F439705
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 420 | 232 | 420 | 168 |
Family's Representative Sequence
| Representative Sequence | 3300005546|Ga0070696_100189979|Ga0070696_1001899792 |
| Length | 202 |
| Sequence | MRNDRPTSVRPELVEGPSFLRAVRKNRAGLRQAQPERFGVVATLSLSLLLAGCGLQPLYSGGGKGPVAQSLRSVAVAPIEGRSGWLVRTALEDRLGVPAAGGARYRLEVLLDDDITGFGIRSDDAVTRERRTLRARYRLVDAARGTVLLDATAGSDAGIDVVGSEYATVAAEQTALERLSKEVADQIVTRIALYARRSGSRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 4 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 77 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 78 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 80 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 135 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 137 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 138 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 139 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 140 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 141 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 142 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 143 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 144 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 145 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 146 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 148 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 149 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 151 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 152 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 153 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 154 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 155 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 156 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 157 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 158 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 159 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 160 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 162 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 163 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 164 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 165 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 166 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 167 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 168 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 169 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 170 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 171 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 172 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 173 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 174 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 175 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 176 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 177 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 178 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 179 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 180 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 194 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 195 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 196 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 197 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 198 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 199 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 200 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 201 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 202 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 203 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 204 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 210 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 211 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 212 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 213 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 214 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 215 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 217 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 218 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 219 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 221 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 222 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 223 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 224 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 225 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 226 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 227 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 228 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 229 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 230 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 231 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 232 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.29 |
| Metatranscriptomes | 0.71 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.48 |
| Nodule | 0 |
| Rhizoplane | 1.19 |
| Rhizosphere | 85.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10002757 | 3300001990 | Bacteria | 6215 |
| 2 | JGI24737J22298_10005238 | 3300001990 | Bacteria | 4489 |
| 3 | JGI24735J21928_10000375 | 3300002067 | Bacteria | 15639 |
| 4 | JGI25157J39369_1023103 | 3300002741 | Bacteria | 732 |
| 5 | JGI25164J39214_1011644 | 3300002772 | Bacteria | 840 |
| 6 | JGI25165J46597_1000350 | 3300003214 | Bacteria | 52046 |
| 7 | Ga0065704_10075953 | 3300005289 | Bacteria | 5338 |
| 8 | Ga0070658_10006307 | 3300005327 | Bacteria | 9607 |
| 9 | Ga0070658_10014281 | 3300005327 | Bacteria | 6373 |
| 10 | Ga0070676_10004604 | 3300005328 | Bacteria | 7274 |
| 11 | Ga0070676_10081762 | 3300005328 | Bacteria | 1961 |
| 12 | Ga0070670_100001565 | 3300005331 | Bacteria | 18443 |
| 13 | Ga0070670_100024630 | 3300005331 | Bacteria | 5175 |
| 14 | Ga0070677_10000160 | 3300005333 | Bacteria | 22947 |
| 15 | Ga0068869_100001299 | 3300005334 | Bacteria | 14779 |
| 16 | Ga0070680_100000642 | 3300005336 | Bacteria | 24330 |
| 17 | Ga0070682_100230256 | 3300005337 | Bacteria | 1324 |
| 18 | Ga0068868_100000032 | 3300005338 | Bacteria | 75803 |
| 19 | Ga0068868_100001207 | 3300005338 | Bacteria | 17740 |
| 20 | Ga0070660_100001901 | 3300005339 | Bacteria | 14387 |
| 21 | Ga0070660_100003184 | 3300005339 | Bacteria | 11277 |
| 22 | Ga0070660_100004877 | 3300005339 | Bacteria | 9271 |
| 23 | Ga0070660_100032282 | 3300005339 | Bacteria | 3939 |
| 24 | Ga0070660_100072144 | 3300005339 | Bacteria | 2697 |
| 25 | Ga0070660_100281558 | 3300005339 | Bacteria | 1361 |
| 26 | Ga0070661_100000003 | 3300005344 | Bacteria | 254653 |
| 27 | Ga0070668_100000001 | 3300005347 | Bacteria | 275905 |
| 28 | Ga0070668_100000007 | 3300005347 | Bacteria | 150621 |
| 29 | Ga0070668_100001305 | 3300005347 | Bacteria | 17832 |
| 30 | Ga0070669_100020675 | 3300005353 | Bacteria | 4702 |
| 31 | Ga0070669_100112106 | 3300005353 | Bacteria | 2071 |
| 32 | Ga0070669_100165677 | 3300005353 | Bacteria | 1720 |
| 33 | Ga0070675_100215903 | 3300005354 | Bacteria | 1669 |
| 34 | Ga0070675_101001603 | 3300005354 | Bacteria | 767 |
| 35 | Ga0070675_101289986 | 3300005354 | Bacteria | 673 |
| 36 | Ga0070671_100000046 | 3300005355 | Bacteria | 84967 |
| 37 | Ga0070671_100004606 | 3300005355 | Bacteria | 10934 |
| 38 | Ga0070671_100016182 | 3300005355 | Bacteria | 6031 |
| 39 | Ga0070671_100868902 | 3300005355 | Bacteria | 787 |
| 40 | Ga0070671_101261138 | 3300005355 | Bacteria | 651 |
| 41 | Ga0070674_100117701 | 3300005356 | Bacteria | 1962 |
| 42 | Ga0070673_100000029 | 3300005364 | Bacteria | 64228 |
| 43 | Ga0070659_100000005 | 3300005366 | Bacteria | 259902 |
| 44 | Ga0070659_100194804 | 3300005366 | Bacteria | 1667 |
| 45 | Ga0070659_100229617 | 3300005366 | Bacteria | 1533 |
| 46 | Ga0070667_100029219 | 3300005367 | Bacteria | 4592 |
| 47 | Ga0070705_100787460 | 3300005440 | Bacteria | 755 |
| 48 | Ga0070678_100061165 | 3300005456 | Bacteria | 2775 |
| 49 | Ga0070681_10044787 | 3300005458 | Bacteria | 4430 |
| 50 | Ga0068867_100000044 | 3300005459 | Bacteria | 76426 |
| 51 | Ga0070685_10842395 | 3300005466 | Bacteria | 679 |
| 52 | Ga0070679_100000001 | 3300005530 | Bacteria | 764811 |
| 53 | Ga0068853_100028934 | 3300005539 | Bacteria | 4664 |
| 54 | Ga0068853_100248059 | 3300005539 | Bacteria | 1633 |
| 55 | Ga0070672_100149653 | 3300005543 | Bacteria | 1930 |
| 56 | Ga0070672_100481867 | 3300005543 | Bacteria | 1071 |
| 57 | Ga0070672_100612225 | 3300005543 | Bacteria | 949 |
| 58 | Ga0070686_100493122 | 3300005544 | Bacteria | 949 |
| 59 | Ga0070696_100189979 | 3300005546 | Bacteria | 1528 |
| 60 | Ga0070696_100822245 | 3300005546 | Bacteria | 766 |
| 61 | Ga0070693_100024200 | 3300005547 | Bacteria | 3254 |
| 62 | Ga0070665_100000079 | 3300005548 | Bacteria | 186925 |
| 63 | Ga0070665_100004425 | 3300005548 | Bacteria | 14760 |
| 64 | Ga0070665_100069646 | 3300005548 | Bacteria | 3526 |
| 65 | Ga0070665_100304304 | 3300005548 | Bacteria | 1597 |
| 66 | Ga0070665_100505231 | 3300005548 | Bacteria | 1220 |
| 67 | Ga0068855_100301097 | 3300005563 | Bacteria | 1776 |
| 68 | Ga0068857_100249422 | 3300005577 | Bacteria | 1627 |
| 69 | Ga0068854_100588075 | 3300005578 | Bacteria | 949 |
| 70 | Ga0068856_100257615 | 3300005614 | Bacteria | 1760 |
| 71 | Ga0068856_100641068 | 3300005614 | Bacteria | 1083 |
| 72 | Ga0068856_100937487 | 3300005614 | Bacteria | 884 |
| 73 | Ga0068852_100001909 | 3300005616 | Bacteria | 14186 |
| 74 | Ga0068859_101717426 | 3300005617 | Bacteria | 693 |
| 75 | Ga0068866_10176219 | 3300005718 | Bacteria | 1259 |
| 76 | Ga0068861_100039323 | 3300005719 | Bacteria | 3529 |
| 77 | Ga0068863_100000027 | 3300005841 | Bacteria | 181884 |
| 78 | Ga0068863_100014434 | 3300005841 | Bacteria | 7609 |
| 79 | Ga0068863_100034345 | 3300005841 | Bacteria | 4832 |
| 80 | Ga0068858_100077187 | 3300005842 | Bacteria | 3094 |
| 81 | Ga0068858_100597705 | 3300005842 | Bacteria | 1070 |
| 82 | Ga0068860_100014907 | 3300005843 | Bacteria | 7600 |
| 83 | Ga0068860_100023451 | 3300005843 | Bacteria | 5963 |
| 84 | Ga0068862_100000898 | 3300005844 | Bacteria | 28838 |
| 85 | Ga0068862_100009303 | 3300005844 | Bacteria | 8134 |
| 86 | Ga0068862_100031234 | 3300005844 | Bacteria | 4494 |
| 87 | Ga0075370_10157463 | 3300006353 | Bacteria | 1332 |
| 88 | Ga0068865_100000405 | 3300006881 | Bacteria | 24003 |
| 89 | Ga0097620_101716738 | 3300006931 | Bacteria | 693 |
| 90 | Ga0075435_100263344 | 3300007076 | Bacteria | 1469 |
| 91 | Ga0105251_10002745 | 3300009011 | Bacteria | 13482 |
| 92 | Ga0105240_10263231 | 3300009093 | Bacteria | 1988 |
| 93 | Ga0105240_10789122 | 3300009093 | Bacteria | 1030 |
| 94 | Ga0105245_10004355 | 3300009098 | Bacteria | 12530 |
| 95 | Ga0105245_10466877 | 3300009098 | Bacteria | 1273 |
| 96 | Ga0105247_10239818 | 3300009101 | Bacteria | 1235 |
| 97 | Ga0105243_10000267 | 3300009148 | Bacteria | 58724 |
| 98 | Ga0105242_10003607 | 3300009176 | Bacteria | 12039 |
| 99 | Ga0105248_10222552 | 3300009177 | Bacteria | 2125 |
| 100 | Ga0105249_10002539 | 3300009553 | Bacteria | 15800 |
| 101 | Ga0105249_10076063 | 3300009553 | Bacteria | 3111 |
| 102 | Ga0105249_10167332 | 3300009553 | Bacteria | 2129 |
| 103 | Ga0105249_10984754 | 3300009553 | Bacteria | 912 |
| 104 | Ga0105246_10001740 | 3300011119 | Bacteria | 13020 |
| 105 | Ga0157371_10402985 | 3300013102 | Bacteria | 1001 |
| 106 | Ga0157371_10644126 | 3300013102 | Bacteria | 790 |
| 107 | Ga0157370_10000140 | 3300013104 | Bacteria | 87498 |
| 108 | Ga0157370_10125999 | 3300013104 | Bacteria | 2390 |
| 109 | Ga0157370_10344192 | 3300013104 | Bacteria | 1374 |
| 110 | Ga0157369_10039174 | 3300013105 | Bacteria | 5180 |
| 111 | Ga0157374_10002642 | 3300013296 | Bacteria | 15099 |
| 112 | Ga0157378_10003125 | 3300013297 | Bacteria | 14717 |
| 113 | Ga0163162_10782734 | 3300013306 | Bacteria | 1072 |
| 114 | Ga0163162_11187945 | 3300013306 | Bacteria | 865 |
| 115 | Ga0157372_10069573 | 3300013307 | Bacteria | 3958 |
| 116 | Ga0157372_11897138 | 3300013307 | Bacteria | 685 |
| 117 | Ga0157375_10007514 | 3300013308 | Bacteria | 9530 |
| 118 | Ga0157375_10035932 | 3300013308 | Bacteria | 4733 |
| 119 | Ga0157375_11679993 | 3300013308 | Bacteria | 752 |
| 120 | Ga0163163_10591136 | 3300014325 | Bacteria | 1173 |
| 121 | Ga0157377_10033833 | 3300014745 | Bacteria | 2792 |
| 122 | Ga0157376_10000595 | 3300014969 | Bacteria | 23367 |
| 123 | Ga0163161_10031491 | 3300017792 | Bacteria | 3779 |
| 124 | Ga0206354_10726863 | 3300020081 | Bacteria | 4596 |
| 125 | Ga0206353_11331210 | 3300020082 | Bacteria | 7970 |
| 126 | Ga0213873_10000016 | 3300021358 | Bacteria | 124829 |
| 127 | Ga0213876_10000056 | 3300021384 | Bacteria | 135017 |
| 128 | Ga0213876_10000258 | 3300021384 | Bacteria | 49441 |
| 129 | Ga0207427_100635 | 3300025231 | Bacteria | 17043 |
| 130 | Ga0209026_1007027 | 3300025250 | Bacteria | 2622 |
| 131 | Ga0209148_1000114 | 3300025254 | Bacteria | 192073 |
| 132 | Ga0209148_1000867 | 3300025254 | Bacteria | 21151 |
| 133 | Ga0209233_1000319 | 3300025261 | Bacteria | 52404 |
| 134 | Ga0209455_1000599 | 3300025272 | Bacteria | 23019 |
| 135 | Ga0209455_1011083 | 3300025272 | Bacteria | 2243 |
| 136 | Ga0207713_1000673 | 3300025735 | Bacteria | 32203 |
| 137 | Ga0207682_10000258 | 3300025893 | Bacteria | 23899 |
| 138 | Ga0207642_10144368 | 3300025899 | Bacteria | 1259 |
| 139 | Ga0207710_10112457 | 3300025900 | Bacteria | 1294 |
| 140 | Ga0207688_10264473 | 3300025901 | Bacteria | 1045 |
| 141 | Ga0207647_10001049 | 3300025904 | Bacteria | 21361 |
| 142 | Ga0207647_10047839 | 3300025904 | Bacteria | 2658 |
| 143 | Ga0207647_10049825 | 3300025904 | Bacteria | 2596 |
| 144 | Ga0207645_10002995 | 3300025907 | Bacteria | 13047 |
| 145 | Ga0207645_10712832 | 3300025907 | Bacteria | 682 |
| 146 | Ga0207705_10000014 | 3300025909 | Bacteria | 434286 |
| 147 | Ga0207705_10000583 | 3300025909 | Bacteria | 30635 |
| 148 | Ga0207705_10008707 | 3300025909 | Bacteria | 7395 |
| 149 | Ga0207707_10020047 | 3300025912 | Bacteria | 5834 |
| 150 | Ga0207695_10095072 | 3300025913 | Bacteria | 2985 |
| 151 | Ga0207671_10056309 | 3300025914 | Bacteria | 2913 |
| 152 | Ga0207660_10001365 | 3300025917 | Bacteria | 16351 |
| 153 | Ga0207657_10001518 | 3300025919 | Bacteria | 24871 |
| 154 | Ga0207657_10005887 | 3300025919 | Bacteria | 12766 |
| 155 | Ga0207657_10011544 | 3300025919 | Bacteria | 8769 |
| 156 | Ga0207657_10019472 | 3300025919 | Bacteria | 6443 |
| 157 | Ga0207657_10048240 | 3300025919 | Bacteria | 3719 |
| 158 | Ga0207657_10073445 | 3300025919 | Bacteria | 2890 |
| 159 | Ga0207657_10093522 | 3300025919 | Bacteria | 2504 |
| 160 | Ga0207649_10000016 | 3300025920 | Bacteria | 243843 |
| 161 | Ga0207652_10000002 | 3300025921 | Bacteria | 878035 |
| 162 | Ga0207681_10000261 | 3300025923 | Bacteria | 40384 |
| 163 | Ga0207681_10004717 | 3300025923 | Bacteria | 8387 |
| 164 | Ga0207681_10105317 | 3300025923 | Bacteria | 2042 |
| 165 | Ga0207681_10219326 | 3300025923 | Bacteria | 1471 |
| 166 | Ga0207681_10245714 | 3300025923 | Bacteria | 1395 |
| 167 | Ga0207681_11295455 | 3300025923 | Bacteria | 612 |
| 168 | Ga0207650_10015162 | 3300025925 | Bacteria | 5363 |
| 169 | Ga0207650_10337699 | 3300025925 | Bacteria | 1237 |
| 170 | Ga0207659_10130592 | 3300025926 | Bacteria | 1938 |
| 171 | Ga0207659_10698481 | 3300025926 | Bacteria | 868 |
| 172 | Ga0207687_10014408 | 3300025927 | Bacteria | 5173 |
| 173 | Ga0207644_10000111 | 3300025931 | Bacteria | 60737 |
| 174 | Ga0207644_10001037 | 3300025931 | Bacteria | 17807 |
| 175 | Ga0207644_10114231 | 3300025931 | Bacteria | 2046 |
| 176 | Ga0207644_10192467 | 3300025931 | Bacteria | 1604 |
| 177 | Ga0207644_10477912 | 3300025931 | Bacteria | 1026 |
| 178 | Ga0207690_10000020 | 3300025932 | Bacteria | 218439 |
| 179 | Ga0207690_10135992 | 3300025932 | Bacteria | 1805 |
| 180 | Ga0207690_10145954 | 3300025932 | Bacteria | 1749 |
| 181 | Ga0207690_10162291 | 3300025932 | Bacteria | 1667 |
| 182 | Ga0207690_10451606 | 3300025932 | Bacteria | 1033 |
| 183 | Ga0207706_10056056 | 3300025933 | Bacteria | 3475 |
| 184 | Ga0207686_10001120 | 3300025934 | Bacteria | 15512 |
| 185 | Ga0207709_10001754 | 3300025935 | Bacteria | 14597 |
| 186 | Ga0207669_10111718 | 3300025937 | Bacteria | 1833 |
| 187 | Ga0207669_10296785 | 3300025937 | Bacteria | 1226 |
| 188 | Ga0207669_10465464 | 3300025937 | Bacteria | 1005 |
| 189 | Ga0207669_10846837 | 3300025937 | Bacteria | 761 |
| 190 | Ga0207704_10000002 | 3300025938 | Bacteria | 303025 |
| 191 | Ga0207691_10116756 | 3300025940 | Bacteria | 2368 |
| 192 | Ga0207691_10421166 | 3300025940 | Bacteria | 1138 |
| 193 | Ga0207691_10548526 | 3300025940 | Bacteria | 980 |
| 194 | Ga0207711_10005137 | 3300025941 | Bacteria | 11096 |
| 195 | Ga0207689_10003341 | 3300025942 | Bacteria | 14700 |
| 196 | Ga0207661_10674204 | 3300025944 | Bacteria | 951 |
| 197 | Ga0207667_10027645 | 3300025949 | Bacteria | 6170 |
| 198 | Ga0207667_10536469 | 3300025949 | Bacteria | 1184 |
| 199 | Ga0207651_10000023 | 3300025960 | Bacteria | 76488 |
| 200 | Ga0207712_10146108 | 3300025961 | Bacteria | 1820 |
| 201 | Ga0207712_10505275 | 3300025961 | Bacteria | 1034 |
| 202 | Ga0207668_10000009 | 3300025972 | Bacteria | 188071 |
| 203 | Ga0207668_10000054 | 3300025972 | Bacteria | 95426 |
| 204 | Ga0207668_10004544 | 3300025972 | Bacteria | 8164 |
| 205 | Ga0207640_10059555 | 3300025981 | Bacteria | 2520 |
| 206 | Ga0207677_10000100 | 3300026023 | Bacteria | 70908 |
| 207 | Ga0207677_10000168 | 3300026023 | Bacteria | 52215 |
| 208 | Ga0207703_10744200 | 3300026035 | Bacteria | 934 |
| 209 | Ga0207639_10343678 | 3300026041 | Bacteria | 1331 |
| 210 | Ga0207639_10348757 | 3300026041 | Bacteria | 1321 |
| 211 | Ga0207639_11425977 | 3300026041 | Bacteria | 650 |
| 212 | Ga0207678_10746191 | 3300026067 | Bacteria | 863 |
| 213 | Ga0207708_10203693 | 3300026075 | Bacteria | 1579 |
| 214 | Ga0207702_10008154 | 3300026078 | Bacteria | 8860 |
| 215 | Ga0207702_10220782 | 3300026078 | Bacteria | 1766 |
| 216 | Ga0207702_10276529 | 3300026078 | Bacteria | 1586 |
| 217 | Ga0207702_10786477 | 3300026078 | Bacteria | 940 |
| 218 | Ga0207641_10000045 | 3300026088 | Bacteria | 181882 |
| 219 | Ga0207641_10006245 | 3300026088 | Bacteria | 10080 |
| 220 | Ga0207648_10000120 | 3300026089 | Bacteria | 76384 |
| 221 | Ga0207674_10015972 | 3300026116 | Bacteria | 8225 |
| 222 | Ga0207674_10084798 | 3300026116 | Bacteria | 3165 |
| 223 | Ga0207674_10826222 | 3300026116 | Bacteria | 894 |
| 224 | Ga0207675_100006332 | 3300026118 | Bacteria | 11222 |
| 225 | Ga0207683_10078323 | 3300026121 | Bacteria | 2929 |
| 226 | Ga0207698_10004199 | 3300026142 | Bacteria | 8765 |
| 227 | Ga0207698_10180165 | 3300026142 | Bacteria | 1871 |
| 228 | Ga0268266_10000130 | 3300028379 | Bacteria | 147912 |
| 229 | Ga0268266_10000175 | 3300028379 | Bacteria | 115897 |
| 230 | Ga0268266_10003755 | 3300028379 | Bacteria | 14909 |
| 231 | Ga0268266_10032027 | 3300028379 | Bacteria | 4467 |
| 232 | Ga0268266_10345937 | 3300028379 | Bacteria | 1396 |
| 233 | Ga0268266_10581628 | 3300028379 | Bacteria | 1075 |
| 234 | Ga0268265_10000803 | 3300028380 | Bacteria | 29861 |
| 235 | Ga0268265_10065726 | 3300028380 | Bacteria | 2800 |
| 236 | Ga0268264_10010960 | 3300028381 | Bacteria | 7487 |
| 237 | Ga0268264_10025177 | 3300028381 | Bacteria | 4861 |
| 238 | Ga0268264_10063611 | 3300028381 | Bacteria | 3102 |
| 239 | Ga0268264_10334712 | 3300028381 | Bacteria | 1436 |
| 240 | Ga0265331_10020163 | 3300031250 | Bacteria | 3428 |
| 241 | Ga0307408_100017066 | 3300031548 | Bacteria | 4855 |
| 242 | Ga0307408_100082185 | 3300031548 | Bacteria | 2411 |
| 243 | Ga0307408_100175767 | 3300031548 | Bacteria | 1713 |
| 244 | Ga0307408_100200167 | 3300031548 | Bacteria | 1616 |
| 245 | Ga0307408_100813543 | 3300031548 | Bacteria | 849 |
| 246 | Ga0307405_10092162 | 3300031731 | Bacteria | 2010 |
| 247 | Ga0307405_10099374 | 3300031731 | Bacteria | 1947 |
| 248 | Ga0307405_10185135 | 3300031731 | Unclassified | 1499 |
| 249 | Ga0307405_10585100 | 3300031731 | Bacteria | 908 |
| 250 | Ga0307405_11018214 | 3300031731 | Bacteria | 707 |
| 251 | Ga0307413_10074536 | 3300031824 | Bacteria | 2150 |
| 252 | Ga0307413_11521836 | 3300031824 | Bacteria | 592 |
| 253 | Ga0307410_10006775 | 3300031852 | Bacteria | 6213 |
| 254 | Ga0307410_10093968 | 3300031852 | Bacteria | 2135 |
| 255 | Ga0307410_10389614 | 3300031852 | Bacteria | 1123 |
| 256 | Ga0307410_10438910 | 3300031852 | Bacteria | 1062 |
| 257 | Ga0307410_10601131 | 3300031852 | Bacteria | 917 |
| 258 | Ga0307410_10756565 | 3300031852 | Bacteria | 823 |
| 259 | Ga0307410_11450711 | 3300031852 | Bacteria | 603 |
| 260 | Ga0307406_10059890 | 3300031901 | Bacteria | 2453 |
| 261 | Ga0307406_10213389 | 3300031901 | Bacteria | 1429 |
| 262 | Ga0307407_10010565 | 3300031903 | Bacteria | 4360 |
| 263 | Ga0307407_10042583 | 3300031903 | Bacteria | 2547 |
| 264 | Ga0307407_10190771 | 3300031903 | Bacteria | 1366 |
| 265 | Ga0307407_10386514 | 3300031903 | Bacteria | 1000 |
| 266 | Ga0307407_10798910 | 3300031903 | Bacteria | 718 |
| 267 | Ga0307412_10000454 | 3300031911 | Bacteria | 24665 |
| 268 | Ga0307412_10021885 | 3300031911 | Bacteria | 3911 |
| 269 | Ga0307412_10040123 | 3300031911 | Bacteria | 3027 |
| 270 | Ga0307412_10063286 | 3300031911 | Bacteria | 2495 |
| 271 | Ga0307412_10818251 | 3300031911 | Bacteria | 810 |
| 272 | Ga0307412_11189590 | 3300031911 | Bacteria | 682 |
| 273 | Ga0307409_100064827 | 3300031995 | Bacteria | 2872 |
| 274 | Ga0307409_100097248 | 3300031995 | Bacteria | 2431 |
| 275 | Ga0307409_100197231 | 3300031995 | Bacteria | 1798 |
| 276 | Ga0307409_102381819 | 3300031995 | Bacteria | 558 |
| 277 | Ga0307416_100013683 | 3300032002 | Bacteria | 5524 |
| 278 | Ga0307416_100018856 | 3300032002 | Bacteria | 4875 |
| 279 | Ga0307416_100042324 | 3300032002 | Bacteria | 3554 |
| 280 | Ga0307416_100145103 | 3300032002 | Bacteria | 2165 |
| 281 | Ga0307416_100284376 | 3300032002 | Bacteria | 1633 |
| 282 | Ga0307416_100302820 | 3300032002 | Bacteria | 1590 |
| 283 | Ga0307416_101489335 | 3300032002 | Bacteria | 782 |
| 284 | Ga0307414_10020000 | 3300032004 | Bacteria | 4162 |
| 285 | Ga0307414_10024870 | 3300032004 | Bacteria | 3825 |
| 286 | Ga0307414_10033888 | 3300032004 | Bacteria | 3380 |
| 287 | Ga0307414_10043199 | 3300032004 | Bacteria | 3068 |
| 288 | Ga0307414_10173894 | 3300032004 | Bacteria | 1725 |
| 289 | Ga0307414_10323091 | 3300032004 | Bacteria | 1314 |
| 290 | Ga0307414_10396188 | 3300032004 | Bacteria | 1198 |
| 291 | Ga0307414_10587433 | 3300032004 | Bacteria | 997 |
| 292 | Ga0307414_10659364 | 3300032004 | Bacteria | 944 |
| 293 | Ga0307411_10023693 | 3300032005 | Bacteria | 3642 |
| 294 | Ga0307411_10141928 | 3300032005 | Bacteria | 1772 |
| 295 | Ga0307411_10185144 | 3300032005 | Bacteria | 1584 |
| 296 | Ga0307411_10392717 | 3300032005 | Bacteria | 1144 |
| 297 | Ga0307411_10552855 | 3300032005 | Bacteria | 982 |
| 298 | Ga0307415_100154910 | 3300032126 | Bacteria | 1768 |
| 299 | Ga0307415_100585249 | 3300032126 | Bacteria | 991 |
| 300 | Ga0307415_100612395 | 3300032126 | Bacteria | 971 |
| 301 | Ga0373932_0014778 | 3300035112 | Bacteria | 1969 |
| 302 | Ga0373931_0272751 | 3300035691 | Bacteria | 1036 |
| 303 | Ga0373947_0049928 | 3300035725 | Bacteria | 2514 |
| 304 | Ga0373925_0038509 | 3300037068 | Bacteria | 3536 |
| 305 | Ga0395899_0000730 | 3300037312 | Bacteria | 32812 |
| 306 | Ga0395900_0132024 | 3300037418 | Bacteria | 2559 |
| 307 | Ga0395900_0196167 | 3300037418 | Bacteria | 2045 |
| 308 | Ga0395898_0933928 | 3300037466 | Bacteria | 805 |
| 309 | Ga0395898_1436128 | 3300037466 | Bacteria | 617 |
| 310 | Ga0395905_0378107 | 3300037471 | Bacteria | 1310 |
| 311 | Ga0395905_0664662 | 3300037471 | Bacteria | 944 |
| 312 | Ga0436365_0869628 | 3300039437 | Bacteria | 66366 |
| 313 | Ga0436365_0881241 | 3300039437 | Bacteria | 1056 |
| 314 | Ga0436365_1503647 | 3300039437 | Bacteria | 38811 |
| 315 | Ga0436362_0580304 | 3300039453 | Bacteria | 124869 |
| 316 | Ga0439436_0034554 | 3300041404 | Bacteria | 1462 |
| 317 | Ga0439465_0128915 | 3300041413 | Bacteria | 892 |
| 318 | Ga0451793_0561142 | 3300041452 | Bacteria | 869 |
| 319 | Ga0451800_1552524 | 3300041459 | Unclassified | 1642 |
| 320 | Ga0451802_0082328 | 3300041460 | Bacteria | 3188 |
| 321 | Ga0451806_036250 | 3300041462 | Bacteria | 1831 |
| 322 | Ga0451841_0647617 | 3300041498 | Bacteria | 1541 |
| 323 | Ga0439448_0001093 | 3300042005 | Bacteria | 6818 |
| 324 | Ga0439432_013450 | 3300042006 | Bacteria | 2785 |
| 325 | Ga0439449_0015947 | 3300042007 | Bacteria | 2824 |
| 326 | Ga0450923_084288 | 3300042125 | Bacteria | 718 |
| 327 | Ga0439458_0000368 | 3300042157 | Bacteria | 11329 |
| 328 | Ga0466965_0014812 | 3300044683 | Bacteria | 3695 |
| 329 | Ga0466966_0395534 | 3300044684 | Bacteria | 830 |
| 330 | Ga0466961_0008751 | 3300044693 | Bacteria | 6455 |
| 331 | Ga0466961_0217487 | 3300044693 | Bacteria | 1178 |
| 332 | Ga0466963_0004926 | 3300044694 | Bacteria | 7788 |
| 333 | Ga0466963_0868853 | 3300044694 | Bacteria | 636 |
| 334 | Ga0466964_0034449 | 3300044706 | Bacteria | 2021 |
| 335 | Ga0466964_0042035 | 3300044706 | Bacteria | 1851 |
| 336 | Ga0466971_0003710 | 3300044719 | Bacteria | 6533 |
| 337 | Ga0466971_0056132 | 3300044719 | Bacteria | 1776 |
| 338 | Ga0466968_0004036 | 3300044735 | Bacteria | 5458 |
| 339 | Ga0466968_0435826 | 3300044735 | Bacteria | 646 |
| 340 | Ga0466970_0029400 | 3300044765 | Bacteria | 2892 |
| 341 | Ga0466970_0074801 | 3300044765 | Bacteria | 1824 |
| 342 | Ga0466957_0029141 | 3300044842 | Bacteria | 3290 |
| 343 | Ga0466957_0224700 | 3300044842 | Bacteria | 1241 |
| 344 | Ga0466959_0039310 | 3300045049 | Bacteria | 3495 |
| 345 | Ga0466958_0003930 | 3300045836 | Bacteria | 7791 |
| 346 | Ga0466958_0056184 | 3300045836 | Bacteria | 2390 |
| 347 | Ga0466967_0010112 | 3300045976 | Bacteria | 7053 |
| 348 | Ga0466967_0261982 | 3300045976 | Bacteria | 1654 |
| 349 | Ga0466967_0301745 | 3300045976 | Bacteria | 1541 |
| 350 | Ga0495605_0249486 | 3300046474 | Bacteria | 760 |
| 351 | Ga0495606_0107785 | 3300046507 | Bacteria | 1685 |
| 352 | Ga0495610_0000418 | 3300046512 | Bacteria | 43639 |
| 353 | Ga0495616_0049321 | 3300046513 | Bacteria | 2111 |
| 354 | Ga0495620_0042099 | 3300046515 | Bacteria | 1998 |
| 355 | Ga0495637_0013603 | 3300046520 | Bacteria | 3859 |
| 356 | Ga0495643_0000126 | 3300046522 | Bacteria | 123807 |
| 357 | Ga0495643_0023040 | 3300046522 | Bacteria | 3544 |
| 358 | Ga0495609_0056161 | 3300046538 | Bacteria | 1745 |
| 359 | Ga0495597_0002079 | 3300046542 | Bacteria | 13347 |
| 360 | Ga0495633_0051354 | 3300046558 | Bacteria | 1943 |
| 361 | Ga0495625_0044418 | 3300046660 | Bacteria | 3217 |
| 362 | Ga0495625_0387357 | 3300046660 | Bacteria | 876 |
| 363 | Ga0495649_0167964 | 3300046694 | Bacteria | 1149 |
| 364 | Ga0495686_0003763 | 3300047472 | Bacteria | 12898 |
| 365 | Ga0495686_0006588 | 3300047472 | Bacteria | 8856 |
| 366 | Ga0496113_0965518 | 3300048916 | Bacteria | 672 |
| 367 | Ga0496117_0008571 | 3300048920 | Bacteria | 9695 |
| 368 | Ga0496117_0135850 | 3300048920 | Bacteria | 1481 |
| 369 | Ga0496118_0011266 | 3300048921 | Bacteria | 8750 |
| 370 | Ga0496118_0013942 | 3300048921 | Bacteria | 7559 |
| 371 | Ga0496118_0047653 | 3300048921 | Bacteria | 3319 |
| 372 | Ga0496119_0022403 | 3300048922 | Bacteria | 4523 |
| 373 | Ga0496119_0227887 | 3300048922 | Bacteria | 950 |
| 374 | Ga0496120_0015483 | 3300048923 | Bacteria | 5025 |
| 375 | Ga0496120_0052243 | 3300048923 | Bacteria | 2329 |
| 376 | Ga0496120_0089600 | 3300048923 | Bacteria | 1646 |
| 377 | Ga0496121_0007252 | 3300048924 | Bacteria | 13420 |
| 378 | Ga0496121_0011369 | 3300048924 | Bacteria | 9895 |
| 379 | Ga0496121_0028884 | 3300048924 | Bacteria | 5150 |
| 380 | Ga0496122_0043107 | 3300048925 | Bacteria | 3539 |
| 381 | Ga0496122_0478984 | 3300048925 | Bacteria | 610 |
| 382 | Ga0496123_0005045 | 3300048926 | Bacteria | 13507 |
| 383 | Ga0496124_0062534 | 3300048927 | Bacteria | 3114 |
| 384 | Ga0496124_0099729 | 3300048927 | Bacteria | 2355 |
| 385 | Ga0496124_0405658 | 3300048927 | Bacteria | 944 |
| 386 | Ga0496125_0006050 | 3300048928 | Bacteria | 13227 |
| 387 | Ga0496125_0162377 | 3300048928 | Bacteria | 1515 |
| 388 | Ga0496126_0044798 | 3300048929 | Bacteria | 4071 |
| 389 | Ga0496126_0184869 | 3300048929 | Bacteria | 1768 |
| 390 | Ga0496126_0442133 | 3300048929 | Bacteria | 1048 |
| 391 | Ga0501314_001179 | 3300049530 | Bacteria | 1843 |
| 392 | Ga0501034_0009756 | 3300049571 | Bacteria | 10040 |
| 393 | Ga0501069_0016864 | 3300049585 | Bacteria | 3924 |
| 394 | Ga0501070_0106750 | 3300049586 | Bacteria | 2314 |
| 395 | Ga0501074_0611843 | 3300049590 | Bacteria | 770 |
| 396 | Ga0501198_029448 | 3300049649 | Bacteria | 910 |
| 397 | Ga0501223_000170 | 3300049663 | Bacteria | 16976 |
| 398 | Ga0501224_000100 | 3300049664 | Bacteria | 9083 |
| 399 | Ga0501233_007363 | 3300049668 | Bacteria | 2091 |
| 400 | Ga0501235_035498 | 3300049669 | Bacteria | 1132 |
| 401 | Ga0501225_0000927 | 3300049705 | Bacteria | 9139 |
| 402 | Ga0501080_0531916 | 3300049742 | Bacteria | 1048 |
| 403 | Ga0501226_000031 | 3300049853 | Bacteria | 74305 |
| 404 | nmdc:mga03683_74173_c1 | 3300050489 | Bacteria | 1459 |
| 405 | nmdc:mga0k408_73927_c1 | 3300050493 | Bacteria | 1991 |
| 406 | nmdc:mga0rr50_903370_c1 | 3300050513 | Bacteria | 753 |
| 407 | Ga0500646_0027913 | 3300053090 | Bacteria | 1538 |
| 408 | Ga0500651_0004262 | 3300053093 | Bacteria | 7988 |
| 409 | Ga0500642_0027175 | 3300053130 | Bacteria | 2346 |
| 410 | Ga0500559_0022972 | 3300053136 | Bacteria | 2646 |
| 411 | Ga0500568_0002468 | 3300053139 | Bacteria | 10868 |
| 412 | Ga0500577_0095323 | 3300053142 | Bacteria | 1209 |
| 413 | Ga0500604_0000102 | 3300053151 | Bacteria | 26419 |
| 414 | Ga0500616_0000161 | 3300053153 | Bacteria | 111424 |
| 415 | Ga0500639_153514 | 3300053163 | Bacteria | 1058 |
| 416 | Ga0500570_000958 | 3300053724 | Bacteria | 12450 |
| 417 | Ga0500645_115389 | 3300053730 | Bacteria | 751 |
| 418 | Ga0500552_001947 | 3300053733 | Bacteria | 1986 |
| 419 | Ga0466962_0001969 | 3300061719 | Bacteria | 9693 |
| 420 | Ga0466962_0176130 | 3300061719 | Bacteria | 1042 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005539 | Ga0068853_100028934 | Ga0068853_1000289345 | 161 |
| 2 | 3300005539 | Ga0068853_100248059 | Ga0068853_1002480592 | 161 |
| 3 | 3300013307 | Ga0157372_11897138 | Ga0157372_118971381 | 161 |
| 4 | 3300025923 | Ga0207681_10105317 | Ga0207681_101053172 | 161 |
| 5 | 3300025944 | Ga0207661_10674204 | Ga0207661_106742042 | 161 |
| 6 | 3300026041 | Ga0207639_10348757 | Ga0207639_103487572 | 161 |
| 7 | 3300026142 | Ga0207698_10180165 | Ga0207698_101801652 | 161 |
| 8 | 3300028379 | Ga0268266_10000130 | Ga0268266_1000013051 | 161 |
| 9 | 3300031903 | Ga0307407_10798910 | Ga0307407_107989102 | 161 |
| 10 | 3300039437 | Ga0436365_0881241 | Ga0436365_0881241_281_796 | 161 |
| 11 | 3300046694 | Ga0495649_0167964 | Ga0495649_0167964_430_930 | 161 |
| 12 | 3300005289 | Ga0065704_10075953 | Ga0065704_100759534 | 162 |
| 13 | 3300005336 | Ga0070680_100000642 | Ga0070680_1000006425 | 162 |
| 14 | 3300005337 | Ga0070682_100230256 | Ga0070682_1002302562 | 162 |
| 15 | 3300005339 | Ga0070660_100004877 | Ga0070660_1000048773 | 162 |
| 16 | 3300005344 | Ga0070661_100000003 | Ga0070661_100000003237 | 162 |
| 17 | 3300005354 | Ga0070675_101289986 | Ga0070675_1012899861 | 162 |
| 18 | 3300005367 | Ga0070667_100029219 | Ga0070667_1000292192 | 162 |
| 19 | 3300005458 | Ga0070681_10044787 | Ga0070681_100447872 | 162 |
| 20 | 3300005530 | Ga0070679_100000001 | Ga0070679_100000001244 | 162 |
| 21 | 3300005841 | Ga0068863_100014434 | Ga0068863_1000144343 | 162 |
| 22 | 3300005843 | Ga0068860_100023451 | Ga0068860_1000234513 | 162 |
| 23 | 3300005844 | Ga0068862_100009303 | Ga0068862_1000093032 | 162 |
| 24 | 3300009011 | Ga0105251_10002745 | Ga0105251_100027453 | 162 |
| 25 | 3300009101 | Ga0105247_10239818 | Ga0105247_102398182 | 162 |
| 26 | 3300009553 | Ga0105249_10076063 | Ga0105249_100760632 | 162 |
| 27 | 3300025912 | Ga0207707_10020047 | Ga0207707_100200476 | 162 |
| 28 | 3300025917 | Ga0207660_10001365 | Ga0207660_100013655 | 162 |
| 29 | 3300025919 | Ga0207657_10005887 | Ga0207657_1000588712 | 162 |
| 30 | 3300025920 | Ga0207649_10000016 | Ga0207649_10000016142 | 162 |
| 31 | 3300025921 | Ga0207652_10000002 | Ga0207652_10000002805 | 162 |
| 32 | 3300025926 | Ga0207659_10698481 | Ga0207659_106984812 | 162 |
| 33 | 3300025961 | Ga0207712_10146108 | Ga0207712_101461082 | 162 |
| 34 | 3300025972 | Ga0207668_10004544 | Ga0207668_100045448 | 162 |
| 35 | 3300026088 | Ga0207641_10006245 | Ga0207641_100062454 | 162 |
| 36 | 3300028381 | Ga0268264_10025177 | Ga0268264_100251773 | 162 |
| 37 | 3300032002 | Ga0307416_100284376 | Ga0307416_1002843761 | 162 |
| 38 | 3300046507 | Ga0495606_0107785 | Ga0495606_0107785_97_591 | 162 |
| 39 | 3300046515 | Ga0495620_0042099 | Ga0495620_0042099_843_1337 | 162 |
| 40 | 3300048920 | Ga0496117_0135850 | Ga0496117_0135850_71_580 | 162 |
| 41 | 3300048921 | Ga0496118_0013942 | Ga0496118_0013942_3115_3624 | 162 |
| 42 | 3300048922 | Ga0496119_0227887 | Ga0496119_0227887_65_574 | 162 |
| 43 | 3300048923 | Ga0496120_0052243 | Ga0496120_0052243_1170_1679 | 162 |
| 44 | 3300048924 | Ga0496121_0011369 | Ga0496121_0011369_2291_2800 | 162 |
| 45 | 3300048925 | Ga0496122_0478984 | Ga0496122_0478984_38_547 | 162 |
| 46 | 3300048927 | Ga0496124_0062534 | Ga0496124_0062534_914_1423 | 162 |
| 47 | 3300048927 | Ga0496124_0405658 | Ga0496124_0405658_401_910 | 162 |
| 48 | 3300048928 | Ga0496125_0006050 | Ga0496125_0006050_11458_11967 | 162 |
| 49 | 3300048929 | Ga0496126_0044798 | Ga0496126_0044798_3008_3517 | 162 |
| 50 | 3300005338 | Ga0068868_100000032 | Ga0068868_10000003213 | 163 |
| 51 | 3300005339 | Ga0070660_100003184 | Ga0070660_1000031844 | 163 |
| 52 | 3300005353 | Ga0070669_100165677 | Ga0070669_1001656772 | 163 |
| 53 | 3300005354 | Ga0070675_101001603 | Ga0070675_1010016032 | 163 |
| 54 | 3300005356 | Ga0070674_100117701 | Ga0070674_1001177012 | 163 |
| 55 | 3300005366 | Ga0070659_100000005 | Ga0070659_100000005204 | 163 |
| 56 | 3300005440 | Ga0070705_100787460 | Ga0070705_1007874601 | 163 |
| 57 | 3300005543 | Ga0070672_100612225 | Ga0070672_1006122252 | 163 |
| 58 | 3300005546 | Ga0070696_100822245 | Ga0070696_1008222451 | 163 |
| 59 | 3300007076 | Ga0075435_100263344 | Ga0075435_1002633442 | 163 |
| 60 | 3300009098 | Ga0105245_10466877 | Ga0105245_104668772 | 163 |
| 61 | 3300021384 | Ga0213876_10000258 | Ga0213876_1000025828 | 163 |
| 62 | 3300025907 | Ga0207645_10712832 | Ga0207645_107128322 | 163 |
| 63 | 3300025919 | Ga0207657_10001518 | Ga0207657_1000151816 | 163 |
| 64 | 3300025923 | Ga0207681_10219326 | Ga0207681_102193262 | 163 |
| 65 | 3300025926 | Ga0207659_10130592 | Ga0207659_101305922 | 163 |
| 66 | 3300025932 | Ga0207690_10000020 | Ga0207690_1000002020 | 163 |
| 67 | 3300025937 | Ga0207669_10296785 | Ga0207669_102967852 | 163 |
| 68 | 3300025940 | Ga0207691_10548526 | Ga0207691_105485262 | 163 |
| 69 | 3300026023 | Ga0207677_10000100 | Ga0207677_1000010050 | 163 |
| 70 | 3300026075 | Ga0207708_10203693 | Ga0207708_102036932 | 163 |
| 71 | 3300031824 | Ga0307413_11521836 | Ga0307413_115218361 | 163 |
| 72 | 3300032002 | Ga0307416_100013683 | Ga0307416_1000136833 | 163 |
| 73 | 3300032004 | Ga0307414_10020000 | Ga0307414_100200002 | 163 |
| 74 | 3300032005 | Ga0307411_10552855 | Ga0307411_105528551 | 163 |
| 75 | 3300032126 | Ga0307415_100585249 | Ga0307415_1005852492 | 163 |
| 76 | 3300039437 | Ga0436365_1503647 | Ga0436365_1503647_12738_13238 | 163 |
| 77 | 3300046474 | Ga0495605_0249486 | Ga0495605_0249486_82_576 | 163 |
| 78 | 3300046512 | Ga0495610_0000418 | Ga0495610_0000418_18470_18964 | 163 |
| 79 | 3300046522 | Ga0495643_0000126 | Ga0495643_0000126_25317_25811 | 163 |
| 80 | 3300046558 | Ga0495633_0051354 | Ga0495633_0051354_1144_1638 | 163 |
| 81 | 3300050513 | nmdc:mga0rr50_903370_c1 | nmdc:mga0rr50_903370_c1_114_626 | 163 |
| 82 | 3300005333 | Ga0070677_10000160 | Ga0070677_100001604 | 164 |
| 83 | 3300005347 | Ga0070668_100000001 | Ga0070668_10000000182 | 164 |
| 84 | 3300005353 | Ga0070669_100020675 | Ga0070669_1000206754 | 164 |
| 85 | 3300005353 | Ga0070669_100112106 | Ga0070669_1001121062 | 164 |
| 86 | 3300005355 | Ga0070671_100000046 | Ga0070671_10000004698 | 164 |
| 87 | 3300005548 | Ga0070665_100004425 | Ga0070665_10000442514 | 164 |
| 88 | 3300005548 | Ga0070665_100304304 | Ga0070665_1003043042 | 164 |
| 89 | 3300005617 | Ga0068859_101717426 | Ga0068859_1017174261 | 164 |
| 90 | 3300005719 | Ga0068861_100039323 | Ga0068861_1000393232 | 164 |
| 91 | 3300005841 | Ga0068863_100034345 | Ga0068863_1000343452 | 164 |
| 92 | 3300005844 | Ga0068862_100000898 | Ga0068862_1000008982 | 164 |
| 93 | 3300006931 | Ga0097620_101716738 | Ga0097620_1017167381 | 164 |
| 94 | 3300009177 | Ga0105248_10222552 | Ga0105248_102225522 | 164 |
| 95 | 3300009553 | Ga0105249_10984754 | Ga0105249_109847542 | 164 |
| 96 | 3300013104 | Ga0157370_10125999 | Ga0157370_101259992 | 164 |
| 97 | 3300013306 | Ga0163162_10782734 | Ga0163162_107827342 | 164 |
| 98 | 3300013308 | Ga0157375_10035932 | Ga0157375_100359322 | 164 |
| 99 | 3300013308 | Ga0157375_11679993 | Ga0157375_116799932 | 164 |
| 100 | 3300025893 | Ga0207682_10000258 | Ga0207682_100002582 | 164 |
| 101 | 3300025923 | Ga0207681_10004717 | Ga0207681_100047172 | 164 |
| 102 | 3300025923 | Ga0207681_10245714 | Ga0207681_102457142 | 164 |
| 103 | 3300025931 | Ga0207644_10001037 | Ga0207644_1000103712 | 164 |
| 104 | 3300025931 | Ga0207644_10477912 | Ga0207644_104779122 | 164 |
| 105 | 3300025937 | Ga0207669_10846837 | Ga0207669_108468372 | 164 |
| 106 | 3300025972 | Ga0207668_10000009 | Ga0207668_1000000975 | 164 |
| 107 | 3300026118 | Ga0207675_100006332 | Ga0207675_1000063329 | 164 |
| 108 | 3300028379 | Ga0268266_10003755 | Ga0268266_100037552 | 164 |
| 109 | 3300028379 | Ga0268266_10581628 | Ga0268266_105816282 | 164 |
| 110 | 3300028380 | Ga0268265_10000803 | Ga0268265_1000080333 | 164 |
| 111 | 3300031250 | Ga0265331_10020163 | Ga0265331_100201632 | 164 |
| 112 | 3300031731 | Ga0307405_10099374 | Ga0307405_100993742 | 164 |
| 113 | 3300031852 | Ga0307410_10006775 | Ga0307410_100067756 | 164 |
| 114 | 3300031852 | Ga0307410_10389614 | Ga0307410_103896141 | 164 |
| 115 | 3300031995 | Ga0307409_100097248 | Ga0307409_1000972482 | 164 |
| 116 | 3300032002 | Ga0307416_101489335 | Ga0307416_1014893352 | 164 |
| 117 | 3300032004 | Ga0307414_10659364 | Ga0307414_106593642 | 164 |
| 118 | 3300044694 | Ga0466963_0868853 | Ga0466963_0868853_118_612 | 164 |
| 119 | 3300044842 | Ga0466957_0224700 | Ga0466957_0224700_474_968 | 164 |
| 120 | 3300005331 | Ga0070670_100001565 | Ga0070670_10000156512 | 165 |
| 121 | 3300005355 | Ga0070671_101261138 | Ga0070671_1012611381 | 165 |
| 122 | 3300005466 | Ga0070685_10842395 | Ga0070685_108423951 | 165 |
| 123 | 3300005544 | Ga0070686_100493122 | Ga0070686_1004931222 | 165 |
| 124 | 3300005546 | Ga0070696_100189979 | Ga0070696_1001899792 | 165 |
| 125 | 3300005548 | Ga0070665_100505231 | Ga0070665_1005052312 | 165 |
| 126 | 3300005577 | Ga0068857_100249422 | Ga0068857_1002494221 | 165 |
| 127 | 3300005578 | Ga0068854_100588075 | Ga0068854_1005880752 | 165 |
| 128 | 3300005842 | Ga0068858_100077187 | Ga0068858_1000771872 | 165 |
| 129 | 3300005843 | Ga0068860_100014907 | Ga0068860_1000149074 | 165 |
| 130 | 3300014325 | Ga0163163_10591136 | Ga0163163_105911362 | 165 |
| 131 | 3300020081 | Ga0206354_10726863 | Ga0206354_107268633 | 165 |
| 132 | 3300020082 | Ga0206353_11331210 | Ga0206353_113312107 | 165 |
| 133 | 3300021358 | Ga0213873_10000016 | Ga0213873_1000001610 | 165 |
| 134 | 3300021384 | Ga0213876_10000056 | Ga0213876_10000056128 | 165 |
| 135 | 3300025923 | Ga0207681_11295455 | Ga0207681_112954551 | 165 |
| 136 | 3300025937 | Ga0207669_10465464 | Ga0207669_104654642 | 165 |
| 137 | 3300025981 | Ga0207640_10059555 | Ga0207640_100595552 | 165 |
| 138 | 3300026116 | Ga0207674_10084798 | Ga0207674_100847982 | 165 |
| 139 | 3300026116 | Ga0207674_10826222 | Ga0207674_108262222 | 165 |
| 140 | 3300028379 | Ga0268266_10345937 | Ga0268266_103459372 | 165 |
| 141 | 3300028381 | Ga0268264_10010960 | Ga0268264_100109606 | 165 |
| 142 | 3300031548 | Ga0307408_100082185 | Ga0307408_1000821852 | 165 |
| 143 | 3300031548 | Ga0307408_100175767 | Ga0307408_1001757672 | 165 |
| 144 | 3300031548 | Ga0307408_100200167 | Ga0307408_1002001672 | 165 |
| 145 | 3300031548 | Ga0307408_100813543 | Ga0307408_1008135432 | 165 |
| 146 | 3300031731 | Ga0307405_10092162 | Ga0307405_100921622 | 165 |
| 147 | 3300031731 | Ga0307405_10185135 | Ga0307405_101851352 | 165 |
| 148 | 3300031852 | Ga0307410_10601131 | Ga0307410_106011312 | 165 |
| 149 | 3300031852 | Ga0307410_10756565 | Ga0307410_107565651 | 165 |
| 150 | 3300031852 | Ga0307410_11450711 | Ga0307410_114507112 | 165 |
| 151 | 3300031901 | Ga0307406_10059890 | Ga0307406_100598902 | 165 |
| 152 | 3300031903 | Ga0307407_10042583 | Ga0307407_100425832 | 165 |
| 153 | 3300031903 | Ga0307407_10190771 | Ga0307407_101907712 | 165 |
| 154 | 3300031903 | Ga0307407_10386514 | Ga0307407_103865142 | 165 |
| 155 | 3300031911 | Ga0307412_10021885 | Ga0307412_100218852 | 165 |
| 156 | 3300031911 | Ga0307412_10063286 | Ga0307412_100632863 | 165 |
| 157 | 3300031911 | Ga0307412_10818251 | Ga0307412_108182512 | 165 |
| 158 | 3300031911 | Ga0307412_11189590 | Ga0307412_111895902 | 165 |
| 159 | 3300031995 | Ga0307409_100197231 | Ga0307409_1001972312 | 165 |
| 160 | 3300031995 | Ga0307409_102381819 | Ga0307409_1023818191 | 165 |
| 161 | 3300032002 | Ga0307416_100018856 | Ga0307416_1000188562 | 165 |
| 162 | 3300032002 | Ga0307416_100145103 | Ga0307416_1001451032 | 165 |
| 163 | 3300032004 | Ga0307414_10033888 | Ga0307414_100338882 | 165 |
| 164 | 3300032004 | Ga0307414_10173894 | Ga0307414_101738942 | 165 |
| 165 | 3300032004 | Ga0307414_10323091 | Ga0307414_103230911 | 165 |
| 166 | 3300032004 | Ga0307414_10396188 | Ga0307414_103961882 | 165 |
| 167 | 3300032004 | Ga0307414_10587433 | Ga0307414_105874332 | 165 |
| 168 | 3300032005 | Ga0307411_10023693 | Ga0307411_100236933 | 165 |
| 169 | 3300032005 | Ga0307411_10185144 | Ga0307411_101851442 | 165 |
| 170 | 3300032126 | Ga0307415_100154910 | Ga0307415_1001549102 | 165 |
| 171 | 3300032126 | Ga0307415_100612395 | Ga0307415_1006123952 | 165 |
| 172 | 3300037471 | Ga0395905_0664662 | Ga0395905_0664662_256_753 | 165 |
| 173 | 3300039437 | Ga0436365_0869628 | Ga0436365_0869628_8873_9373 | 165 |
| 174 | 3300039453 | Ga0436362_0580304 | Ga0436362_0580304_8873_9373 | 165 |
| 175 | 3300041404 | Ga0439436_0034554 | Ga0439436_0034554_681_1178 | 165 |
| 176 | 3300041498 | Ga0451841_0647617 | Ga0451841_0647617_760_1272 | 165 |
| 177 | 3300045976 | Ga0466967_0301745 | Ga0466967_0301745_65_562 | 165 |
| 178 | 3300046513 | Ga0495616_0049321 | Ga0495616_0049321_1485_1997 | 165 |
| 179 | 3300046660 | Ga0495625_0044418 | Ga0495625_0044418_426_938 | 165 |
| 180 | 3300048929 | Ga0496126_0184869 | Ga0496126_0184869_638_1150 | 165 |
| 181 | 3300049585 | Ga0501069_0016864 | Ga0501069_0016864_1404_1901 | 165 |
| 182 | 3300049586 | Ga0501070_0106750 | Ga0501070_0106750_610_1107 | 165 |
| 183 | 3300049590 | Ga0501074_0611843 | Ga0501074_0611843_161_658 | 165 |
| 184 | 3300049742 | Ga0501080_0531916 | Ga0501080_0531916_365_862 | 165 |
| 185 | 3300053090 | Ga0500646_0027913 | Ga0500646_0027913_469_984 | 165 |
| 186 | 3300053139 | Ga0500568_0002468 | Ga0500568_0002468_9159_9674 | 165 |
| 187 | 3300053151 | Ga0500604_0000102 | Ga0500604_0000102_15787_16302 | 165 |
| 188 | 3300053153 | Ga0500616_0000161 | Ga0500616_0000161_58342_58857 | 165 |
| 189 | 3300026078 | Ga0207702_10786477 | Ga0207702_107864772 | 166 |
| 190 | 3300031548 | Ga0307408_100017066 | Ga0307408_1000170663 | 166 |
| 191 | 3300031731 | Ga0307405_10585100 | Ga0307405_105851002 | 166 |
| 192 | 3300031731 | Ga0307405_11018214 | Ga0307405_110182142 | 166 |
| 193 | 3300031824 | Ga0307413_10074536 | Ga0307413_100745363 | 166 |
| 194 | 3300031852 | Ga0307410_10093968 | Ga0307410_100939682 | 166 |
| 195 | 3300031852 | Ga0307410_10438910 | Ga0307410_104389102 | 166 |
| 196 | 3300031901 | Ga0307406_10213389 | Ga0307406_102133892 | 166 |
| 197 | 3300031903 | Ga0307407_10010565 | Ga0307407_100105653 | 166 |
| 198 | 3300031911 | Ga0307412_10000454 | Ga0307412_100004542 | 166 |
| 199 | 3300031911 | Ga0307412_10040123 | Ga0307412_100401232 | 166 |
| 200 | 3300031995 | Ga0307409_100064827 | Ga0307409_1000648272 | 166 |
| 201 | 3300032002 | Ga0307416_100042324 | Ga0307416_1000423243 | 166 |
| 202 | 3300032002 | Ga0307416_100302820 | Ga0307416_1003028202 | 166 |
| 203 | 3300032004 | Ga0307414_10024870 | Ga0307414_100248704 | 166 |
| 204 | 3300032004 | Ga0307414_10043199 | Ga0307414_100431992 | 166 |
| 205 | 3300032005 | Ga0307411_10141928 | Ga0307411_101419282 | 166 |
| 206 | 3300032005 | Ga0307411_10392717 | Ga0307411_103927172 | 166 |
| 207 | 3300035725 | Ga0373947_0049928 | Ga0373947_0049928_123_644 | 166 |
| 208 | 3300037068 | Ga0373925_0038509 | Ga0373925_0038509_1057_1578 | 166 |
| 209 | 3300041413 | Ga0439465_0128915 | Ga0439465_0128915_34_534 | 166 |
| 210 | 3300042006 | Ga0439432_013450 | Ga0439432_013450_123_623 | 166 |
| 211 | 3300042007 | Ga0439449_0015947 | Ga0439449_0015947_224_724 | 166 |
| 212 | 3300042125 | Ga0450923_084288 | Ga0450923_084288_17_517 | 166 |
| 213 | 3300044765 | Ga0466970_0074801 | Ga0466970_0074801_384_884 | 166 |
| 214 | 3300046520 | Ga0495637_0013603 | Ga0495637_0013603_3098_3619 | 166 |
| 215 | 3300046522 | Ga0495643_0023040 | Ga0495643_0023040_985_1506 | 166 |
| 216 | 3300046538 | Ga0495609_0056161 | Ga0495609_0056161_325_846 | 166 |
| 217 | 3300046542 | Ga0495597_0002079 | Ga0495597_0002079_1957_2478 | 166 |
| 218 | 3300046660 | Ga0495625_0387357 | Ga0495625_0387357_61_582 | 166 |
| 219 | 3300049530 | Ga0501314_001179 | Ga0501314_001179_1184_1684 | 166 |
| 220 | 3300049571 | Ga0501034_0009756 | Ga0501034_0009756_5084_5584 | 166 |
| 221 | 3300049649 | Ga0501198_029448 | Ga0501198_029448_254_754 | 166 |
| 222 | 3300049663 | Ga0501223_000170 | Ga0501223_000170_14723_15223 | 166 |
| 223 | 3300049664 | Ga0501224_000100 | Ga0501224_000100_1750_2250 | 166 |
| 224 | 3300049668 | Ga0501233_007363 | Ga0501233_007363_652_1152 | 166 |
| 225 | 3300049669 | Ga0501235_035498 | Ga0501235_035498_414_914 | 166 |
| 226 | 3300049705 | Ga0501225_0000927 | Ga0501225_0000927_6651_7151 | 166 |
| 227 | 3300049853 | Ga0501226_000031 | Ga0501226_000031_1987_2487 | 166 |
| 228 | 3300053093 | Ga0500651_0004262 | Ga0500651_0004262_1951_2472 | 166 |
| 229 | 3300053130 | Ga0500642_0027175 | Ga0500642_0027175_389_910 | 166 |
| 230 | 3300053142 | Ga0500577_0095323 | Ga0500577_0095323_156_677 | 166 |
| 231 | 3300053163 | Ga0500639_153514 | Ga0500639_153514_415_936 | 166 |
| 232 | 3300053724 | Ga0500570_000958 | Ga0500570_000958_51_572 | 166 |
| 233 | 3300053730 | Ga0500645_115389 | Ga0500645_115389_30_551 | 166 |
| 234 | 3300053733 | Ga0500552_001947 | Ga0500552_001947_923_1444 | 166 |
| 235 | 3300005327 | Ga0070658_10006307 | Ga0070658_1000630710 | 167 |
| 236 | 3300005331 | Ga0070670_100024630 | Ga0070670_1000246302 | 167 |
| 237 | 3300005339 | Ga0070660_100281558 | Ga0070660_1002815582 | 167 |
| 238 | 3300005347 | Ga0070668_100000007 | Ga0070668_100000007106 | 167 |
| 239 | 3300005355 | Ga0070671_100016182 | Ga0070671_1000161825 | 167 |
| 240 | 3300005366 | Ga0070659_100194804 | Ga0070659_1001948042 | 167 |
| 241 | 3300005548 | Ga0070665_100069646 | Ga0070665_1000696463 | 167 |
| 242 | 3300005563 | Ga0068855_100301097 | Ga0068855_1003010972 | 167 |
| 243 | 3300005841 | Ga0068863_100000027 | Ga0068863_10000002722 | 167 |
| 244 | 3300005842 | Ga0068858_100597705 | Ga0068858_1005977052 | 167 |
| 245 | 3300005844 | Ga0068862_100031234 | Ga0068862_1000312342 | 167 |
| 246 | 3300009553 | Ga0105249_10002539 | Ga0105249_1000253910 | 167 |
| 247 | 3300025254 | Ga0209148_1000867 | Ga0209148_100086721 | 167 |
| 248 | 3300025272 | Ga0209455_1000599 | Ga0209455_10005998 | 167 |
| 249 | 3300025904 | Ga0207647_10049825 | Ga0207647_100498253 | 167 |
| 250 | 3300025909 | Ga0207705_10008707 | Ga0207705_100087076 | 167 |
| 251 | 3300025919 | Ga0207657_10073445 | Ga0207657_100734452 | 167 |
| 252 | 3300025925 | Ga0207650_10337699 | Ga0207650_103376992 | 167 |
| 253 | 3300025931 | Ga0207644_10000111 | Ga0207644_1000011163 | 167 |
| 254 | 3300025931 | Ga0207644_10114231 | Ga0207644_101142312 | 167 |
| 255 | 3300025932 | Ga0207690_10162291 | Ga0207690_101622912 | 167 |
| 256 | 3300025949 | Ga0207667_10536469 | Ga0207667_105364692 | 167 |
| 257 | 3300025961 | Ga0207712_10505275 | Ga0207712_105052752 | 167 |
| 258 | 3300025972 | Ga0207668_10000054 | Ga0207668_1000005479 | 167 |
| 259 | 3300026035 | Ga0207703_10744200 | Ga0207703_107442002 | 167 |
| 260 | 3300026088 | Ga0207641_10000045 | Ga0207641_10000045153 | 167 |
| 261 | 3300028379 | Ga0268266_10032027 | Ga0268266_100320274 | 167 |
| 262 | 3300028380 | Ga0268265_10065726 | Ga0268265_100657262 | 167 |
| 263 | 3300028381 | Ga0268264_10063611 | Ga0268264_100636113 | 167 |
| 264 | 3300047472 | Ga0495686_0003763 | Ga0495686_0003763_10269_10775 | 167 |
| 265 | 3300047472 | Ga0495686_0006588 | Ga0495686_0006588_6382_6888 | 167 |
| 266 | 3300053136 | Ga0500559_0022972 | Ga0500559_0022972_971_1477 | 167 |
| 267 | 3300002741 | JGI25157J39369_1023103 | JGI25157J39369_10231032 | 168 |
| 268 | 3300002772 | JGI25164J39214_1011644 | JGI25164J39214_10116442 | 168 |
| 269 | 3300003214 | JGI25165J46597_1000350 | JGI25165J46597_100035028 | 168 |
| 270 | 3300005614 | Ga0068856_100257615 | Ga0068856_1002576152 | 168 |
| 271 | 3300009093 | Ga0105240_10263231 | Ga0105240_102632312 | 168 |
| 272 | 3300013104 | Ga0157370_10000140 | Ga0157370_1000014069 | 168 |
| 273 | 3300013105 | Ga0157369_10039174 | Ga0157369_100391742 | 168 |
| 274 | 3300025231 | Ga0207427_100635 | Ga0207427_10063515 | 168 |
| 275 | 3300025250 | Ga0209026_1007027 | Ga0209026_10070272 | 168 |
| 276 | 3300025261 | Ga0209233_1000319 | Ga0209233_100031927 | 168 |
| 277 | 3300025913 | Ga0207695_10095072 | Ga0207695_100950722 | 168 |
| 278 | 3300026078 | Ga0207702_10220782 | Ga0207702_102207822 | 168 |
| 279 | 3300035112 | Ga0373932_0014778 | Ga0373932_0014778_709_1215 | 168 |
| 280 | 3300035691 | Ga0373931_0272751 | Ga0373931_0272751_316_822 | 168 |
| 281 | 3300037312 | Ga0395899_0000730 | Ga0395899_0000730_1977_2483 | 168 |
| 282 | 3300037418 | Ga0395900_0132024 | Ga0395900_0132024_1878_2384 | 168 |
| 283 | 3300037418 | Ga0395900_0196167 | Ga0395900_0196167_700_1206 | 168 |
| 284 | 3300037466 | Ga0395898_0933928 | Ga0395898_0933928_94_600 | 168 |
| 285 | 3300037466 | Ga0395898_1436128 | Ga0395898_1436128_63_569 | 168 |
| 286 | 3300037471 | Ga0395905_0378107 | Ga0395905_0378107_21_527 | 168 |
| 287 | 3300001990 | JGI24737J22298_10002757 | JGI24737J22298_100027575 | 169 |
| 288 | 3300001990 | JGI24737J22298_10005238 | JGI24737J22298_100052384 | 169 |
| 289 | 3300002067 | JGI24735J21928_10000375 | JGI24735J21928_1000037514 | 169 |
| 290 | 3300005327 | Ga0070658_10014281 | Ga0070658_100142817 | 169 |
| 291 | 3300005328 | Ga0070676_10004604 | Ga0070676_100046044 | 169 |
| 292 | 3300005328 | Ga0070676_10081762 | Ga0070676_100817622 | 169 |
| 293 | 3300005334 | Ga0068869_100001299 | Ga0068869_1000012996 | 169 |
| 294 | 3300005338 | Ga0068868_100001207 | Ga0068868_1000012078 | 169 |
| 295 | 3300005339 | Ga0070660_100001901 | Ga0070660_1000019015 | 169 |
| 296 | 3300005339 | Ga0070660_100032282 | Ga0070660_1000322822 | 169 |
| 297 | 3300005339 | Ga0070660_100072144 | Ga0070660_1000721442 | 169 |
| 298 | 3300005347 | Ga0070668_100001305 | Ga0070668_10000130518 | 169 |
| 299 | 3300005354 | Ga0070675_100215903 | Ga0070675_1002159032 | 169 |
| 300 | 3300005355 | Ga0070671_100004606 | Ga0070671_10000460610 | 169 |
| 301 | 3300005355 | Ga0070671_100868902 | Ga0070671_1008689022 | 169 |
| 302 | 3300005364 | Ga0070673_100000029 | Ga0070673_10000002960 | 169 |
| 303 | 3300005366 | Ga0070659_100229617 | Ga0070659_1002296172 | 169 |
| 304 | 3300005456 | Ga0070678_100061165 | Ga0070678_1000611653 | 169 |
| 305 | 3300005459 | Ga0068867_100000044 | Ga0068867_10000004417 | 169 |
| 306 | 3300005543 | Ga0070672_100149653 | Ga0070672_1001496532 | 169 |
| 307 | 3300005543 | Ga0070672_100481867 | Ga0070672_1004818672 | 169 |
| 308 | 3300005547 | Ga0070693_100024200 | Ga0070693_1000242002 | 169 |
| 309 | 3300005548 | Ga0070665_100000079 | Ga0070665_100000079149 | 169 |
| 310 | 3300005614 | Ga0068856_100641068 | Ga0068856_1006410682 | 169 |
| 311 | 3300005614 | Ga0068856_100937487 | Ga0068856_1009374872 | 169 |
| 312 | 3300005616 | Ga0068852_100001909 | Ga0068852_1000019095 | 169 |
| 313 | 3300005718 | Ga0068866_10176219 | Ga0068866_101762192 | 169 |
| 314 | 3300006353 | Ga0075370_10157463 | Ga0075370_101574632 | 169 |
| 315 | 3300006881 | Ga0068865_100000405 | Ga0068865_10000040516 | 169 |
| 316 | 3300009093 | Ga0105240_10789122 | Ga0105240_107891222 | 169 |
| 317 | 3300009098 | Ga0105245_10004355 | Ga0105245_100043554 | 169 |
| 318 | 3300009148 | Ga0105243_10000267 | Ga0105243_1000026717 | 169 |
| 319 | 3300009176 | Ga0105242_10003607 | Ga0105242_1000360713 | 169 |
| 320 | 3300009553 | Ga0105249_10167332 | Ga0105249_101673322 | 169 |
| 321 | 3300011119 | Ga0105246_10001740 | Ga0105246_100017402 | 169 |
| 322 | 3300013102 | Ga0157371_10402985 | Ga0157371_104029852 | 169 |
| 323 | 3300013102 | Ga0157371_10644126 | Ga0157371_106441262 | 169 |
| 324 | 3300013104 | Ga0157370_10344192 | Ga0157370_103441923 | 169 |
| 325 | 3300013296 | Ga0157374_10002642 | Ga0157374_1000264210 | 169 |
| 326 | 3300013297 | Ga0157378_10003125 | Ga0157378_100031257 | 169 |
| 327 | 3300013306 | Ga0163162_11187945 | Ga0163162_111879452 | 169 |
| 328 | 3300013307 | Ga0157372_10069573 | Ga0157372_100695734 | 169 |
| 329 | 3300013308 | Ga0157375_10007514 | Ga0157375_100075147 | 169 |
| 330 | 3300014745 | Ga0157377_10033833 | Ga0157377_100338332 | 169 |
| 331 | 3300014969 | Ga0157376_10000595 | Ga0157376_1000059517 | 169 |
| 332 | 3300017792 | Ga0163161_10031491 | Ga0163161_100314912 | 169 |
| 333 | 3300025254 | Ga0209148_1000114 | Ga0209148_1000114125 | 169 |
| 334 | 3300025272 | Ga0209455_1011083 | Ga0209455_10110832 | 169 |
| 335 | 3300025735 | Ga0207713_1000673 | Ga0207713_10006739 | 169 |
| 336 | 3300025899 | Ga0207642_10144368 | Ga0207642_101443682 | 169 |
| 337 | 3300025900 | Ga0207710_10112457 | Ga0207710_101124572 | 169 |
| 338 | 3300025901 | Ga0207688_10264473 | Ga0207688_102644732 | 169 |
| 339 | 3300025904 | Ga0207647_10001049 | Ga0207647_100010492 | 169 |
| 340 | 3300025904 | Ga0207647_10047839 | Ga0207647_100478393 | 169 |
| 341 | 3300025907 | Ga0207645_10002995 | Ga0207645_1000299512 | 169 |
| 342 | 3300025909 | Ga0207705_10000014 | Ga0207705_1000001419 | 169 |
| 343 | 3300025909 | Ga0207705_10000583 | Ga0207705_1000058310 | 169 |
| 344 | 3300025914 | Ga0207671_10056309 | Ga0207671_100563092 | 169 |
| 345 | 3300025919 | Ga0207657_10011544 | Ga0207657_100115446 | 169 |
| 346 | 3300025919 | Ga0207657_10019472 | Ga0207657_100194722 | 169 |
| 347 | 3300025919 | Ga0207657_10048240 | Ga0207657_100482404 | 169 |
| 348 | 3300025919 | Ga0207657_10093522 | Ga0207657_100935222 | 169 |
| 349 | 3300025923 | Ga0207681_10000261 | Ga0207681_1000026127 | 169 |
| 350 | 3300025925 | Ga0207650_10015162 | Ga0207650_100151622 | 169 |
| 351 | 3300025927 | Ga0207687_10014408 | Ga0207687_100144082 | 169 |
| 352 | 3300025931 | Ga0207644_10192467 | Ga0207644_101924672 | 169 |
| 353 | 3300025932 | Ga0207690_10135992 | Ga0207690_101359922 | 169 |
| 354 | 3300025932 | Ga0207690_10145954 | Ga0207690_101459542 | 169 |
| 355 | 3300025932 | Ga0207690_10451606 | Ga0207690_104516062 | 169 |
| 356 | 3300025933 | Ga0207706_10056056 | Ga0207706_100560565 | 169 |
| 357 | 3300025934 | Ga0207686_10001120 | Ga0207686_1000112016 | 169 |
| 358 | 3300025935 | Ga0207709_10001754 | Ga0207709_100017545 | 169 |
| 359 | 3300025937 | Ga0207669_10111718 | Ga0207669_101117182 | 169 |
| 360 | 3300025938 | Ga0207704_10000002 | Ga0207704_10000002235 | 169 |
| 361 | 3300025940 | Ga0207691_10116756 | Ga0207691_101167563 | 169 |
| 362 | 3300025940 | Ga0207691_10421166 | Ga0207691_104211662 | 169 |
| 363 | 3300025941 | Ga0207711_10005137 | Ga0207711_100051372 | 169 |
| 364 | 3300025942 | Ga0207689_10003341 | Ga0207689_100033419 | 169 |
| 365 | 3300025949 | Ga0207667_10027645 | Ga0207667_100276455 | 169 |
| 366 | 3300025960 | Ga0207651_10000023 | Ga0207651_1000002316 | 169 |
| 367 | 3300026023 | Ga0207677_10000168 | Ga0207677_1000016814 | 169 |
| 368 | 3300026041 | Ga0207639_10343678 | Ga0207639_103436782 | 169 |
| 369 | 3300026041 | Ga0207639_11425977 | Ga0207639_114259772 | 169 |
| 370 | 3300026067 | Ga0207678_10746191 | Ga0207678_107461912 | 169 |
| 371 | 3300026078 | Ga0207702_10008154 | Ga0207702_100081544 | 169 |
| 372 | 3300026078 | Ga0207702_10276529 | Ga0207702_102765292 | 169 |
| 373 | 3300026089 | Ga0207648_10000120 | Ga0207648_1000012060 | 169 |
| 374 | 3300026116 | Ga0207674_10015972 | Ga0207674_100159727 | 169 |
| 375 | 3300026121 | Ga0207683_10078323 | Ga0207683_100783232 | 169 |
| 376 | 3300026142 | Ga0207698_10004199 | Ga0207698_100041992 | 169 |
| 377 | 3300028379 | Ga0268266_10000175 | Ga0268266_100001759 | 169 |
| 378 | 3300028381 | Ga0268264_10334712 | Ga0268264_103347122 | 169 |
| 379 | 3300041452 | Ga0451793_0561142 | Ga0451793_0561142_86_595 | 169 |
| 380 | 3300041459 | Ga0451800_1552524 | Ga0451800_1552524_1041_1550 | 169 |
| 381 | 3300041460 | Ga0451802_0082328 | Ga0451802_0082328_1497_2006 | 169 |
| 382 | 3300041462 | Ga0451806_036250 | Ga0451806_036250_413_922 | 169 |
| 383 | 3300042005 | Ga0439448_0001093 | Ga0439448_0001093_2171_2680 | 169 |
| 384 | 3300042157 | Ga0439458_0000368 | Ga0439458_0000368_3835_4344 | 169 |
| 385 | 3300044683 | Ga0466965_0014812 | Ga0466965_0014812_2230_2739 | 169 |
| 386 | 3300044684 | Ga0466966_0395534 | Ga0466966_0395534_187_696 | 169 |
| 387 | 3300044693 | Ga0466961_0008751 | Ga0466961_0008751_3649_4158 | 169 |
| 388 | 3300044693 | Ga0466961_0217487 | Ga0466961_0217487_477_986 | 169 |
| 389 | 3300044694 | Ga0466963_0004926 | Ga0466963_0004926_2105_2614 | 169 |
| 390 | 3300044706 | Ga0466964_0034449 | Ga0466964_0034449_640_1149 | 169 |
| 391 | 3300044706 | Ga0466964_0042035 | Ga0466964_0042035_43_552 | 169 |
| 392 | 3300044719 | Ga0466971_0003710 | Ga0466971_0003710_4079_4588 | 169 |
| 393 | 3300044719 | Ga0466971_0056132 | Ga0466971_0056132_106_615 | 169 |
| 394 | 3300044735 | Ga0466968_0004036 | Ga0466968_0004036_1132_1641 | 169 |
| 395 | 3300044735 | Ga0466968_0435826 | Ga0466968_0435826_56_565 | 169 |
| 396 | 3300044765 | Ga0466970_0029400 | Ga0466970_0029400_1298_1807 | 169 |
| 397 | 3300044842 | Ga0466957_0029141 | Ga0466957_0029141_702_1211 | 169 |
| 398 | 3300045049 | Ga0466959_0039310 | Ga0466959_0039310_2536_3045 | 169 |
| 399 | 3300045836 | Ga0466958_0003930 | Ga0466958_0003930_5483_5992 | 169 |
| 400 | 3300045836 | Ga0466958_0056184 | Ga0466958_0056184_153_662 | 169 |
| 401 | 3300045976 | Ga0466967_0010112 | Ga0466967_0010112_2175_2684 | 169 |
| 402 | 3300045976 | Ga0466967_0261982 | Ga0466967_0261982_106_615 | 169 |
| 403 | 3300048916 | Ga0496113_0965518 | Ga0496113_0965518_79_588 | 169 |
| 404 | 3300048920 | Ga0496117_0008571 | Ga0496117_0008571_7594_8103 | 169 |
| 405 | 3300048921 | Ga0496118_0011266 | Ga0496118_0011266_827_1336 | 169 |
| 406 | 3300048921 | Ga0496118_0047653 | Ga0496118_0047653_717_1226 | 169 |
| 407 | 3300048922 | Ga0496119_0022403 | Ga0496119_0022403_2297_2806 | 169 |
| 408 | 3300048923 | Ga0496120_0015483 | Ga0496120_0015483_2353_2862 | 169 |
| 409 | 3300048923 | Ga0496120_0089600 | Ga0496120_0089600_126_635 | 169 |
| 410 | 3300048924 | Ga0496121_0007252 | Ga0496121_0007252_1773_2282 | 169 |
| 411 | 3300048924 | Ga0496121_0028884 | Ga0496121_0028884_4081_4590 | 169 |
| 412 | 3300048925 | Ga0496122_0043107 | Ga0496122_0043107_1792_2301 | 169 |
| 413 | 3300048926 | Ga0496123_0005045 | Ga0496123_0005045_2228_2737 | 169 |
| 414 | 3300048927 | Ga0496124_0099729 | Ga0496124_0099729_293_802 | 169 |
| 415 | 3300048928 | Ga0496125_0162377 | Ga0496125_0162377_816_1325 | 169 |
| 416 | 3300048929 | Ga0496126_0442133 | Ga0496126_0442133_265_774 | 169 |
| 417 | 3300050489 | nmdc:mga03683_74173_c1 | nmdc:mga03683_74173_c1_304_813 | 169 |
| 418 | 3300050493 | nmdc:mga0k408_73927_c1 | nmdc:mga0k408_73927_c1_241_750 | 169 |
| 419 | 3300061719 | Ga0466962_0001969 | Ga0466962_0001969_2391_2900 | 169 |
| 420 | 3300061719 | Ga0466962_0176130 | Ga0466962_0176130_270_779 | 169 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kwy-assembly2.cif.gz_B | crystal structure of a putative lipoprotein (cc_3750) from caulobacter crescentus cb15 at 2.40 a resolution | 0.8616 | 32 | 163 |
| 4kwy-assembly2.cif.gz_B | crystal structure of a putative lipoprotein (cc_3750) from caulobacter crescentus cb15 at 2.40 a resolution | 0.8433 | 32 | 163 |
| 4kwy-assembly1.cif.gz_A | crystal structure of a putative lipoprotein (cc_3750) from caulobacter crescentus cb15 at 2.40 a resolution | 0.8431 | 32 | 165 |
| 4kwy-assembly1.cif.gz_A | crystal structure of a putative lipoprotein (cc_3750) from caulobacter crescentus cb15 at 2.40 a resolution | 0.8202 | 32 | 165 |
| 5tse-assembly2.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8007 | 41 | 164 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kwyB00 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain | 0.8169 | 32 | 163 | 3.30.160.150 |
| 5tseB00 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain | 0.8007 | 41 | 164 | 3.30.160.150 |
| 4kwyB00 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain | 0.7994 | 32 | 163 | 3.30.160.150 |
| 3bf2A00 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain | 0.7417 | 41 | 163 | 3.30.160.150 |
| 5tseB00 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain | 0.7293 | 41 | 164 | 3.30.160.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350KZ18-F1-model_v4 | deleted | 0.9806 | 71 | 165 |
|
| AF-A0A3B9K392-F1-model_v4 | Lipoprotein | 0.9454 | 34 | 165 |
|
| AF-A0A1F2YM04-F1-model_v4 | LPS-assembly lipoprotein | 0.944 | 35 | 167 |
GO:0019867
GO:0043165 |
| AF-A0A2S6U8S6-F1-model_v4 | Uncharacterized protein | 0.9426 | 38 | 161 |
GO:0019867
GO:0043165 |
| AF-A0A840YZX4-F1-model_v4 | LPS-assembly lipoprotein | 0.9355 | 19 | 165 |
GO:0019867
GO:0043165 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar