga0307412_111895902 165
159 3300031995 Ga0307409_100197231 Ga0307409_1001972312 165
160 3300031995 Ga0307409_102381819 Ga0307409_1023818191 165
161 3300032002 Ga0307416_100018856 Ga0307416_1000188562 165
162 3300032002 Ga0307416_100145103 Ga0307416_1001451032 165
163 3300032004 Ga0307414_10033888 Ga0307414_100338882 165
164 3300032004 Ga0307414_10173894 Ga0307414_101738942 165
165 3300032004 Ga0307414_10323091 Ga0307414_103230911 165
166 3300032004 Ga0307414_10396188 Ga0307414_103961882 165
167 3300032004 Ga0307414_10587433 Ga0307414_105874332 165
168 3300032005 Ga0307411_10023693 Ga0307411_100236933 165
169 3300032005 Ga0307411_10185144 Ga0307411_101851442 165
170 3300032126 Ga0307415_100154910 Ga0307415_1001549102 165
171 3300032126 Ga0307415_100612395 Ga0307415_1006123952 165
172 3300037471 Ga0395905_0664662 Ga0395905_0664662_256_753 165
173 3300039437 Ga0436365_0869628 Ga0436365_0869628_8873_9373 165
174 3300039453 Ga0436362_0580304 Ga0436362_0580304_8873_9373 165
175 3300041404 Ga0439436_0034554 Ga0439436_0034554_681_1178 165
176 3300041498 Ga0451841_0647617 Ga0451841_0647617_760_1272 165
177 3300045976 Ga0466967_0301745 Ga0466967_0301745_65_562 165
178 3300046513 Ga0495616_0049321 Ga0495616_0049321_1485_1997 165
179 3300046660 Ga0495625_0044418 Ga0495625_0044418_426_938 165
180 3300048929 Ga0496126_0184869 Ga0496126_0184869_638_1150 165
181 3300049585 Ga0501069_0016864 Ga0501069_0016864_1404_1901 165
182 3300049586 Ga0501070_0106750 Ga0501070_0106750_610_1107 165
183 3300049590 Ga0501074_0611843 Ga0501074_0611843_161_658 165
184 3300049742 Ga0501080_0531916 Ga0501080_0531916_365_862 165
185 3300053090 Ga0500646_0027913 Ga0500646_0027913_469_984 165
186 3300053139 Ga0500568_0002468 Ga0500568_0002468_9159_9674 165
187 3300053151 Ga0500604_0000102 Ga0500604_0000102_15787_16302 165
188 3300053153 Ga0500616_0000161 Ga0500616_0000161_58342_58857 165
189 3300026078 Ga0207702_10786477 Ga0207702_107864772 166
190 3300031548 Ga0307408_100017066 Ga0307408_1000170663 166
191 3300031731 Ga0307405_10585100 Ga0307405_105851002 166
192 3300031731 Ga0307405_11018214 Ga0307405_110182142 166
193 3300031824 Ga0307413_10074536 Ga0307413_100745363 166
194 3300031852 Ga0307410_10093968 Ga0307410_100939682 166
195 3300031852 Ga0307410_10438910 Ga0307410_104389102 166
196 3300031901 Ga0307406_10213389 Ga0307406_102133892 166
197 3300031903 Ga0307407_10010565 Ga0307407_100105653 166
198 3300031911 Ga0307412_10000454 Ga0307412_100004542 166
199 3300031911 Ga0307412_10040123 Ga0307412_100401232 166
200 3300031995 Ga0307409_100064827 Ga0307409_1000648272 166
201 3300032002 Ga0307416_100042324 Ga0307416_1000423243 166
202 3300032002 Ga0307416_100302820 Ga0307416_1003028202 166
203 3300032004 Ga0307414_10024870 Ga0307414_100248704 166
204 3300032004 Ga0307414_10043199 Ga0307414_100431992 166
205 3300032005 Ga0307411_10141928 Ga0307411_101419282 166
206 3300032005 Ga0307411_10392717 Ga0307411_103927172 166
207 3300035725 Ga0373947_0049928 Ga0373947_0049928_123_644 166
208 3300037068 Ga0373925_0038509 Ga0373925_0038509_1057_1578 166
209 3300041413 Ga0439465_0128915 Ga0439465_0128915_34_534 166
210 3300042006 Ga0439432_013450 Ga0439432_013450_123_623 166
211 3300042007 Ga0439449_0015947 Ga0439449_0015947_224_724 166
212 3300042125 Ga0450923_084288 Ga0450923_084288_17_517 166
213 3300044765 Ga0466970_0074801 Ga0466970_0074801_384_884 166
214 3300046520 Ga0495637_0013603 Ga0495637_0013603_3098_3619 166
215 3300046522 Ga0495643_0023040 Ga0495643_0023040_985_1506 166
216 3300046538 Ga0495609_0056161 Ga0495609_0056161_325_846 166
217 3300046542 Ga0495597_0002079 Ga0495597_0002079_1957_2478 166
218 3300046660 Ga0495625_0387357 Ga0495625_0387357_61_582 166
219 3300049530 Ga0501314_001179 Ga0501314_001179_1184_1684 166
220 3300049571 Ga0501034_0009756 Ga0501034_0009756_5084_5584 166
221 3300049649 Ga0501198_029448 Ga0501198_029448_254_754 166
222 3300049663 Ga0501223_000170 Ga0501223_000170_14723_15223 166
223 3300049664 Ga0501224_000100 Ga0501224_000100_1750_2250 166
224 3300049668 Ga0501233_007363 Ga0501233_007363_652_1152 166
225 3300049669 Ga0501235_035498 Ga0501235_035498_414_914 166
226 3300049705 Ga0501225_0000927 Ga0501225_0000927_6651_7151 166
227 3300049853 Ga0501226_000031 Ga0501226_000031_1987_2487 166
228 3300053093 Ga0500651_0004262 Ga0500651_0004262_1951_2472 166
229 3300053130 Ga0500642_0027175 Ga0500642_0027175_389_910 166
230 3300053142 Ga0500577_0095323 Ga0500577_0095323_156_677 166
231 3300053163 Ga0500639_153514 Ga0500639_153514_415_936 166
232 3300053724 Ga0500570_000958 Ga0500570_000958_51_572 166
233 3300053730 Ga0500645_115389 Ga0500645_115389_30_551 166
234 3300053733 Ga0500552_001947 Ga0500552_001947_923_1444 166
235 3300005327 Ga0070658_10006307 Ga0070658_1000630710 167
236 3300005331 Ga0070670_100024630 Ga0070670_1000246302 167
237 3300005339 Ga0070660_100281558 Ga0070660_1002815582 167
238 3300005347 Ga0070668_100000007 Ga0070668_100000007106 167
239 3300005355 Ga0070671_100016182 Ga0070671_1000161825 167
240 3300005366 Ga0070659_100194804 Ga0070659_1001948042 167
241 3300005548 Ga0070665_100069646 Ga0070665_1000696463 167
242 3300005563 Ga0068855_100301097 Ga0068855_1003010972 167
243 3300005841 Ga0068863_100000027 Ga0068863_10000002722 167
244 3300005842 Ga0068858_100597705 Ga0068858_1005977052 167
245 3300005844 Ga0068862_100031234 Ga0068862_1000312342 167
246 3300009553 Ga0105249_10002539 Ga0105249_1000253910 167
247 3300025254 Ga0209148_1000867 Ga0209148_100086721 167
248 3300025272 Ga0209455_1000599 Ga0209455_10005998 167
249 3300025904 Ga0207647_10049825 Ga0207647_100498253 167
250 3300025909 Ga0207705_10008707 Ga0207705_100087076 167
251 3300025919 Ga0207657_10073445 Ga0207657_100734452 167
252 3300025925 Ga0207650_10337699 Ga0207650_103376992 167
253 3300025931 Ga0207644_10000111 Ga0207644_1000011163 167
254 3300025931 Ga0207644_10114231 Ga0207644_101142312 167
255 3300025932 Ga0207690_10162291 Ga0207690_101622912 167
256 3300025949 Ga0207667_10536469 Ga0207667_105364692 167
257 3300025961 Ga0207712_10505275 Ga0207712_105052752 167
258 3300025972 Ga0207668_10000054 Ga0207668_1000005479 167
259 3300026035 Ga0207703_10744200 Ga0207703_107442002 167
260 3300026088 Ga0207641_10000045 Ga0207641_10000045153 167
261 3300028379 Ga0268266_10032027 Ga0268266_100320274 167
262 3300028380 Ga0268265_10065726 Ga0268265_100657262 167
263 3300028381 Ga0268264_10063611 Ga0268264_100636113 167
264 3300047472 Ga0495686_0003763 Ga0495686_0003763_10269_10775 167
265 3300047472 Ga0495686_0006588 Ga0495686_0006588_6382_6888 167
266 3300053136 Ga0500559_0022972 Ga0500559_0022972_971_1477 167
267 3300002741 JGI25157J39369_1023103 JGI25157J39369_10231032 168
268 3300002772 JGI25164J39214_1011644 JGI25164J39214_10116442 168
269 3300003214 JGI25165J46597_1000350 JGI25165J46597_100035028 168
270 3300005614 Ga0068856_100257615 Ga0068856_1002576152 168
271 3300009093 Ga0105240_10263231 Ga0105240_102632312 168
272 3300013104 Ga0157370_10000140 Ga0157370_1000014069 168
273 3300013105 Ga0157369_10039174 Ga0157369_100391742 168
274 3300025231 Ga0207427_100635 Ga0207427_10063515 168
275 3300025250 Ga0209026_1007027 Ga0209026_10070272 168
276 3300025261 Ga0209233_1000319 Ga0209233_100031927 168
277 3300025913 Ga0207695_10095072 Ga0207695_100950722 168
278 3300026078 Ga0207702_10220782 Ga0207702_102207822 168
279 3300035112 Ga0373932_0014778 Ga0373932_0014778_709_1215 168
280 3300035691 Ga0373931_0272751 Ga0373931_0272751_316_822 168
281 3300037312 Ga0395899_0000730 Ga0395899_0000730_1977_2483 168
282 3300037418 Ga0395900_0132024 Ga0395900_0132024_1878_2384 168
283 3300037418 Ga0395900_0196167 Ga0395900_0196167_700_1206 168
284 3300037466 Ga0395898_0933928 Ga0395898_0933928_94_600 168
285 3300037466 Ga0395898_1436128 Ga0395898_1436128_63_569 168
286 3300037471 Ga0395905_0378107 Ga0395905_0378107_21_527 168
287 3300001990 JGI24737J22298_10002757 JGI24737J22298_100027575 169
288 3300001990 JGI24737J22298_10005238 JGI24737J22298_100052384 169
289 3300002067 JGI24735J21928_10000375 JGI24735J21928_1000037514 169
290 3300005327 Ga0070658_10014281 Ga0070658_100142817 169
291 3300005328 Ga0070676_10004604 Ga0070676_100046044 169
292 3300005328 Ga0070676_10081762 Ga0070676_100817622 169
293 3300005334 Ga0068869_100001299 Ga0068869_1000012996 169
294 3300005338 Ga0068868_100001207 Ga0068868_1000012078 169
295 3300005339 Ga0070660_100001901 Ga0070660_1000019015 169
296 3300005339 Ga0070660_100032282 Ga0070660_1000322822 169
297 3300005339 Ga0070660_100072144 Ga0070660_1000721442 169
298 3300005347 Ga0070668_100001305 Ga0070668_10000130518 169
299 3300005354 Ga0070675_100215903 Ga0070675_1002159032 169
300 3300005355 Ga0070671_100004606 Ga0070671_10000460610 169
301 3300005355 Ga0070671_100868902 Ga0070671_1008689022 169
302 3300005364 Ga0070673_100000029 Ga0070673_10000002960 169
303 3300005366 Ga0070659_100229617 Ga0070659_1002296172 169
304 3300005456 Ga0070678_100061165 Ga0070678_1000611653 169
305 3300005459 Ga0068867_100000044 Ga0068867_10000004417 169
306 3300005543 Ga0070672_100149653 Ga0070672_1001496532 169
307 3300005543 Ga0070672_100481867 Ga0070672_1004818672 169
308 3300005547 Ga0070693_100024200 Ga0070693_1000242002 169
309 3300005548 Ga0070665_100000079 Ga0070665_100000079149 169
310 3300005614 Ga0068856_100641068 Ga0068856_1006410682 169
311 3300005614 Ga0068856_100937487 Ga0068856_1009374872 169
312 3300005616 Ga0068852_100001909 Ga0068852_1000019095 169
313 3300005718 Ga0068866_10176219 Ga0068866_101762192 169
314 3300006353 Ga0075370_10157463 Ga0075370_101574632 169
315 3300006881 Ga0068865_100000405 Ga0068865_10000040516 169
316 3300009093 Ga0105240_10789122 Ga0105240_107891222 169
317 3300009098 Ga0105245_10004355 Ga0105245_100043554 169
318 3300009148 Ga0105243_10000267 Ga0105243_1000026717 169
319 3300009176 Ga0105242_10003607 Ga0105242_1000360713 169
320 3300009553 Ga0105249_10167332 Ga0105249_101673322 169
321 3300011119 Ga0105246_10001740 Ga0105246_100017402 169
322 3300013102 Ga0157371_10402985 Ga0157371_104029852 169
323 3300013102 Ga0157371_10644126 Ga0157371_106441262 169
324 3300013104 Ga0157370_10344192 Ga0157370_103441923 169
325 3300013296 Ga0157374_10002642 Ga0157374_1000264210 169
326 3300013297 Ga0157378_10003125 Ga0157378_100031257 169
327 3300013306 Ga0163162_11187945 Ga0163162_111879452 169
328 3300013307 Ga0157372_10069573 Ga0157372_100695734 169
329 3300013308 Ga0157375_10007514 Ga0157375_100075147 169
330 3300014745 Ga0157377_10033833 Ga0157377_100338332 169
331 3300014969 Ga0157376_10000595 Ga0157376_1000059517 169
332 3300017792 Ga0163161_10031491 Ga0163161_100314912 169
333 3300025254 Ga0209148_1000114 Ga0209148_1000114125 169
334 3300025272 Ga0209455_1011083 Ga0209455_10110832 169
335 3300025735 Ga0207713_1000673 Ga0207713_10006739 169
336 3300025899 Ga0207642_10144368 Ga0207642_101443682 169
337 3300025900 Ga0207710_10112457 Ga0207710_101124572 169
338 3300025901 Ga0207688_10264473 Ga0207688_102644732 169
339 3300025904 Ga0207647_10001049 Ga0207647_100010492 169
340 3300025904 Ga0207647_10047839 Ga0207647_100478393 169
341 3300025907 Ga0207645_10002995 Ga0207645_1000299512 169
342 3300025909 Ga0207705_10000014 Ga0207705_1000001419 169
343 3300025909 Ga0207705_10000583 Ga0207705_1000058310 169
344 3300025914 Ga0207671_10056309 Ga0207671_100563092 169
345 3300025919 Ga0207657_10011544 Ga0207657_100115446 169
346 3300025919 Ga0207657_10019472 Ga0207657_100194722 169
347 3300025919 Ga0207657_10048240 Ga0207657_100482404 169
348 3300025919 Ga0207657_10093522 Ga0207657_100935222 169
349 3300025923 Ga0207681_10000261 Ga0207681_1000026127 169
350 3300025925 Ga0207650_10015162 Ga0207650_100151622 169
351 3300025927 Ga0207687_10014408 Ga0207687_100144082 169
352 3300025931 Ga0207644_10192467 Ga0207644_101924672 169
353 3300025932 Ga0207690_10135992 Ga0207690_101359922 169
354 3300025932 Ga0207690_10145954 Ga0207690_101459542 169
355 3300025932 Ga0207690_10451606 Ga0207690_104516062 169
356 3300025933 Ga0207706_10056056 Ga0207706_100560565 169
357 3300025934 Ga0207686_10001120 Ga0207686_1000112016 169
358 3300025935 Ga0207709_10001754 Ga0207709_100017545 169
359 3300025937 Ga0207669_10111718 Ga0207669_101117182 169
360 3300025938 Ga0207704_10000002 Ga0207704_10000002235 169
361 3300025940 Ga0207691_10116756 Ga0207691_101167563 169
362 3300025940 Ga0207691_10421166 Ga0207691_104211662 169
363 3300025941 Ga0207711_10005137 Ga0207711_100051372 169
364 3300025942 Ga0207689_10003341 Ga0207689_100033419 169
365 3300025949 Ga0207667_10027645 Ga0207667_100276455 169
366 3300025960 Ga0207651_10000023 Ga0207651_1000002316 169
367 3300026023 Ga0207677_10000168 Ga0207677_1000016814 169
368 3300026041 Ga0207639_10343678 Ga0207639_103436782 169
369 3300026041 Ga0207639_11425977 Ga0207639_114259772 169
370 3300026067 Ga0207678_10746191 Ga0207678_107461912 169
371 3300026078 Ga0207702_10008154 Ga0207702_100081544 169
372 3300026078 Ga0207702_10276529 Ga0207702_102765292 169
373 3300026089 Ga0207648_10000120 Ga0207648_1000012060 169
374 3300026116 Ga0207674_10015972 Ga0207674_100159727 169
375 3300026121 Ga0207683_10078323 Ga0207683_100783232 169
376 3300026142 Ga0207698_10004199 Ga0207698_100041992 169
377 3300028379 Ga0268266_10000175 Ga0268266_100001759 169
378 3300028381 Ga0268264_10334712 Ga0268264_103347122 169
379 3300041452 Ga0451793_0561142 Ga0451793_0561142_86_595 169
380 3300041459 Ga0451800_1552524 Ga0451800_1552524_1041_1550 169
381 3300041460 Ga0451802_0082328 Ga0451802_0082328_1497_2006 169
382 3300041462 Ga0451806_036250 Ga0451806_036250_413_922 169
383 3300042005 Ga0439448_0001093 Ga0439448_0001093_2171_2680 169
384 3300042157 Ga0439458_0000368 Ga0439458_0000368_3835_4344 169
385 3300044683 Ga0466965_0014812 Ga0466965_0014812_2230_2739 169
386 3300044684 Ga0466966_0395534 Ga0466966_0395534_187_696 169
387 3300044693 Ga0466961_0008751 Ga0466961_0008751_3649_4158 169
388 3300044693 Ga0466961_0217487 Ga0466961_0217487_477_986 169
389 3300044694 Ga0466963_0004926 Ga0466963_0004926_2105_2614 169
390 3300044706 Ga0466964_0034449 Ga0466964_0034449_640_1149 169
391 3300044706 Ga0466964_0042035 Ga0466964_0042035_43_552 169
392 3300044719 Ga0466971_0003710 Ga0466971_0003710_4079_4588 169
393 3300044719 Ga0466971_0056132 Ga0466971_0056132_106_615 169
394 3300044735 Ga0466968_0004036 Ga0466968_0004036_1132_1641 169
395 3300044735 Ga0466968_0435826 Ga0466968_0435826_56_565 169
396 3300044765 Ga0466970_0029400 Ga0466970_0029400_1298_1807 169
397 3300044842 Ga0466957_0029141 Ga0466957_0029141_702_1211 169
398 3300045049 Ga0466959_0039310 Ga0466959_0039310_2536_3045 169
399 3300045836 Ga0466958_0003930 Ga0466958_0003930_5483_5992 169
400 3300045836 Ga0466958_0056184 Ga0466958_0056184_153_662 169
401 3300045976 Ga0466967_0010112 Ga0466967_0010112_2175_2684 169
402 3300045976 Ga0466967_0261982 Ga0466967_0261982_106_615 169
403 3300048916 Ga0496113_0965518 Ga0496113_0965518_79_588 169
404 3300048920 Ga0496117_0008571 Ga0496117_0008571_7594_8103 169
405 3300048921 Ga0496118_0011266 Ga0496118_0011266_827_1336 169
406 3300048921 Ga0496118_0047653 Ga0496118_0047653_717_1226 169
407 3300048922 Ga0496119_0022403 Ga0496119_0022403_2297_2806 169
408 3300048923 Ga0496120_0015483 Ga0496120_0015483_2353_2862 169
409 3300048923 Ga0496120_0089600 Ga0496120_0089600_126_635 169
410 3300048924 Ga0496121_0007252 Ga0496121_0007252_1773_2282 169
411 3300048924 Ga0496121_0028884 Ga0496121_0028884_4081_4590 169
412 3300048925 Ga0496122_0043107 Ga0496122_0043107_1792_2301 169
413 3300048926 Ga0496123_0005045 Ga0496123_0005045_2228_2737 169
414 3300048927 Ga0496124_0099729 Ga0496124_0099729_293_802 169
415 3300048928 Ga0496125_0162377 Ga0496125_0162377_816_1325 169
416 3300048929 Ga0496126_0442133 Ga0496126_0442133_265_774 169
417 3300050489 nmdc:mga03683_74173_c1 nmdc:mga03683_74173_c1_304_813 169
418 3300050493 nmdc:mga0k408_73927_c1 nmdc:mga0k408_73927_c1_241_750 169
419 3300061719 Ga0466962_0001969 Ga0466962_0001969_2391_2900 169
420 3300061719 Ga0466962_0176130 Ga0466962_0176130_270_779 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04390

LptE

Lipopolysaccharide-assembly

71

191

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kwy-assembly2.cif.gz_B crystal structure of a putative lipoprotein (cc_3750) from caulobacter crescentus cb15 at 2.40 a resolution 0.8616 32 163
4kwy-assembly2.cif.gz_B crystal structure of a putative lipoprotein (cc_3750) from caulobacter crescentus cb15 at 2.40 a resolution 0.8433 32 163
4kwy-assembly1.cif.gz_A crystal structure of a putative lipoprotein (cc_3750) from caulobacter crescentus cb15 at 2.40 a resolution 0.8431 32 165
4kwy-assembly1.cif.gz_A crystal structure of a putative lipoprotein (cc_3750) from caulobacter crescentus cb15 at 2.40 a resolution 0.8202 32 165
5tse-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8007 41 164
ID Description Score Start End Superfamily
4kwyB00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain 0.8169 32 163 3.30.160.150
5tseB00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain 0.8007 41 164 3.30.160.150
4kwyB00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain 0.7994 32 163 3.30.160.150
3bf2A00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain 0.7417 41 163 3.30.160.150
5tseB00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain 0.7293 41 164 3.30.160.150
ID Description Score Start End GO Terms
AF-A0A350KZ18-F1-model_v4 deleted 0.9806 71 165
AF-A0A3B9K392-F1-model_v4 Lipoprotein 0.9454 34 165
AF-A0A1F2YM04-F1-model_v4 LPS-assembly lipoprotein 0.944 35 167 GO:0019867
GO:0043165
AF-A0A2S6U8S6-F1-model_v4 Uncharacterized protein 0.9426 38 161 GO:0019867
GO:0043165
AF-A0A840YZX4-F1-model_v4 LPS-assembly lipoprotein 0.9355 19 165 GO:0019867
GO:0043165

Feature Viewer

pLDDT pTM Quality
82.12 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map