F439526

General Info

Members Datasets Scaffolds Average Seq Length
419 227 838 140

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_12682467|Ga0157372_126824671
Length 145
Sequence MNLKPRRRADPELNMISLIDVVLMIVVFFVLSSQFINEGRVHVRLPQAQGVPNANKQAEPIIVSVTQTGSYRVNDKDLINSSPDTLRAALIKETGSDRSKRVTVRADGRATHQSVITAMDVLGRLGFRAISIATVNESGGAPGAN

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
135 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
157 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
158 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
159 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
160 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
161 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
215 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
216 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
217 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
218 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
219 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
220 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
221 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
222 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
223 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
224 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
225 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.53
Nodule 0
Rhizoplane 3.34
Rhizosphere 87.35
Stem 0
Stem Tuber 0
Unclassified 20.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_12682467 3300013307 Unclassified 572
2 Ga0070683_100041605 3300005329 Bacteria 4228
3 Ga0070670_100109213 3300005331 Bacteria 2384
4 Ga0070677_10004424 3300005333 Bacteria 4590
5 Ga0070677_10028954 3300005333 Bacteria 2097
6 Ga0070677_10191898 3300005333 Bacteria 980
7 Ga0068869_100218344 3300005334 Bacteria 1510
8 Ga0068869_100387805 3300005334 Bacteria 1146
9 Ga0070666_10053121 3300005335 Bacteria 2732
10 Ga0070680_100126046 3300005336 Bacteria 2139
11 Ga0070682_100040310 3300005337 Bacteria 2873
12 Ga0070682_100093136 3300005337 Unclassified 1975
13 Ga0070682_100762454 3300005337 Bacteria 782
14 Ga0070689_100001759 3300005340 Bacteria 13876
15 Ga0070689_100917008 3300005340 Unclassified 776
16 Ga0070691_10119994 3300005341 Unclassified 1323
17 Ga0070691_10180023 3300005341 Unclassified 1100
18 Ga0070691_10476645 3300005341 Bacteria 717
19 Ga0070687_100182796 3300005343 Bacteria 1257
20 Ga0070692_10155505 3300005345 Bacteria 1306
21 Ga0070668_100017248 3300005347 Bacteria 5405
22 Ga0070668_101300572 3300005347 Unclassified 661
23 Ga0070669_100029453 3300005353 Bacteria 3957
24 Ga0070669_100093326 3300005353 Bacteria 2260
25 Ga0070675_100025239 3300005354 Bacteria 4764
26 Ga0070675_100109755 3300005354 Bacteria 2332
27 Ga0070675_100430413 3300005354 Bacteria 1181
28 Ga0070675_101031547 3300005354 Bacteria 755
29 Ga0070675_101200174 3300005354 Unclassified 698
30 Ga0070671_100010336 3300005355 Bacteria 7487
31 Ga0070671_100507379 3300005355 Unclassified 1038
32 Ga0070671_100608494 3300005355 Bacteria 945
33 Ga0070674_100237035 3300005356 Unclassified 1426
34 Ga0070674_100522323 3300005356 Bacteria 992
35 Ga0070673_100018627 3300005364 Bacteria 4965
36 Ga0070673_100032751 3300005364 Bacteria 3918
37 Ga0070673_100137701 3300005364 Bacteria 2057
38 Ga0070673_100365999 3300005364 Bacteria 1283
39 Ga0070688_100062354 3300005365 Unclassified 2360
40 Ga0070688_100218081 3300005365 Bacteria 1343
41 Ga0070667_100000225 3300005367 Bacteria 65088
42 Ga0070667_100027724 3300005367 Bacteria 4713
43 Ga0070713_100327314 3300005436 Bacteria 1417
44 Ga0070701_10056453 3300005438 Bacteria 2054
45 Ga0070705_100009934 3300005440 Bacteria 4749
46 Ga0070705_101039118 3300005440 Unclassified 667
47 Ga0070700_100007840 3300005441 Bacteria 5790
48 Ga0070700_100141868 3300005441 Bacteria 1634
49 Ga0070700_100147465 3300005441 Unclassified 1605
50 Ga0070700_100172216 3300005441 Bacteria 1500
51 Ga0070694_100068208 3300005444 Bacteria 2444
52 Ga0070663_100342733 3300005455 Bacteria 1208
53 Ga0070678_100084633 3300005456 Unclassified 2415
54 Ga0070678_101281275 3300005456 Bacteria 681
55 Ga0070662_100770332 3300005457 Bacteria 817
56 Ga0070681_10082091 3300005458 Bacteria 3179
57 Ga0068867_100267759 3300005459 Bacteria 1396
58 Ga0068867_100390721 3300005459 Bacteria 1171
59 Ga0070685_10035471 3300005466 Unclassified 2814
60 Ga0070685_10265601 3300005466 Bacteria 1143
61 Ga0070685_10509262 3300005466 Bacteria 853
62 Ga0070679_100554280 3300005530 Bacteria 1093
63 Ga0070684_100099231 3300005535 Bacteria 2599
64 Ga0070672_100012463 3300005543 Bacteria 5970
65 Ga0070672_100039648 3300005543 Unclassified 3609
66 Ga0070672_100151431 3300005543 Bacteria 1919
67 Ga0070672_100811444 3300005543 Bacteria 824
68 Ga0070686_100007188 3300005544 Bacteria 6202
69 Ga0070686_100290660 3300005544 Bacteria 1209
70 Ga0070686_100645708 3300005544 Bacteria 838
71 Ga0070695_100271793 3300005545 Bacteria 1242
72 Ga0070696_100163838 3300005546 Bacteria 1640
73 Ga0070693_100115839 3300005547 Bacteria 1656
74 Ga0070693_100172013 3300005547 Bacteria 1388
75 Ga0070665_100002559 3300005548 Bacteria 19953
76 Ga0070665_100005723 3300005548 Bacteria 12762
77 Ga0070665_100008936 3300005548 Bacteria 10152
78 Ga0070665_100351631 3300005548 Bacteria 1479
79 Ga0070665_100375013 3300005548 Bacteria 1430
80 Ga0070665_101143353 3300005548 Bacteria 790
81 Ga0070704_100193357 3300005549 Bacteria 1637
82 Ga0070704_101262731 3300005549 Bacteria 675
83 Ga0068855_100040150 3300005563 Bacteria 5555
84 Ga0068854_100645398 3300005578 Bacteria 908
85 Ga0070702_100004705 3300005615 Bacteria 6263
86 Ga0068859_100000678 3300005617 Bacteria 34157
87 Ga0068859_100211935 3300005617 Bacteria 2024
88 Ga0068859_100331546 3300005617 Bacteria 1616
89 Ga0068859_100354260 3300005617 Unclassified 1563
90 Ga0068859_100579038 3300005617 Bacteria 1216
91 Ga0068859_100680478 3300005617 Bacteria 1120
92 Ga0068859_103064336 3300005617 Unclassified 510
93 Ga0068864_100107028 3300005618 Unclassified 2487
94 Ga0068861_100005770 3300005719 Bacteria 8399
95 Ga0068861_100040810 3300005719 Unclassified 3473
96 Ga0068861_100236065 3300005719 Bacteria 1553
97 Ga0068861_100444434 3300005719 Bacteria 1160
98 Ga0068863_100008716 3300005841 Bacteria 9909
99 Ga0068863_100266596 3300005841 Bacteria 1657
100 Ga0068863_100309974 3300005841 Bacteria 1532
101 Ga0068863_100522375 3300005841 Bacteria 1170
102 Ga0068858_100009954 3300005842 Bacteria 9032
103 Ga0068858_100061885 3300005842 Bacteria 3461
104 Ga0068858_100306215 3300005842 Bacteria 1517
105 Ga0068858_100772244 3300005842 Bacteria 937
106 Ga0068858_100870414 3300005842 Unclassified 880
107 Ga0068860_100005616 3300005843 Bacteria 12674
108 Ga0068860_100046088 3300005843 Unclassified 4158
109 Ga0068860_100336612 3300005843 Bacteria 1483
110 Ga0068862_100057273 3300005844 Bacteria 3342
111 Ga0068862_100064861 3300005844 Bacteria 3145
112 Ga0068862_100235066 3300005844 Bacteria 1664
113 Ga0068862_102052715 3300005844 Unclassified 583
114 Ga0081455_10000099 3300005937 Bacteria 95044
115 Ga0081455_10002524 3300005937 Bacteria 21743
116 Ga0081539_10000004 3300005985 Bacteria 555600
117 Ga0097621_100034463 3300006237 Bacteria 4039
118 Ga0097621_100046503 3300006237 Bacteria 3512
119 Ga0097621_100105223 3300006237 Bacteria 2379
120 Ga0097621_100141949 3300006237 Bacteria 2053
121 Ga0097621_100390093 3300006237 Bacteria 1245
122 Ga0097621_100408850 3300006237 Bacteria 1216
123 Ga0068871_100107441 3300006358 Unclassified 2344
124 Ga0068871_100142293 3300006358 Bacteria 2040
125 Ga0068871_100952265 3300006358 Bacteria 798
126 Ga0068871_101115327 3300006358 Bacteria 738
127 Ga0068865_100764322 3300006881 Bacteria 831
128 Ga0097620_100000678 3300006931 Bacteria 34157
129 Ga0097620_100211946 3300006931 Bacteria 2024
130 Ga0097620_100331514 3300006931 Bacteria 1616
131 Ga0097620_100354245 3300006931 Unclassified 1563
132 Ga0097620_100579022 3300006931 Bacteria 1216
133 Ga0097620_100680393 3300006931 Bacteria 1120
134 Ga0097620_103064817 3300006931 Unclassified 510
135 Ga0105250_10016079 3300009092 Bacteria 3053
136 Ga0105240_10001356 3300009093 Bacteria 42000
137 Ga0105240_10025657 3300009093 Bacteria 7741
138 Ga0105240_10060106 3300009093 Bacteria 4739
139 Ga0105240_10623763 3300009093 Bacteria 1185
140 Ga0111539_11273581 3300009094 Bacteria 853
141 Ga0105247_10000203 3300009101 Bacteria 58331
142 Ga0105247_10005377 3300009101 Bacteria 8070
143 Ga0105243_10362394 3300009148 Bacteria 1335
144 Ga0105248_10062707 3300009177 Bacteria 4174
145 Ga0105248_10170171 3300009177 Bacteria 2455
146 Ga0105248_10520347 3300009177 Bacteria 1341
147 Ga0105237_10007703 3300009545 Bacteria 11765
148 Ga0105237_10538947 3300009545 Bacteria 1174
149 Ga0105238_10595483 3300009551 Unclassified 1113
150 Ga0105238_10607228 3300009551 Bacteria 1102
151 Ga0105249_10197841 3300009553 Bacteria 1965
152 Ga0105249_10923228 3300009553 Bacteria 940
153 Ga0105239_10025743 3300010375 Bacteria 6480
154 Ga0157369_10379842 3300013105 Bacteria 1466
155 Ga0157374_10192509 3300013296 Bacteria 1995
156 Ga0157374_10506835 3300013296 Unclassified 1212
157 Ga0163162_10105209 3300013306 Bacteria 2917
158 Ga0163162_10452539 3300013306 Bacteria 1416
159 Ga0163162_10881512 3300013306 Bacteria 1009
160 Ga0157375_11066217 3300013308 Bacteria 945
161 Ga0157375_11418242 3300013308 Unclassified 818
162 Ga0163163_10037590 3300014325 Bacteria 4711
163 Ga0163163_10149339 3300014325 Bacteria 2381
164 Ga0163163_10196849 3300014325 Bacteria 2063
165 Ga0163163_11344490 3300014325 Unclassified 776
166 Ga0157380_10013957 3300014326 Bacteria 5866
167 Ga0157380_10043445 3300014326 Bacteria 3519
168 Ga0157380_10049283 3300014326 Bacteria 3321
169 Ga0157380_10582388 3300014326 Unclassified 1104
170 Ga0157380_11599392 3300014326 Bacteria 707
171 Ga0157380_11727883 3300014326 Bacteria 684
172 Ga0157379_10012507 3300014968 Bacteria 7412
173 Ga0157379_10017199 3300014968 Bacteria 6370
174 Ga0157379_10197818 3300014968 Bacteria 1817
175 Ga0157379_10627335 3300014968 Unclassified 1005
176 Ga0157376_10028705 3300014969 Bacteria 4425
177 Ga0157376_10067244 3300014969 Bacteria 3031
178 Ga0157376_10314671 3300014969 Bacteria 1486
179 Ga0157376_10625565 3300014969 Unclassified 1074
180 Ga0157376_10823123 3300014969 Bacteria 942
181 Ga0157376_12089010 3300014969 Bacteria 605
182 Ga0157376_12469181 3300014969 Unclassified 559
183 Ga0163161_10093111 3300017792 Bacteria 2232
184 Ga0163161_11082972 3300017792 Bacteria 688
185 Ga0213873_10009367 3300021358 Bacteria 2031
186 Ga0213876_10270367 3300021384 Bacteria 903
187 Ga0207696_1028536 3300025711 Bacteria 1711
188 Ga0207682_10006227 3300025893 Bacteria 4820
189 Ga0207682_10022187 3300025893 Bacteria 2500
190 Ga0207682_10118125 3300025893 Bacteria 1174
191 Ga0207642_10313543 3300025899 Bacteria 914
192 Ga0207710_10001184 3300025900 Bacteria 13248
193 Ga0207710_10096916 3300025900 Bacteria 1387
194 Ga0207688_10399782 3300025901 Bacteria 852
195 Ga0207680_10003207 3300025903 Bacteria 7693
196 Ga0207680_10250096 3300025903 Bacteria 1224
197 Ga0207699_10246238 3300025906 Unclassified 1230
198 Ga0207645_10091803 3300025907 Bacteria 1953
199 Ga0207645_10147046 3300025907 Bacteria 1537
200 Ga0207643_10057599 3300025908 Bacteria 2212
201 Ga0207707_10091186 3300025912 Bacteria 2664
202 Ga0207695_10036750 3300025913 Bacteria 5291
203 Ga0207695_10175048 3300025913 Bacteria 2069
204 Ga0207695_10530179 3300025913 Unclassified 1059
205 Ga0207671_10381508 3300025914 Unclassified 1120
206 Ga0207663_10097052 3300025916 Bacteria 1970
207 Ga0207660_10087615 3300025917 Bacteria 2301
208 Ga0207660_11727710 3300025917 Unclassified 503
209 Ga0207662_10127639 3300025918 Bacteria 1600
210 Ga0207681_10346384 3300025923 Bacteria 1188
211 Ga0207694_10388118 3300025924 Unclassified 1160
212 Ga0207650_10611385 3300025925 Bacteria 917
213 Ga0207659_10138451 3300025926 Unclassified 1887
214 Ga0207659_10254133 3300025926 Bacteria 1427
215 Ga0207659_10478401 3300025926 Bacteria 1052
216 Ga0207700_10047976 3300025928 Bacteria 3169
217 Ga0207644_10196181 3300025931 Bacteria 1590
218 Ga0207644_10200575 3300025931 Bacteria 1573
219 Ga0207706_10120293 3300025933 Bacteria 2309
220 Ga0207706_10877881 3300025933 Unclassified 758
221 Ga0207709_10220189 3300025935 Bacteria 1368
222 Ga0207670_10002801 3300025936 Bacteria 9188
223 Ga0207670_10756196 3300025936 Unclassified 807
224 Ga0207669_10011932 3300025937 Unclassified 4251
225 Ga0207669_10089768 3300025937 Bacteria 1996
226 Ga0207669_10112217 3300025937 Bacteria 1830
227 Ga0207704_10105969 3300025938 Bacteria 1887
228 Ga0207704_10152475 3300025938 Bacteria 1633
229 Ga0207704_10980271 3300025938 Unclassified 714
230 Ga0207691_10010585 3300025940 Bacteria 8847
231 Ga0207691_10031214 3300025940 Bacteria 4975
232 Ga0207691_10042538 3300025940 Bacteria 4188
233 Ga0207691_10565869 3300025940 Bacteria 963
234 Ga0207711_10263685 3300025941 Bacteria 1584
235 Ga0207711_10454957 3300025941 Bacteria 1192
236 Ga0207689_10257033 3300025942 Bacteria 1445
237 Ga0207689_10411141 3300025942 Bacteria 1128
238 Ga0207661_10104043 3300025944 Bacteria 2390
239 Ga0207679_10470469 3300025945 Bacteria 1117
240 Ga0207667_10001105 3300025949 Bacteria 34029
241 Ga0207651_10020249 3300025960 Bacteria 4011
242 Ga0207651_10078487 3300025960 Bacteria 2368
243 Ga0207651_10749129 3300025960 Bacteria 863
244 Ga0207712_10069019 3300025961 Bacteria 2535
245 Ga0207712_10623213 3300025961 Unclassified 935
246 Ga0207668_10154303 3300025972 Bacteria 1782
247 Ga0207668_11031592 3300025972 Bacteria 736
248 Ga0207640_10277417 3300025981 Bacteria 1315
249 Ga0207658_10009108 3300025986 Bacteria 6733
250 Ga0207658_10014994 3300025986 Bacteria 5314
251 Ga0207658_10339236 3300025986 Bacteria 1306
252 Ga0207703_10000240 3300026035 Bacteria 62235
253 Ga0207703_10054253 3300026035 Bacteria 3259
254 Ga0207703_10362825 3300026035 Bacteria 1336
255 Ga0207703_10745833 3300026035 Unclassified 933
256 Ga0207678_10392984 3300026067 Bacteria 1200
257 Ga0207678_10401209 3300026067 Bacteria 1187
258 Ga0207708_10010373 3300026075 Bacteria 6916
259 Ga0207708_10015677 3300026075 Bacteria 5686
260 Ga0207708_10085859 3300026075 Bacteria 2421
261 Ga0207708_10097980 3300026075 Unclassified 2266
262 Ga0207708_10335579 3300026075 Bacteria 1237
263 Ga0207641_10003471 3300026088 Bacteria 13966
264 Ga0207641_10106626 3300026088 Bacteria 2477
265 Ga0207641_10233866 3300026088 Bacteria 1709
266 Ga0207641_10283039 3300026088 Bacteria 1560
267 Ga0207648_10089163 3300026089 Bacteria 2694
268 Ga0207648_10118217 3300026089 Bacteria 2329
269 Ga0207648_10371801 3300026089 Bacteria 1291
270 Ga0207676_10018611 3300026095 Bacteria 5054
271 Ga0207676_10211732 3300026095 Unclassified 1720
272 Ga0207675_100005471 3300026118 Bacteria 12162
273 Ga0207675_100010106 3300026118 Bacteria 8844
274 Ga0207675_100140093 3300026118 Bacteria 2297
275 Ga0207675_100264493 3300026118 Bacteria 1668
276 Ga0207675_100591960 3300026118 Bacteria 1111
277 Ga0207675_100989480 3300026118 Bacteria 859
278 Ga0207675_100996691 3300026118 Bacteria 856
279 Ga0207683_10017843 3300026121 Bacteria 6053
280 Ga0207683_10190031 3300026121 Bacteria 1864
281 Ga0207698_10315120 3300026142 Bacteria 1462
282 Ga0207428_10097555 3300027907 Bacteria 2274
283 Ga0268266_10005167 3300028379 Bacteria 12298
284 Ga0268266_10158598 3300028379 Bacteria 2045
285 Ga0268266_10534341 3300028379 Bacteria 1122
286 Ga0268266_10563342 3300028379 Bacteria 1092
287 Ga0268266_10865046 3300028379 Unclassified 874
288 Ga0268266_10954466 3300028379 Bacteria 829
289 Ga0268266_11358563 3300028379 Bacteria 686
290 Ga0268265_10555052 3300028380 Unclassified 1091
291 Ga0268264_10012865 3300028381 Bacteria 6884
292 Ga0268264_10116756 3300028381 Bacteria 2346
293 Ga0268264_11187266 3300028381 Unclassified 772
294 Ga0307515_10001344 3300028794 Bacteria 55675
295 Ga0307515_10172914 3300028794 Unclassified 2144
296 Ga0307515_10270397 3300028794 Bacteria 1422
297 Ga0265338_10030545 3300028800 Bacteria 5305
298 Ga0265325_10003824 3300031241 Bacteria 9698
299 Ga0265340_10038876 3300031247 Bacteria 2351
300 Ga0265340_10109027 3300031247 Bacteria 1281
301 Ga0265331_10000928 3300031250 Bacteria 23492
302 Ga0307513_10081982 3300031456 Bacteria 3322
303 Ga0307509_10267880 3300031507 Bacteria 1478
304 Ga0307514_10349180 3300031649 Bacteria 790
305 Ga0265314_10011687 3300031711 Bacteria 7224
306 Ga0307405_10074416 3300031731 Bacteria 2197
307 Ga0307413_10005857 3300031824 Bacteria 5542
308 Ga0307413_11708160 3300031824 Bacteria 561
309 Ga0307410_10003267 3300031852 Bacteria 8092
310 Ga0307407_10004602 3300031903 Bacteria 5881
311 Ga0307412_10933569 3300031911 Unclassified 763
312 Ga0307409_100003444 3300031995 Bacteria 8592
313 Ga0307409_100041475 3300031995 Bacteria 3438
314 Ga0307409_100046191 3300031995 Unclassified 3295
315 Ga0307409_100058168 3300031995 Bacteria 3001
316 Ga0307414_10634377 3300032004 Unclassified 962
317 Ga0307411_10017994 3300032005 Bacteria 4044
318 Ga0307411_11292540 3300032005 Bacteria 664
319 Ga0307415_102222376 3300032126 Unclassified 537
320 Ga0373923_0616892 3300035111 Unclassified 535
321 Ga0373957_0093948 3300035120 Bacteria 1195
322 Ga0373933_0159474 3300035724 Unclassified 1432
323 Ga0373937_0494442 3300036401 Bacteria 1162
324 Ga0373937_0774258 3300036401 Bacteria 907
325 Ga0373925_0148170 3300037068 Bacteria 1841
326 Ga0436365_0936942 3300039437 Bacteria 1962
327 Ga0436360_0720278 3300039438 Bacteria 5147
328 Ga0436361_1037373 3300039447 Bacteria 1084
329 Ga0436363_0054011 3300039450 Bacteria 3675
330 Ga0436363_0374424 3300039450 Bacteria 1055
331 Ga0436363_1455644 3300039450 Bacteria 2870
332 Ga0436362_1215189 3300039453 Bacteria 2070
333 Ga0451793_0988062 3300041452 Bacteria 1113
334 Ga0451797_0186166 3300041453 Bacteria 830
335 Ga0451804_0366137 3300041463 Bacteria 686
336 Ga0451804_0836176 3300041463 Bacteria 2696
337 Ga0451807_1056072 3300041486 Bacteria 958
338 Ga0451807_1755242 3300041486 Unclassified 990
339 Ga0451849_0029079 3300041505 Bacteria 912
340 Ga0451851_1295510 3300041507 Bacteria 813
341 Ga0451853_1549191 3300041512 Bacteria 2119
342 Ga0439445_0279700 3300042004 Bacteria 501
343 Ga0439458_0118167 3300042157 Bacteria 697
344 Ga0466969_0001844 3300044656 Bacteria 11329
345 Ga0466972_0026682 3300044658 Unclassified 2862
346 Ga0466966_0741510 3300044684 Bacteria 592
347 Ga0466968_0103741 3300044735 Bacteria 1272
348 Ga0466960_0086798 3300044901 Bacteria 1587
349 Ga0466959_0514553 3300045049 Bacteria 808
350 Ga0495591_039347 3300046458 Bacteria 1356
351 Ga0495638_0016123 3300046460 Bacteria 5007
352 Ga0495580_0524063 3300046472 Unclassified 789
353 Ga0495639_0270791 3300046475 Unclassified 843
354 Ga0495616_0237182 3300046513 Unclassified 788
355 Ga0495620_0048562 3300046515 Unclassified 1821
356 Ga0495630_1029297 3300046517 Unclassified 625
357 Ga0495632_0151965 3300046519 Bacteria 1070
358 Ga0495644_0004729 3300046523 Bacteria 5350
359 Ga0495663_0165420 3300046525 Unclassified 760
360 Ga0495586_0286067 3300046535 Bacteria 944
361 Ga0495621_0006718 3300046539 Bacteria 3372
362 Ga0495633_0154007 3300046558 Unclassified 1061
363 Ga0495633_0248098 3300046558 Bacteria 813
364 Ga0495656_0463669 3300046615 Unclassified 668
365 Ga0495611_0209009 3300046648 Unclassified 909
366 Ga0495625_0083876 3300046660 Bacteria 2214
367 Ga0495625_0556687 3300046660 Bacteria 694
368 Ga0495647_0036634 3300046681 Bacteria 1847
369 Ga0495658_0125612 3300046683 Bacteria 1556
370 Ga0495669_0122164 3300046684 Bacteria 1221
371 Ga0495624_0253684 3300046690 Unclassified 1064
372 Ga0495649_0027891 3300046694 Bacteria 3131
373 Ga0495672_0300918 3300047320 Bacteria 760
374 Ga0495673_0158762 3300047469 Unclassified 869
375 Ga0495686_0057276 3300047472 Bacteria 2433
376 Ga0495686_0232783 3300047472 Bacteria 1042
377 Ga0496102_0003596 3300048905 Bacteria 13131
378 Ga0496103_0170372 3300048906 Bacteria 1398
379 Ga0496106_0155437 3300048909 Bacteria 1806
380 Ga0496107_0386877 3300048910 Bacteria 1040
381 Ga0496108_0533099 3300048911 Bacteria 1025
382 Ga0496108_0651744 3300048911 Bacteria 915
383 Ga0496112_0012694 3300048915 Bacteria 7748
384 Ga0496114_0133570 3300048917 Bacteria 2145
385 Ga0496119_0088742 3300048922 Bacteria 1762
386 Ga0496121_0000522 3300048924 Bacteria 73298
387 Ga0496125_0005091 3300048928 Bacteria 14801
388 Ga0496125_0052778 3300048928 Bacteria 3341
389 Ga0496126_0016695 3300048929 Bacteria 7335
390 Ga0496126_0192612 3300048929 Unclassified 1726
391 Ga0501036_0496147 3300049572 Bacteria 1016
392 Ga0501039_0490342 3300049575 Bacteria 965
393 Ga0501039_0500452 3300049575 Unclassified 954
394 Ga0501042_0546707 3300049578 Unclassified 842
395 Ga0501071_0817467 3300049587 Unclassified 719
396 Ga0501076_0523191 3300049592 Bacteria 978
397 Ga0501077_1077793 3300049593 Bacteria 517
398 Ga0501045_1135415 3300049824 Unclassified 571
399 nmdc:mga08y16_35852_c1 3300050511 Bacteria 5210
400 nmdc:mga08y16_575620_c1 3300050511 Bacteria 1137
401 Ga0500583_0025262 3300053092 Unclassified 2534
402 Ga0500583_0105381 3300053092 Unclassified 1384
403 Ga0500583_0535005 3300053092 Bacteria 546
404 Ga0500651_0141955 3300053093 Unclassified 1447
405 Ga0500641_0006329 3300053096 Bacteria 4205
406 Ga0500556_0161884 3300053104 Unclassified 883
407 Ga0500562_015822 3300053108 Bacteria 1937
408 Ga0500595_013509 3300053119 Bacteria 3127
409 Ga0500642_0223040 3300053130 Unclassified 873
410 Ga0500642_0363508 3300053130 Unclassified 639
411 Ga0500652_049796 3300053131 Unclassified 1708
412 Ga0500652_097605 3300053131 Bacteria 1228
413 Ga0500568_0110183 3300053139 Bacteria 1029
414 Ga0500577_0031569 3300053142 Unclassified 1855
415 Ga0500588_0018164 3300053146 Unclassified 1848
416 Ga0500589_333333 3300053147 Bacteria 526
417 Ga0500622_0038971 3300053156 Bacteria 2478
418 Ga0500622_0043601 3300053156 Unclassified 2326
419 Ga0500637_0369052 3300053178 Unclassified 757
420 Ga0157372_12682467
421 Ga0070683_100041605
422 Ga0070670_100109213
423 Ga0070677_10004424
424 Ga0070677_10028954
425 Ga0070677_10191898
426 Ga0068869_100218344
427 Ga0068869_100387805
428 Ga0070666_10053121
429 Ga0070680_100126046
430 Ga0070682_100040310
431 Ga0070682_100093136
432 Ga0070682_100762454
433 Ga0070689_100001759
434 Ga0070689_100917008
435 Ga0070691_10119994
436 Ga0070691_10180023
437 Ga0070691_10476645
438 Ga0070687_100182796
439 Ga0070692_10155505
440 Ga0070668_100017248
441 Ga0070668_101300572
442 Ga0070669_100029453
443 Ga0070669_100093326
444 Ga0070675_100025239
445 Ga0070675_100109755
446 Ga0070675_100430413
447 Ga0070675_101031547
448 Ga0070675_101200174
449 Ga0070671_100010336
450 Ga0070671_100507379
451 Ga0070671_100608494
452 Ga0070674_100237035
453 Ga0070674_100522323
454 Ga0070673_100018627
455 Ga0070673_100032751
456 Ga0070673_100137701
457 Ga0070673_100365999
458 Ga0070688_100062354
459 Ga0070688_100218081
460 Ga0070667_100000225
461 Ga0070667_100027724
462 Ga0070713_100327314
463 Ga0070701_10056453
464 Ga0070705_100009934
465 Ga0070705_101039118
466 Ga0070700_100007840
467 Ga0070700_100141868
468 Ga0070700_100147465
469 Ga0070700_100172216
470 Ga0070694_100068208
471 Ga0070663_100342733
472 Ga0070678_100084633
473 Ga0070678_101281275
474 Ga0070662_100770332
475 Ga0070681_10082091
476 Ga0068867_100267759
477 Ga0068867_100390721
478 Ga0070685_10035471
479 Ga0070685_10265601
480 Ga0070685_10509262
481 Ga0070679_100554280
482 Ga0070684_100099231
483 Ga0070672_100012463
484 Ga0070672_100039648
485 Ga0070672_100151431
486 Ga0070672_100811444
487 Ga0070686_100007188
488 Ga0070686_100290660
489 Ga0070686_100645708
490 Ga0070695_100271793
491 Ga0070696_100163838
492 Ga0070693_100115839
493 Ga0070693_100172013
494 Ga0070665_100002559
495 Ga0070665_100005723
496 Ga0070665_100008936
497 Ga0070665_100351631
498 Ga0070665_100375013
499 Ga0070665_101143353
500 Ga0070704_100193357
501 Ga0070704_101262731
502 Ga0068855_100040150
503 Ga0068854_100645398
504 Ga0070702_100004705
505 Ga0068859_100000678
506 Ga0068859_100211935
507 Ga0068859_100331546
508 Ga0068859_100354260
509 Ga0068859_100579038
510 Ga0068859_100680478
511 Ga0068859_103064336
512 Ga0068864_100107028
513 Ga0068861_100005770
514 Ga0068861_100040810
515 Ga0068861_100236065
516 Ga0068861_100444434
517 Ga0068863_100008716
518 Ga0068863_100266596
519 Ga0068863_100309974
520 Ga0068863_100522375
521 Ga0068858_100009954
522 Ga0068858_100061885
523 Ga0068858_100306215
524 Ga0068858_100772244
525 Ga0068858_100870414
526 Ga0068860_100005616
527 Ga0068860_100046088
528 Ga0068860_100336612
529 Ga0068862_100057273
530 Ga0068862_100064861
531 Ga0068862_100235066
532 Ga0068862_102052715
533 Ga0081455_10000099
534 Ga0081455_10002524
535 Ga0081539_10000004
536 Ga0097621_100034463
537 Ga0097621_100046503
538 Ga0097621_100105223
539 Ga0097621_100141949
540 Ga0097621_100390093
541 Ga0097621_100408850
542 Ga0068871_100107441
543 Ga0068871_100142293
544 Ga0068871_100952265
545 Ga0068871_101115327
546 Ga0068865_100764322
547 Ga0097620_100000678
548 Ga0097620_100211946
549 Ga0097620_100331514
550 Ga0097620_100354245
551 Ga0097620_100579022
552 Ga0097620_100680393
553 Ga0097620_103064817
554 Ga0105250_10016079
555 Ga0105240_10001356
556 Ga0105240_10025657
557 Ga0105240_10060106
558 Ga0105240_10623763
559 Ga0111539_11273581
560 Ga0105247_10000203
561 Ga0105247_10005377
562 Ga0105243_10362394
563 Ga0105248_10062707
564 Ga0105248_10170171
565 Ga0105248_10520347
566 Ga0105237_10007703
567 Ga0105237_10538947
568 Ga0105238_10595483
569 Ga0105238_10607228
570 Ga0105249_10197841
571 Ga0105249_10923228
572 Ga0105239_10025743
573 Ga0157369_10379842
574 Ga0157374_10192509
575 Ga0157374_10506835
576 Ga0163162_10105209
577 Ga0163162_10452539
578 Ga0163162_10881512
579 Ga0157375_11066217
580 Ga0157375_11418242
581 Ga0163163_10037590
582 Ga0163163_10149339
583 Ga0163163_10196849
584 Ga0163163_11344490
585 Ga0157380_10013957
586 Ga0157380_10043445
587 Ga0157380_10049283
588 Ga0157380_10582388
589 Ga0157380_11599392
590 Ga0157380_11727883
591 Ga0157379_10012507
592 Ga0157379_10017199
593 Ga0157379_10197818
594 Ga0157379_10627335
595 Ga0157376_10028705
596 Ga0157376_10067244
597 Ga0157376_10314671
598 Ga0157376_10625565
599 Ga0157376_10823123
600 Ga0157376_12089010
601 Ga0157376_12469181
602 Ga0163161_10093111
603 Ga0163161_11082972
604 Ga0213873_10009367
605 Ga0213876_10270367
606 Ga0207696_1028536
607 Ga0207682_10006227
608 Ga0207682_10022187
609 Ga0207682_10118125
610 Ga0207642_10313543
611 Ga0207710_10001184
612 Ga0207710_10096916
613 Ga0207688_10399782
614 Ga0207680_10003207
615 Ga0207680_10250096
616 Ga0207699_10246238
617 Ga0207645_10091803
618 Ga0207645_10147046
619 Ga0207643_10057599
620 Ga0207707_10091186
621 Ga0207695_10036750
622 Ga0207695_10175048
623 Ga0207695_10530179
624 Ga0207671_10381508
625 Ga0207663_10097052
626 Ga0207660_10087615
627 Ga0207660_11727710
628 Ga0207662_10127639
629 Ga0207681_10346384
630 Ga0207694_10388118
631 Ga0207650_10611385
632 Ga0207659_10138451
633 Ga0207659_10254133
634 Ga0207659_10478401
635 Ga0207700_10047976
636 Ga0207644_10196181
637 Ga0207644_10200575
638 Ga0207706_10120293
639 Ga0207706_10877881
640 Ga0207709_10220189
641 Ga0207670_10002801
642 Ga0207670_10756196
643 Ga0207669_10011932
644 Ga0207669_10089768
645 Ga0207669_10112217
646 Ga0207704_10105969
647 Ga0207704_10152475
648 Ga0207704_10980271
649 Ga0207691_10010585
650 Ga0207691_10031214
651 Ga0207691_10042538
652 Ga0207691_10565869
653 Ga0207711_10263685
654 Ga0207711_10454957
655 Ga0207689_10257033
656 Ga0207689_10411141
657 Ga0207661_10104043
658 Ga0207679_10470469
659 Ga0207667_10001105
660 Ga0207651_10020249
661 Ga0207651_10078487
662 Ga0207651_10749129
663 Ga0207712_10069019
664 Ga0207712_10623213
665 Ga0207668_10154303
666 Ga0207668_11031592
667 Ga0207640_10277417
668 Ga0207658_10009108
669 Ga0207658_10014994
670 Ga0207658_10339236
671 Ga0207703_10000240
672 Ga0207703_10054253
673 Ga0207703_10362825
674 Ga0207703_10745833
675 Ga0207678_10392984
676 Ga0207678_10401209
677 Ga0207708_10010373
678 Ga0207708_10015677
679 Ga0207708_10085859
680 Ga0207708_10097980
681 Ga0207708_10335579
682 Ga0207641_10003471
683 Ga0207641_10106626
684 Ga0207641_10233866
685 Ga0207641_10283039
686 Ga0207648_10089163
687 Ga0207648_10118217
688 Ga0207648_10371801
689 Ga0207676_10018611
690 Ga0207676_10211732
691 Ga0207675_100005471
692 Ga0207675_100010106
693 Ga0207675_100140093
694 Ga0207675_100264493
695 Ga0207675_100591960
696 Ga0207675_100989480
697 Ga0207675_100996691
698 Ga0207683_10017843
699 Ga0207683_10190031
700 Ga0207698_10315120
701 Ga0207428_10097555
702 Ga0268266_10005167
703 Ga0268266_10158598
704 Ga0268266_10534341
705 Ga0268266_10563342
706 Ga0268266_10865046
707 Ga0268266_10954466
708 Ga0268266_11358563
709 Ga0268265_10555052
710 Ga0268264_10012865
711 Ga0268264_10116756
712 Ga0268264_11187266
713 Ga0307515_10001344
714 Ga0307515_10172914
715 Ga0307515_10270397
716 Ga0265338_10030545
717 Ga0265325_10003824
718 Ga0265340_10038876
719 Ga0265340_10109027
720 Ga0265331_10000928
721 Ga0307513_10081982
722 Ga0307509_10267880
723 Ga0307514_10349180
724 Ga0265314_10011687
725 Ga0307405_10074416
726 Ga0307413_10005857
727 Ga0307413_11708160
728 Ga0307410_10003267
729 Ga0307407_10004602
730 Ga0307412_10933569
731 Ga0307409_100003444
732 Ga0307409_100041475
733 Ga0307409_100046191
734 Ga0307409_100058168
735 Ga0307414_10634377
736 Ga0307411_10017994
737 Ga0307411_11292540
738 Ga0307415_102222376
739 Ga0373923_0616892
740 Ga0373957_0093948
741 Ga0373933_0159474
742 Ga0373937_0494442
743 Ga0373937_0774258
744 Ga0373925_0148170
745 Ga0436365_0936942
746 Ga0436360_0720278
747 Ga0436361_1037373
748 Ga0436363_0054011
749 Ga0436363_0374424
750 Ga0436363_1455644
751 Ga0436362_1215189
752 Ga0451793_0988062
753 Ga0451797_0186166
754 Ga0451804_0366137
755 Ga0451804_0836176
756 Ga0451807_1056072
757 Ga0451807_1755242
758 Ga0451849_0029079
759 Ga0451851_1295510
760 Ga0451853_1549191
761 Ga0439445_0279700
762 Ga0439458_0118167
763 Ga0466969_0001844
764 Ga0466972_0026682
765 Ga0466966_0741510
766 Ga0466968_0103741
767 Ga0466960_0086798
768 Ga0466959_0514553
769 Ga0495591_039347
770 Ga0495638_0016123
771 Ga0495580_0524063
772 Ga0495639_0270791
773 Ga0495616_0237182
774 Ga0495620_0048562
775 Ga0495630_1029297
776 Ga0495632_0151965
777 Ga0495644_0004729
778 Ga0495663_0165420
779 Ga0495586_0286067
780 Ga0495621_0006718
781 Ga0495633_0154007
782 Ga0495633_0248098
783 Ga0495656_0463669
784 Ga0495611_0209009
785 Ga0495625_0083876
786 Ga0495625_0556687
787 Ga0495647_0036634
788 Ga0495658_0125612
789 Ga0495669_0122164
790 Ga0495624_0253684
791 Ga0495649_0027891
792 Ga0495672_0300918
793 Ga0495673_0158762
794 Ga0495686_0057276
795 Ga0495686_0232783
796 Ga0496102_0003596
797 Ga0496103_0170372
798 Ga0496106_0155437
799 Ga0496107_0386877
800 Ga0496108_0533099
801 Ga0496108_0651744
802 Ga0496112_0012694
803 Ga0496114_0133570
804 Ga0496119_0088742
805 Ga0496121_0000522
806 Ga0496125_0005091
807 Ga0496125_0052778
808 Ga0496126_0016695
809 Ga0496126_0192612
810 Ga0501036_0496147
811 Ga0501039_0490342
812 Ga0501039_0500452
813 Ga0501042_0546707
814 Ga0501071_0817467
815 Ga0501076_0523191
816 Ga0501077_1077793
817 Ga0501045_1135415
818 nmdc:mga08y16_35852_c1
819 nmdc:mga08y16_575620_c1
820 Ga0500583_0025262
821 Ga0500583_0105381
822 Ga0500583_0535005
823 Ga0500651_0141955
824 Ga0500641_0006329
825 Ga0500556_0161884
826 Ga0500562_015822
827 Ga0500595_013509
828 Ga0500642_0223040
829 Ga0500642_0363508
830 Ga0500652_049796
831 Ga0500652_097605
832 Ga0500568_0110183
833 Ga0500577_0031569
834 Ga0500588_0018164
835 Ga0500589_333333
836 Ga0500622_0038971
837 Ga0500622_0043601
838 Ga0500637_0369052

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

6

137

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8875 50 124
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.866 50 124
8pek-assembly1.cif.gz_B structure of the dimeric, periplasmic domain of exbd 0.7552 31 124
3og9-assembly2.cif.gz_B structure of yahd with malic acid 0.7435 90 129
4evw-assembly2.cif.gz_B crystal structure of the nucleoside-diphosphate-sugar pyrophosphorylase from vibrio cholerae rc9. northeast structural genomics consortium (nesg) target vcr193. 0.7417 81 126
ID Description Score Start End Superfamily
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.8119 51 122 3.30.420.270
af_Q0JPY3_361_453_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.8062 89 127 3.80.10.10
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.793 51 122 3.30.420.270
af_Q4DNY9_22_263_3.40.367.20 Alpha Beta;3-Layer(aba) Sandwich;Hexokinase; domain 1; 0.7504 74 127 3.40.367.20
3og9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7435 90 129 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A139DB72-F1-model_v4 Biopolymer transport protein ExbD 0.9548 50 131 GO:0005886
GO:0015031
GO:0022857
AF-A0A1Y5Q6K5-F1-model_v4 Biopolymer transport protein ExbD/TolR 0.9399 53 130 GO:0005886
GO:0015031
GO:0022857
AF-F3LFH7-F1-model_v4 Biopolymer transport protein ExbD/TolR 0.9349 51 134 GO:0005886
GO:0015031
GO:0022857
AF-A0A139DB72-F1-model_v4 Biopolymer transport protein ExbD 0.9329 50 131 GO:0005886
GO:0015031
GO:0022857
AF-A0A561H3I4-F1-model_v4 deleted 0.9227 51 133

Map