metagRoot

F439471

General Info

Members	Datasets	Scaffolds	Average Seq Length
419	246	414	263

Family's Representative Sequence

Representative Sequence	3300005435\|Ga0070714_100387006\|Ga0070714_1003870061
Length	305
Sequence	VVGIDRASARCALSITWQVGRQHDLAGNRGPPAAATTLAAVTVASTRYQPRRPVGDLLREWRQRRRLSQLDLAIQADISARHLSFVETGRSRPTSAMILRLTEHLDVPLRDRNTLLLAGGYAPAYPEHPLDSRELAAVRTALRAVLSGHEPYPAVVVNRWWELLDCNTTVGVLTEPVAAHLLAPPANVLRMSLHPEGMAPYIVNLAEWRAHLLGRLRRQLEATGDARLAELFEELRGYPGGEPGXPGPADVVVPLRYRRGDRELAFFSMTAVVGTPMDVTIEELAIESFYPADEATAEALWARRG

Samples

	Sample ID	Description	Type	Environment
1	2512875024	Mesorhizobium loti R88b	Isolate	Nodule
2	2643221578	Streptomyces sp. Root63	Isolate	Unclassified
3	2643221673	Streptomyces sp. Root1295	Isolate	Unclassified
4	2867302475	Micromonospora globbae WPS1-2	Isolate	Unclassified
5	2946045630	Streptomyces sp. W4I9-2	Isolate	Rhizosphere
6	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
7	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
8	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
9	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
10	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
11	3300003373	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
12	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
13	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
14	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
15	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
16	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
17	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
18	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
19	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
20	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
21	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
22	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
23	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
24	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
25	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
26	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
27	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
28	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
29	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
30	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
31	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
32	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
33	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
34	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
35	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
36	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
37	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
38	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
39	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
40	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
41	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
42	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
43	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
44	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
45	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
46	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
47	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
48	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
49	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
50	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
51	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
52	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
53	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
54	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
55	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
56	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
57	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
58	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
59	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
60	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
61	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
62	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
63	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
64	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
65	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
66	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
67	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
68	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
69	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
70	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
71	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
72	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
73	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
74	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
75	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
76	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
77	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
78	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
79	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
80	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
81	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
82	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
83	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
84	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
116	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
117	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
118	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
119	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
120	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
121	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
122	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
123	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
124	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
125	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
126	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
127	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
128	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
129	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
130	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
131	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
132	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
133	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
134	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
135	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
136	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
137	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
138	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
139	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
140	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
141	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
142	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
143	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
144	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
145	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
146	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
147	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
148	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
149	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
150	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
151	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
152	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
153	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
154	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
155	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
156	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
157	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
158	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
159	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
160	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
161	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
162	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
163	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
164	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
165	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
166	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
167	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
168	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
169	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
170	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
171	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
172	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
173	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
174	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
175	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
176	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
177	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
178	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
179	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
180	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
181	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
182	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
183	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
184	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
185	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
186	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
187	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
188	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
189	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
190	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
191	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
192	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
193	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
194	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
195	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
196	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
197	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
198	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
199	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
200	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
201	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
202	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
203	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
204	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
205	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
206	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
207	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
208	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
209	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
210	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
211	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
212	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
213	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
214	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
217	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
218	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
219	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
220	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
221	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
222	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
223	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
224	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
225	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
226	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
227	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
228	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
229	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
230	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
231	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
232	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
233	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
234	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
235	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
236	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
237	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
238	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
239	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
240	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
241	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
242	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
243	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
244	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
245	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
246	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.81
Metatranscriptomes	0
Isolates	1.19

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.06
Nodule	0.24
Rhizoplane	2.86
Rhizosphere	88.07
Stem	0
Stem Tuber	0
Unclassified	4.77

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24735J21928_10007649	3300002067	Bacteria	3519
2	JGI25159J45721_1003305	3300002987	Bacteria	5764
3	JGI25151J46595_10000130	3300003187	Bacteria	101649
4	JGI25151J46595_10000917	3300003187	Bacteria	22964
5	rootH1_10060104	3300003323	Bacteria	34000
6	JGI25160J50197_1000095	3300003354	Bacteria	88326
7	JGI25407J50210_10001136	3300003373	Bacteria	5867
8	JGI25161J50226_1000071	3300003374	Bacteria	88326
9	Ga0055529_1000826	3300003763	Bacteria	18317
10	JGI25405J52794_10025220	3300003911	Bacteria	1217
11	Ga0055543_1000250	3300004625	Bacteria	40740
12	Ga0065165_1000408	3300005262	Bacteria	68789
13	Ga0070658_10036153	3300005327	Bacteria	3980
14	Ga0070683_100128148	3300005329	Bacteria	2400
15	Ga0070683_100429877	3300005329	Bacteria	1260
16	Ga0070690_100075695	3300005330	Bacteria	2194
17	Ga0070680_100186530	3300005336	Bacteria	1747
18	Ga0070687_100091663	3300005343	Bacteria	1682
19	Ga0070661_100010045	3300005344	Bacteria	6570
20	Ga0070661_100548532	3300005344	Bacteria	930
21	Ga0070668_100185632	3300005347	Bacteria	1701
22	Ga0070671_100202262	3300005355	Bacteria	1684
23	Ga0070688_100552358	3300005365	Bacteria	876
24	Ga0070659_100097908	3300005366	Bacteria	2358
25	Ga0070709_10000764	3300005434	Bacteria	18084
26	Ga0070714_100001791	3300005435	Bacteria	15636
27	Ga0070714_100004707	3300005435	Bacteria	10317
28	Ga0070714_100007958	3300005435	Bacteria	8260
29	Ga0070714_100197506	3300005435	Bacteria	1839
30	Ga0070714_100387006	3300005435	Bacteria	1319
31	Ga0070713_100025607	3300005436	Bacteria	4615
32	Ga0070713_100036681	3300005436	Bacteria	3958
33	Ga0070713_100042942	3300005436	Bacteria	3693
34	Ga0070713_100069556	3300005436	Bacteria	2969
35	Ga0070713_100123555	3300005436	Bacteria	2273
36	Ga0070713_100564624	3300005436	Bacteria	1079
37	Ga0070710_10000532	3300005437	Bacteria	17984
38	Ga0070710_10000570	3300005437	Bacteria	17506
39	Ga0070710_10080504	3300005437	Bacteria	1900
40	Ga0070710_10142348	3300005437	Bacteria	1472
41	Ga0070711_100000642	3300005439	Bacteria	18210
42	Ga0070711_100276215	3300005439	Bacteria	1327
43	Ga0070694_100120113	3300005444	Bacteria	1884
44	Ga0070708_100112734	3300005445	Bacteria	2501
45	Ga0070708_100337684	3300005445	Bacteria	1420
46	Ga0070663_100015382	3300005455	Bacteria	4937
47	Ga0070678_100001193	3300005456	Bacteria	13832
48	Ga0070678_100035394	3300005456	Bacteria	3485
49	Ga0070681_10195540	3300005458	Bacteria	1941
50	Ga0068867_100142781	3300005459	Bacteria	1873
51	Ga0070706_100082790	3300005467	Bacteria	2972
52	Ga0070706_100189413	3300005467	Bacteria	1922
53	Ga0070706_100556345	3300005467	Bacteria	1067
54	Ga0070698_100052374	3300005471	Bacteria	4152
55	Ga0070679_100102681	3300005530	Bacteria	2845
56	Ga0070684_100064204	3300005535	Bacteria	3220
57	Ga0070695_100020817	3300005545	Bacteria	4007
58	Ga0070696_100025204	3300005546	Bacteria	4042
59	Ga0070664_100206916	3300005564	Bacteria	1753
60	Ga0070664_100598270	3300005564	Bacteria	1022
61	Ga0068861_100246385	3300005719	Bacteria	1522
62	Ga0068862_100232376	3300005844	Bacteria	1674
63	Ga0081455_10004088	3300005937	Bacteria	16516
64	Ga0081455_10037104	3300005937	Bacteria	4332
65	Ga0081538_10002339	3300005981	Bacteria	18686
66	Ga0081540_1000292	3300005983	Bacteria	52588
67	Ga0070717_10001066	3300006028	Bacteria	18407
68	Ga0070717_10045573	3300006028	Bacteria	3585
69	Ga0070717_10134990	3300006028	Bacteria	2124
70	Ga0070717_10189640	3300006028	Bacteria	1796
71	Ga0070716_100000606	3300006173	Bacteria	15146
72	Ga0070716_100143687	3300006173	Bacteria	1525
73	Ga0070712_100026610	3300006175	Bacteria	3855
74	Ga0075369_10007269	3300006186	Bacteria	4213
75	Ga0097621_100070219	3300006237	Bacteria	2892
76	Ga0075431_100067490	3300006847	Bacteria	3692
77	Ga0075433_10037693	3300006852	Bacteria	4172
78	Ga0075435_100040114	3300007076	Bacteria	3738
79	Ga0075435_100492346	3300007076	Bacteria	1060
80	Ga0105251_10006827	3300009011	Bacteria	7182
81	Ga0105240_10700614	3300009093	Bacteria	1105
82	Ga0114129_10045058	3300009147	Bacteria	6202
83	Ga0114129_10493834	3300009147	Bacteria	1599
84	Ga0105242_10106941	3300009176	Unclassified	2378
85	Ga0105248_10012340	3300009177	Bacteria	9428
86	Ga0105248_10965243	3300009177	Bacteria	963
87	Ga0105237_10434622	3300009545	Bacteria	1318
88	Ga0105239_10491957	3300010375	Bacteria	1394
89	Ga0105246_10062659	3300011119	Bacteria	2591
90	Ga0157370_10172754	3300013104	Bacteria	2009
91	Ga0157369_10019322	3300013105	Bacteria	7625
92	Ga0157374_10203351	3300013296	Bacteria	1940
93	Ga0163162_10001085	3300013306	Bacteria	25212
94	Ga0157375_10114978	3300013308	Bacteria	2793
95	Ga0163163_10119373	3300014325	Bacteria	2670
96	Ga0157379_10005028	3300014968	Bacteria	11341
97	Ga0182005_1035671	3300015265	Bacteria	1353
98	Ga0213872_10011470	3300021361	Bacteria	4190
99	Ga0213876_10110099	3300021384	Bacteria	1462
100	Ga0213875_10002024	3300021388	Bacteria	12495
101	Ga0213875_10015620	3300021388	Bacteria	3694
102	Ga0213875_10037691	3300021388	Bacteria	2278
103	Ga0209672_102978	3300025228	Bacteria	3728
104	Ga0209258_103426	3300025242	Bacteria	3423
105	Ga0209455_1000470	3300025272	Bacteria	30269
106	Ga0209130_1000180	3300025284	Bacteria	89520
107	Ga0209025_1000152	3300025294	Bacteria	171558
108	Ga0209758_1013021	3300025297	Bacteria	4583
109	Ga0207426_1000017	3300025302	Bacteria	577913
110	Ga0207653_10002830	3300025885	Bacteria	5517
111	Ga0207692_10000658	3300025898	Bacteria	12150
112	Ga0207692_10003997	3300025898	Bacteria	5797
113	Ga0207692_10044773	3300025898	Bacteria	2210
114	Ga0207647_10093455	3300025904	Bacteria	1792
115	Ga0207685_10001556	3300025905	Bacteria	4878
116	Ga0207699_10000195	3300025906	Bacteria	36276
117	Ga0207699_10000582	3300025906	Bacteria	17995
118	Ga0207699_10223174	3300025906	Bacteria	1287
119	Ga0207645_10077805	3300025907	Bacteria	2125
120	Ga0207705_10426087	3300025909	Bacteria	1028
121	Ga0207684_10096554	3300025910	Bacteria	2522
122	Ga0207707_10096780	3300025912	Bacteria	2579
123	Ga0207707_10120947	3300025912	Bacteria	2289
124	Ga0207693_10015057	3300025915	Bacteria	6208
125	Ga0207693_10084193	3300025915	Bacteria	2492
126	Ga0207693_10184432	3300025915	Bacteria	1643
127	Ga0207663_10000642	3300025916	Bacteria	15537
128	Ga0207663_10012231	3300025916	Bacteria	4633
129	Ga0207663_10218076	3300025916	Bacteria	1387
130	Ga0207662_10052522	3300025918	Bacteria	2425
131	Ga0207657_10187653	3300025919	Bacteria	1669
132	Ga0207646_10590473	3300025922	Bacteria	997
133	Ga0207659_10111855	3300025926	Bacteria	2077
134	Ga0207659_10258123	3300025926	Bacteria	1417
135	Ga0207700_10000855	3300025928	Bacteria	17540
136	Ga0207700_10004625	3300025928	Bacteria	8149
137	Ga0207700_10032316	3300025928	Bacteria	3731
138	Ga0207700_10066318	3300025928	Bacteria	2759
139	Ga0207700_10102137	3300025928	Bacteria	2289
140	Ga0207700_10498840	3300025928	Bacteria	1077
141	Ga0207664_10001763	3300025929	Bacteria	14263
142	Ga0207664_10005203	3300025929	Bacteria	8868
143	Ga0207664_10008682	3300025929	Bacteria	7104
144	Ga0207664_10169346	3300025929	Bacteria	1868
145	Ga0207644_10110014	3300025931	Bacteria	2082
146	Ga0207706_10289945	3300025933	Bacteria	1427
147	Ga0207665_10004153	3300025939	Bacteria	9645
148	Ga0207665_10009304	3300025939	Bacteria	6448
149	Ga0207665_10073834	3300025939	Bacteria	2333
150	Ga0207689_10012020	3300025942	Bacteria	7418
151	Ga0207661_10026854	3300025944	Bacteria	4392
152	Ga0207661_10303159	3300025944	Bacteria	1433
153	Ga0207677_10336155	3300026023	Bacteria	1260
154	Ga0207639_10055310	3300026041	Unclassified	3037
155	Ga0207678_10003260	3300026067	Bacteria	14649
156	Ga0207708_10038588	3300026075	Bacteria	3638
157	Ga0207702_10574665	3300026078	Bacteria	1104
158	Ga0207641_10142536	3300026088	Bacteria	2164
159	Ga0207648_10187041	3300026089	Bacteria	1834
160	Ga0207674_10054829	3300026116	Bacteria	4057
161	Ga0207683_10041659	3300026121	Bacteria	4011
162	Ga0307513_10011745	3300031456	Bacteria	10860
163	Ga0307414_10252900	3300032004	Bacteria	1466
164	Ga0373926_0003499	3300035083	Bacteria	5075
165	Ga0373944_0016049	3300035089	Bacteria	2106
166	Ga0373923_0014886	3300035111	Bacteria	2929
167	Ga0373923_0019502	3300035111	Bacteria	2627
168	Ga0373936_0002343	3300035113	Bacteria	7086
169	Ga0373936_0005842	3300035113	Bacteria	4633
170	Ga0373945_0000165	3300035116	Bacteria	17305
171	Ga0373945_0109498	3300035116	Bacteria	1089
172	Ga0373953_0143809	3300035117	Bacteria	1020
173	Ga0373954_0015351	3300035118	Bacteria	3423
174	Ga0373956_0025457	3300035119	Bacteria	2557
175	Ga0373956_0057278	3300035119	Bacteria	1760
176	Ga0373956_0102193	3300035119	Bacteria	1330
177	Ga0373957_0002018	3300035120	Bacteria	5677
178	Ga0373957_0015835	3300035120	Bacteria	2601
179	Ga0373943_0000416	3300035170	Bacteria	17972
180	Ga0373943_0005149	3300035170	Bacteria	5886
181	Ga0373946_0003029	3300035171	Bacteria	5955
182	Ga0373955_0057028	3300035172	Bacteria	2144
183	Ga0373955_0106198	3300035172	Bacteria	1618
184	Ga0373955_0181046	3300035172	Bacteria	1250
185	Ga0373924_0020765	3300035410	Bacteria	2556
186	Ga0373931_0025403	3300035691	Bacteria	3009
187	Ga0373935_0013137	3300035692	Bacteria	4992
188	Ga0373935_0040352	3300035692	Bacteria	2929
189	Ga0373935_0063854	3300035692	Bacteria	2360
190	Ga0373935_0112811	3300035692	Bacteria	1806
191	Ga0373935_0335410	3300035692	Bacteria	1075
192	Ga0373927_0019234	3300035695	Bacteria	4479
193	Ga0373927_0042407	3300035695	Bacteria	2947
194	Ga0373927_0373512	3300035695	Bacteria	940
195	Ga0373933_0049368	3300035724	Bacteria	2508
196	Ga0373947_0002421	3300035725	Bacteria	11254
197	Ga0373925_0009599	3300037068	Bacteria	7051
198	Ga0373925_0042630	3300037068	Bacteria	3366
199	Ga0373925_0053119	3300037068	Bacteria	3028
200	Ga0395905_0009426	3300037471	Bacteria	9540
201	Ga0436364_0342969	3300037853	Bacteria	2220
202	Ga0436364_0637047	3300037853	Bacteria	2343
203	Ga0436364_0820797	3300037853	Bacteria	6952
204	Ga0436364_0862011	3300037853	Bacteria	3472
205	Ga0436364_1261114	3300037853	Bacteria	1020
206	Ga0436364_1489807	3300037853	Bacteria	15421
207	Ga0395901_0290220	3300038443	Bacteria	1698
208	Ga0436365_1862477	3300039437	Bacteria	12394
209	Ga0436361_0108546	3300039447	Bacteria	4583
210	Ga0436361_0153264	3300039447	Bacteria	5964
211	Ga0436361_1147847	3300039447	Bacteria	3041
212	Ga0436363_0482250	3300039450	Bacteria	1106
213	Ga0439455_0014861	3300042012	Bacteria	1783
214	Ga0439444_0021941	3300042437	Bacteria	1134
215	Ga0466972_0222051	3300044658	Bacteria	884
216	Ga0466961_0148783	3300044693	Bacteria	1463
217	Ga0466963_0126789	3300044694	Bacteria	1760
218	Ga0466963_0261559	3300044694	Bacteria	1215
219	Ga0466963_0351077	3300044694	Bacteria	1039
220	Ga0466960_0015992	3300044901	Bacteria	3245
221	Ga0466959_0010388	3300045049	Bacteria	6653
222	Ga0466967_0064055	3300045976	Bacteria	3268
223	Ga0466967_0225804	3300045976	Bacteria	1781
224	Ga0495592_0010534	3300046454	Bacteria	6972
225	Ga0495592_0049850	3300046454	Bacteria	3111
226	Ga0495629_0013474	3300046459	Bacteria	5896
227	Ga0495641_0003000	3300046461	Bacteria	12951
228	Ga0495641_0020014	3300046461	Bacteria	3407
229	Ga0495641_0025256	3300046461	Bacteria	2918
230	Ga0495651_0000359	3300046462	Bacteria	35121
231	Ga0495651_0016525	3300046462	Bacteria	5716
232	Ga0495651_0090277	3300046462	Bacteria	2298
233	Ga0495651_0251200	3300046462	Bacteria	1208
234	Ga0495653_0003990	3300046463	Bacteria	11919
235	Ga0495653_0027640	3300046463	Bacteria	4540
236	Ga0495653_0045348	3300046463	Bacteria	3408
237	Ga0495653_0069057	3300046463	Bacteria	2649
238	Ga0495653_0138281	3300046463	Bacteria	1716
239	Ga0495580_0019393	3300046472	Bacteria	5054
240	Ga0495580_0019827	3300046472	Bacteria	4989
241	Ga0495582_0010591	3300046473	Bacteria	5072
242	Ga0495582_0012573	3300046473	Bacteria	4666
243	Ga0495582_0253421	3300046473	Bacteria	1009
244	Ga0495639_0009907	3300046475	Bacteria	4092
245	Ga0495639_0073052	3300046475	Bacteria	1587
246	Ga0495662_0000404	3300046476	Bacteria	19338
247	Ga0495662_0003731	3300046476	Bacteria	7675
248	Ga0495662_0004676	3300046476	Bacteria	6866
249	Ga0495664_0009260	3300046477	Bacteria	5506
250	Ga0495664_0011154	3300046477	Bacteria	5057
251	Ga0495664_0053725	3300046477	Bacteria	2395
252	Ga0495664_0111118	3300046477	Bacteria	1654
253	Ga0495594_0060590	3300046499	Bacteria	2093
254	Ga0495606_0004441	3300046507	Bacteria	14017
255	Ga0495606_0103013	3300046507	Bacteria	1735
256	Ga0495608_0005016	3300046511	Bacteria	9471
257	Ga0495608_0051370	3300046511	Bacteria	2732
258	Ga0495608_0064367	3300046511	Bacteria	2403
259	Ga0495608_0236792	3300046511	Bacteria	1141
260	Ga0495610_0059613	3300046512	Bacteria	1821
261	Ga0495618_0026849	3300046514	Bacteria	3581
262	Ga0495618_0151123	3300046514	Bacteria	1483
263	Ga0495628_0004126	3300046516	Bacteria	12921
264	Ga0495628_0021977	3300046516	Bacteria	5242
265	Ga0495628_0207271	3300046516	Bacteria	1475
266	Ga0495630_0006326	3300046517	Bacteria	8413
267	Ga0495630_0029036	3300046517	Bacteria	4111
268	Ga0495630_0219151	3300046517	Bacteria	1452
269	Ga0495666_0003482	3300046526	Bacteria	7943
270	Ga0495666_0023650	3300046526	Bacteria	3038
271	Ga0495652_0017269	3300046529	Bacteria	6441
272	Ga0495652_0017459	3300046529	Bacteria	6401
273	Ga0495652_0198919	3300046529	Bacteria	1522
274	Ga0495665_0006777	3300046531	Bacteria	6179
275	Ga0495665_0013229	3300046531	Bacteria	4462
276	Ga0495665_0016135	3300046531	Bacteria	4024
277	Ga0495640_0004992	3300046533	Bacteria	10541
278	Ga0495640_0024057	3300046533	Bacteria	4431
279	Ga0495640_0169041	3300046533	Bacteria	1397
280	Ga0495586_0009386	3300046535	Bacteria	5206
281	Ga0495586_0044497	3300046535	Bacteria	2392
282	Ga0495587_0000983	3300046536	Bacteria	18701
283	Ga0495587_0123056	3300046536	Bacteria	1485
284	Ga0495645_0031886	3300046543	Bacteria	3842
285	Ga0495645_0057425	3300046543	Bacteria	2825
286	Ga0495667_0024576	3300046559	Bacteria	4057
287	Ga0495667_0027969	3300046559	Bacteria	3796
288	Ga0495667_0034235	3300046559	Bacteria	3396
289	Ga0495667_0158580	3300046559	Bacteria	1455
290	Ga0495634_0012912	3300046642	Bacteria	6044
291	Ga0495634_0018678	3300046642	Bacteria	4932
292	Ga0495634_0058949	3300046642	Bacteria	2558
293	Ga0495635_0007012	3300046663	Bacteria	7871
294	Ga0495635_0029986	3300046663	Bacteria	3781
295	Ga0495635_0057791	3300046663	Bacteria	2668
296	Ga0495635_0098838	3300046663	Bacteria	1994
297	Ga0495635_0207242	3300046663	Bacteria	1328
298	Ga0495657_0015436	3300046675	Bacteria	5589
299	Ga0495657_0025864	3300046675	Bacteria	4164
300	Ga0495657_0047984	3300046675	Bacteria	2883
301	Ga0495657_0081426	3300046675	Bacteria	2093
302	Ga0495657_0138964	3300046675	Bacteria	1515
303	Ga0495657_0206169	3300046675	Bacteria	1196
304	Ga0495599_0020093	3300046678	Bacteria	4159
305	Ga0495599_0073457	3300046678	Bacteria	2134
306	Ga0495599_0268926	3300046678	Bacteria	1034
307	Ga0495623_0013533	3300046679	Bacteria	5289
308	Ga0495623_0063271	3300046679	Bacteria	2317
309	Ga0495623_0064120	3300046679	Bacteria	2299
310	Ga0495646_0001104	3300046680	Bacteria	15719
311	Ga0495646_0009412	3300046680	Bacteria	6198
312	Ga0495646_0285269	3300046680	Bacteria	876
313	Ga0495658_0005054	3300046683	Bacteria	6482
314	Ga0495613_0011632	3300046689	Bacteria	6541
315	Ga0495613_0023261	3300046689	Bacteria	4616
316	Ga0495613_0139124	3300046689	Bacteria	1735
317	Ga0495624_0011218	3300046690	Bacteria	6163
318	Ga0495624_0015745	3300046690	Bacteria	5099
319	Ga0495624_0025933	3300046690	Bacteria	3845
320	Ga0495600_0017342	3300046809	Bacteria	4579
321	Ga0495600_0027897	3300046809	Bacteria	3651
322	Ga0495600_0048800	3300046809	Bacteria	2761
323	Ga0495600_0087975	3300046809	Bacteria	2026
324	Ga0495600_0167214	3300046809	Bacteria	1420
325	Ga0495581_0006157	3300047315	Bacteria	6959
326	Ga0495581_0008881	3300047315	Bacteria	5817
327	Ga0495604_0000685	3300047317	Bacteria	28681
328	Ga0495674_0045672	3300047319	Bacteria	3889
329	Ga0495674_0081828	3300047319	Bacteria	2769
330	Ga0495674_0097408	3300047319	Bacteria	2505
331	Ga0495674_0132653	3300047319	Bacteria	2098
332	Ga0495674_0173300	3300047319	Bacteria	1799
333	Ga0495672_0105769	3300047320	Bacteria	1518
334	Ga0495676_0015287	3300047321	Bacteria	6838
335	Ga0495680_0014842	3300047322	Bacteria	6735
336	Ga0495680_0054859	3300047322	Bacteria	3093
337	Ga0495680_0080814	3300047322	Bacteria	2455
338	Ga0495680_0084456	3300047322	Bacteria	2392
339	Ga0495675_0027018	3300047444	Bacteria	3658
340	Ga0495675_0037857	3300047444	Bacteria	3071
341	Ga0495684_0006050	3300047471	Bacteria	9408
342	Ga0495684_0018033	3300047471	Bacteria	5439
343	Ga0495684_0036876	3300047471	Bacteria	3748
344	Ga0495684_0050874	3300047471	Bacteria	3162
345	Ga0495684_0055917	3300047471	Bacteria	3009
346	Ga0495593_0020081	3300047673	Bacteria	3741
347	Ga0495593_0028747	3300047673	Bacteria	3052
348	Ga0495602_0007450	3300048088	Bacteria	11446
349	Ga0495602_0125742	3300048088	Bacteria	2054
350	Ga0495602_0179224	3300048088	Bacteria	1636
351	Ga0495602_0234471	3300048088	Bacteria	1376
352	Ga0496100_0202456	3300048903	Bacteria	1447
353	Ga0496102_0069012	3300048905	Bacteria	3244
354	Ga0496104_0270235	3300048907	Bacteria	1613
355	Ga0496105_0305572	3300048908	Bacteria	1278
356	Ga0496106_0028123	3300048909	Bacteria	4187
357	Ga0496107_0123644	3300048910	Bacteria	1906
358	Ga0496109_0109266	3300048912	Bacteria	2570
359	Ga0496110_0089356	3300048913	Bacteria	2753
360	Ga0496112_0317096	3300048915	Bacteria	1504
361	Ga0496112_0366231	3300048915	Bacteria	1383
362	Ga0496114_0230437	3300048917	Bacteria	1627
363	Ga0496115_0115163	3300048918	Bacteria	2210
364	Ga0496119_0038712	3300048922	Bacteria	3077
365	Ga0496125_0121859	3300048928	Bacteria	1858
366	Ga0496126_0000003	3300048929	Bacteria	961576
367	Ga0501031_0095169	3300049568	Bacteria	1943
368	Ga0501033_0076084	3300049570	Bacteria	2464
369	Ga0501036_0016270	3300049572	Bacteria	6213
370	Ga0501037_0164144	3300049573	Bacteria	1582
371	Ga0501038_0134863	3300049574	Bacteria	2023
372	Ga0501039_0014888	3300049575	Bacteria	5948
373	Ga0501040_0026147	3300049576	Bacteria	3925
374	Ga0501041_0018377	3300049577	Bacteria	4166
375	Ga0501042_0152643	3300049578	Bacteria	1665
376	Ga0501043_0100163	3300049579	Bacteria	2278
377	Ga0501046_0072012	3300049580	Bacteria	2684
378	Ga0501048_0054530	3300049582	Bacteria	2840
379	Ga0501071_0010961	3300049587	Bacteria	6086
380	Ga0501072_0034049	3300049588	Bacteria	3991
381	Ga0501073_0302584	3300049589	Bacteria	1103
382	Ga0501074_0131222	3300049590	Bacteria	1792
383	Ga0501074_0362272	3300049590	Bacteria	1029
384	Ga0501075_0030638	3300049591	Bacteria	3985
385	Ga0501075_0161614	3300049591	Bacteria	1709
386	Ga0501076_0010446	3300049592	Bacteria	6893
387	Ga0501077_0009683	3300049593	Bacteria	5989
388	Ga0501077_0115844	3300049593	Bacteria	1699
389	Ga0501079_0038591	3300049741	Bacteria	3683
390	Ga0501079_0557211	3300049741	Bacteria	901
391	Ga0501081_0007577	3300049743	Bacteria	7036
392	Ga0501035_0060746	3300049822	Bacteria	3365
393	Ga0501035_0300668	3300049822	Bacteria	1352
394	Ga0501045_0036185	3300049824	Bacteria	3584
395	nmdc:mga05p37_79223_c1	3300050507	Bacteria	4045
396	nmdc:mga0qj67_178142_c1	3300050509	Bacteria	1726
397	nmdc:mga06r32_2940_c1	3300050510	Bacteria	15265
398	nmdc:mga0n895_202424_c1	3300050512	Bacteria	2016
399	nmdc:mga0rr50_12951_c1	3300050513	Bacteria	5410
400	nmdc:mga0rr50_383261_c1	3300050513	Bacteria	1186
401	nmdc:mga08x19_19992_c1	3300050514	Bacteria	4119
402	nmdc:mga0a205_69782_c1	3300050515	Bacteria	3393
403	Ga0495601_0012450	3300053077	Bacteria	5103
404	Ga0495601_0014857	3300053077	Bacteria	4699
405	Ga0495601_0047767	3300053077	Bacteria	2695
406	Ga0495612_0003584	3300053078	Bacteria	6434
407	Ga0495612_0009980	3300053078	Bacteria	3845
408	Ga0495595_0006963	3300053084	Bacteria	4616
409	Ga0495619_0235394	3300053085	Bacteria	1269
410	Ga0500568_0047199	3300053139	Bacteria	1707
411	Ga0501084_0035763	3300054114	Bacteria	4151
412	Ga0501082_0269406	3300060353	Bacteria	1482
413	Ga0501082_0307888	3300060353	Bacteria	1379
414	Ga0530510_0009692	3300061734	Bacteria	6758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300042012	Ga0439455_0014861	Ga0439455_0014861_622_1350	236
2	3300042437	Ga0439444_0021941	Ga0439444_0021941_318_1046	236
3	3300049568	Ga0501031_0095169	Ga0501031_0095169_470_1198	236
4	3300049570	Ga0501033_0076084	Ga0501033_0076084_706_1434	236
5	3300049572	Ga0501036_0016270	Ga0501036_0016270_2664_3392	236
6	3300049573	Ga0501037_0164144	Ga0501037_0164144_11_739	236
7	3300049574	Ga0501038_0134863	Ga0501038_0134863_271_999	236
8	3300049575	Ga0501039_0014888	Ga0501039_0014888_4084_4812	236
9	3300049576	Ga0501040_0026147	Ga0501040_0026147_566_1294	236
10	3300049577	Ga0501041_0018377	Ga0501041_0018377_452_1180	236
11	3300049578	Ga0501042_0152643	Ga0501042_0152643_187_915	236
12	3300049579	Ga0501043_0100163	Ga0501043_0100163_287_1015	236
13	3300049580	Ga0501046_0072012	Ga0501046_0072012_1669_2397	236
14	3300049582	Ga0501048_0054530	Ga0501048_0054530_1823_2551	236
15	3300049587	Ga0501071_0010961	Ga0501071_0010961_4948_5676	236
16	3300049588	Ga0501072_0034049	Ga0501072_0034049_2834_3562	236
17	3300049590	Ga0501074_0131222	Ga0501074_0131222_1021_1749	236
18	3300049591	Ga0501075_0030638	Ga0501075_0030638_2822_3550	236
19	3300049592	Ga0501076_0010446	Ga0501076_0010446_4983_5711	236
20	3300049593	Ga0501077_0009683	Ga0501077_0009683_4232_4960	236
21	3300049741	Ga0501079_0038591	Ga0501079_0038591_266_994	236
22	3300049743	Ga0501081_0007577	Ga0501081_0007577_2364_3092	236
23	3300049822	Ga0501035_0300668	Ga0501035_0300668_238_966	236
24	3300049824	Ga0501045_0036185	Ga0501045_0036185_2442_3170	236
25	3300050507	nmdc:mga05p37_79223_c1	nmdc:mga05p37_79223_c1_3276_4004	236
26	3300054114	Ga0501084_0035763	Ga0501084_0035763_1505_2233	236
27	3300060353	Ga0501082_0307888	Ga0501082_0307888_199_927	236
28	3300061734	Ga0530510_0009692	Ga0530510_0009692_2974_3702	236
29	3300049589	Ga0501073_0302584	Ga0501073_0302584_27_761	238
30	3300006186	Ga0075369_10007269	Ga0075369_100072692	245
31	3300005330	Ga0070690_100075695	Ga0070690_1000756952	246
32	3300005343	Ga0070687_100091663	Ga0070687_1000916632	246
33	3300005347	Ga0070668_100185632	Ga0070668_1001856322	246
34	3300005355	Ga0070671_100202262	Ga0070671_1002022622	246
35	3300005365	Ga0070688_100552358	Ga0070688_1005523581	246
36	3300005444	Ga0070694_100120113	Ga0070694_1001201132	246
37	3300005445	Ga0070708_100112734	Ga0070708_1001127343	246
38	3300005455	Ga0070663_100015382	Ga0070663_1000153823	246
39	3300005459	Ga0068867_100142781	Ga0068867_1001427812	246
40	3300005467	Ga0070706_100189413	Ga0070706_1001894133	246
41	3300005545	Ga0070695_100020817	Ga0070695_1000208172	246
42	3300005546	Ga0070696_100025204	Ga0070696_1000252041	246
43	3300005719	Ga0068861_100246385	Ga0068861_1002463852	246
44	3300005844	Ga0068862_100232376	Ga0068862_1002323762	246
45	3300005983	Ga0081540_1000292	Ga0081540_100029229	246
46	3300006237	Ga0097621_100070219	Ga0097621_1000702194	246
47	3300009011	Ga0105251_10006827	Ga0105251_100068274	246
48	3300009093	Ga0105240_10700614	Ga0105240_107006142	246
49	3300011119	Ga0105246_10062659	Ga0105246_100626592	246
50	3300013308	Ga0157375_10114978	Ga0157375_101149782	246
51	3300025885	Ga0207653_10002830	Ga0207653_100028302	246
52	3300025898	Ga0207692_10044773	Ga0207692_100447732	246
53	3300025904	Ga0207647_10093455	Ga0207647_100934552	246
54	3300025907	Ga0207645_10077805	Ga0207645_100778052	246
55	3300025926	Ga0207659_10111855	Ga0207659_101118552	246
56	3300025931	Ga0207644_10110014	Ga0207644_101100142	246
57	3300025933	Ga0207706_10289945	Ga0207706_102899451	246
58	3300025942	Ga0207689_10012020	Ga0207689_100120208	246
59	3300026023	Ga0207677_10336155	Ga0207677_103361551	246
60	3300026067	Ga0207678_10003260	Ga0207678_100032602	246
61	3300026075	Ga0207708_10038588	Ga0207708_100385884	246
62	3300026089	Ga0207648_10187041	Ga0207648_101870412	246
63	3300035118	Ga0373954_0015351	Ga0373954_0015351_1312_2064	246
64	3300035119	Ga0373956_0057278	Ga0373956_0057278_734_1486	246
65	3300035120	Ga0373957_0015835	Ga0373957_0015835_464_1216	246
66	3300035170	Ga0373943_0005149	Ga0373943_0005149_2777_3529	246
67	3300035692	Ga0373935_0040352	Ga0373935_0040352_275_1027	246
68	3300035692	Ga0373935_0335410	Ga0373935_0335410_209_961	246
69	3300035695	Ga0373927_0019234	Ga0373927_0019234_3453_4205	246
70	3300045976	Ga0466967_0225804	Ga0466967_0225804_497_1249	246
71	3300046461	Ga0495641_0003000	Ga0495641_0003000_3403_4155	246
72	3300046462	Ga0495651_0016525	Ga0495651_0016525_1936_2688	246
73	3300046462	Ga0495651_0251200	Ga0495651_0251200_233_985	246
74	3300046463	Ga0495653_0045348	Ga0495653_0045348_1015_1767	246
75	3300046472	Ga0495580_0019827	Ga0495580_0019827_1841_2593	246
76	3300046473	Ga0495582_0010591	Ga0495582_0010591_1815_2567	246
77	3300046475	Ga0495639_0009907	Ga0495639_0009907_209_961	246
78	3300046476	Ga0495662_0004676	Ga0495662_0004676_3404_4156	246
79	3300046477	Ga0495664_0111118	Ga0495664_0111118_527_1282	246
80	3300046499	Ga0495594_0060590	Ga0495594_0060590_132_884	246
81	3300046511	Ga0495608_0064367	Ga0495608_0064367_1497_2249	246
82	3300046514	Ga0495618_0026849	Ga0495618_0026849_2158_2910	246
83	3300046514	Ga0495618_0151123	Ga0495618_0151123_354_1109	246
84	3300046517	Ga0495630_0006326	Ga0495630_0006326_6293_7045	246
85	3300046526	Ga0495666_0023650	Ga0495666_0023650_1285_2037	246
86	3300046533	Ga0495640_0024057	Ga0495640_0024057_2584_3336	246
87	3300046535	Ga0495586_0009386	Ga0495586_0009386_478_1230	246
88	3300046663	Ga0495635_0098838	Ga0495635_0098838_1003_1755	246
89	3300046663	Ga0495635_0207242	Ga0495635_0207242_516_1271	246
90	3300046675	Ga0495657_0081426	Ga0495657_0081426_1183_1935	246
91	3300046675	Ga0495657_0206169	Ga0495657_0206169_312_1067	246
92	3300046678	Ga0495599_0020093	Ga0495599_0020093_3133_3885	246
93	3300046680	Ga0495646_0009412	Ga0495646_0009412_1994_2746	246
94	3300046689	Ga0495613_0023261	Ga0495613_0023261_982_1734	246
95	3300046690	Ga0495624_0011218	Ga0495624_0011218_2279_3031	246
96	3300046809	Ga0495600_0087975	Ga0495600_0087975_1096_1848	246
97	3300047319	Ga0495674_0173300	Ga0495674_0173300_773_1525	246
98	3300047322	Ga0495680_0054859	Ga0495680_0054859_23_778	246
99	3300047444	Ga0495675_0037857	Ga0495675_0037857_775_1527	246
100	3300047471	Ga0495684_0018033	Ga0495684_0018033_1427_2179	246
101	3300047471	Ga0495684_0050874	Ga0495684_0050874_1475_2230	246
102	3300048903	Ga0496100_0202456	Ga0496100_0202456_578_1348	246
103	3300048905	Ga0496102_0069012	Ga0496102_0069012_729_1499	246
104	3300048909	Ga0496106_0028123	Ga0496106_0028123_2937_3707	246
105	3300048910	Ga0496107_0123644	Ga0496107_0123644_967_1728	246
106	3300048912	Ga0496109_0109266	Ga0496109_0109266_255_1025	246
107	3300048913	Ga0496110_0089356	Ga0496110_0089356_1232_2002	246
108	3300048918	Ga0496115_0115163	Ga0496115_0115163_913_1674	246
109	3300050512	nmdc:mga0n895_202424_c1	nmdc:mga0n895_202424_c1_780_1541	246
110	3300003373	JGI25407J50210_10001136	JGI25407J50210_100011366	247
111	3300005981	Ga0081538_10002339	Ga0081538_1000233915	248
112	3300045976	Ga0466967_0064055	Ga0466967_0064055_2292_3053	249
113	3300005435	Ga0070714_100197506	Ga0070714_1001975062	250
114	3300005437	Ga0070710_10080504	Ga0070710_100805042	250
115	3300005439	Ga0070711_100276215	Ga0070711_1002762152	250
116	3300006173	Ga0070716_100143687	Ga0070716_1001436872	250
117	3300014325	Ga0163163_10119373	Ga0163163_101193732	250
118	3300025906	Ga0207699_10223174	Ga0207699_102231742	250
119	3300025915	Ga0207693_10015057	Ga0207693_100150575	250
120	3300025916	Ga0207663_10012231	Ga0207663_100122313	250
121	3300025916	Ga0207663_10218076	Ga0207663_102180762	250
122	3300025928	Ga0207700_10102137	Ga0207700_101021373	250
123	3300025929	Ga0207664_10169346	Ga0207664_101693463	250
124	3300025939	Ga0207665_10073834	Ga0207665_100738343	250
125	3300026041	Ga0207639_10055310	Ga0207639_100553103	250
126	3300026088	Ga0207641_10142536	Ga0207641_101425363	250
127	3300026116	Ga0207674_10054829	Ga0207674_100548293	250
128	3300035083	Ga0373926_0003499	Ga0373926_0003499_2901_3665	250
129	3300035089	Ga0373944_0016049	Ga0373944_0016049_361_1125	250
130	3300035113	Ga0373936_0002343	Ga0373936_0002343_4902_5666	250
131	3300035116	Ga0373945_0000165	Ga0373945_0000165_14318_15082	250
132	3300035119	Ga0373956_0102193	Ga0373956_0102193_34_798	250
133	3300035170	Ga0373943_0000416	Ga0373943_0000416_13501_14265	250
134	3300035171	Ga0373946_0003029	Ga0373946_0003029_1603_2367	250
135	3300035172	Ga0373955_0181046	Ga0373955_0181046_459_1223	250
136	3300035410	Ga0373924_0020765	Ga0373924_0020765_659_1423	250
137	3300035692	Ga0373935_0063854	Ga0373935_0063854_627_1391	250
138	3300035695	Ga0373927_0042407	Ga0373927_0042407_1597_2361	250
139	3300035725	Ga0373947_0002421	Ga0373947_0002421_3188_3952	250
140	3300037068	Ga0373925_0009599	Ga0373925_0009599_3461_4225	250
141	3300037068	Ga0373925_0042630	Ga0373925_0042630_1587_2351	250
142	3300037853	Ga0436364_0862011	Ga0436364_0862011_1227_1997	250
143	3300046461	Ga0495641_0025256	Ga0495641_0025256_732_1496	250
144	3300046463	Ga0495653_0003990	Ga0495653_0003990_1574_2338	250
145	3300046473	Ga0495582_0253421	Ga0495582_0253421_61_825	250
146	3300046475	Ga0495639_0073052	Ga0495639_0073052_403_1167	250
147	3300046477	Ga0495664_0009260	Ga0495664_0009260_4143_4907	250
148	3300046507	Ga0495606_0004441	Ga0495606_0004441_8768_9571	250
149	3300046511	Ga0495608_0051370	Ga0495608_0051370_256_1020	250
150	3300046516	Ga0495628_0207271	Ga0495628_0207271_529_1293	250
151	3300046517	Ga0495630_0029036	Ga0495630_0029036_1995_2759	250
152	3300046529	Ga0495652_0017269	Ga0495652_0017269_1740_2504	250
153	3300046529	Ga0495652_0198919	Ga0495652_0198919_738_1502	250
154	3300046531	Ga0495665_0016135	Ga0495665_0016135_959_1723	250
155	3300046533	Ga0495640_0169041	Ga0495640_0169041_323_1087	250
156	3300046536	Ga0495587_0123056	Ga0495587_0123056_315_1079	250
157	3300046543	Ga0495645_0031886	Ga0495645_0031886_184_948	250
158	3300046559	Ga0495667_0027969	Ga0495667_0027969_1609_2373	250
159	3300046559	Ga0495667_0158580	Ga0495667_0158580_671_1435	250
160	3300046642	Ga0495634_0018678	Ga0495634_0018678_616_1380	250
161	3300046663	Ga0495635_0007012	Ga0495635_0007012_375_1139	250
162	3300046675	Ga0495657_0025864	Ga0495657_0025864_3077_3841	250
163	3300046690	Ga0495624_0025933	Ga0495624_0025933_970_1734	250
164	3300046809	Ga0495600_0027897	Ga0495600_0027897_2611_3375	250
165	3300047319	Ga0495674_0045672	Ga0495674_0045672_1098_1862	250
166	3300047321	Ga0495676_0015287	Ga0495676_0015287_5547_6311	250
167	3300047322	Ga0495680_0014842	Ga0495680_0014842_844_1608	250
168	3300047471	Ga0495684_0006050	Ga0495684_0006050_640_1404	250
169	3300048088	Ga0495602_0179224	Ga0495602_0179224_718_1482	250
170	3300048915	Ga0496112_0366231	Ga0496112_0366231_335_1099	250
171	3300005336	Ga0070680_100186530	Ga0070680_1001865301	251
172	3300021388	Ga0213875_10037691	Ga0213875_100376911	251
173	3300025918	Ga0207662_10052522	Ga0207662_100525222	251
174	3300026078	Ga0207702_10574665	Ga0207702_105746652	251
175	3300037853	Ga0436364_0637047	Ga0436364_0637047_1080_1853	251
176	3300044694	Ga0466963_0126789	Ga0466963_0126789_400_1158	251
177	3300046559	Ga0495667_0024576	Ga0495667_0024576_21_788	251
178	3300046689	Ga0495613_0139124	Ga0495613_0139124_23_790	251
179	3300003323	rootH1_10060104	rootH1_100601047	252
180	3300009176	Ga0105242_10106941	Ga0105242_101069412	252
181	3300013306	Ga0163162_10001085	Ga0163162_1000108519	252
182	3300048929	Ga0496126_0000003	Ga0496126_0000003_248100_248885	252
183	3300003911	JGI25405J52794_10025220	JGI25405J52794_100252201	253
184	3300005437	Ga0070710_10142348	Ga0070710_101423482	253
185	3300005937	Ga0081455_10004088	Ga0081455_1000408810	253
186	3300007076	Ga0075435_100492346	Ga0075435_1004923462	253
187	3300009147	Ga0114129_10045058	Ga0114129_100450583	253
188	3300009177	Ga0105248_10965243	Ga0105248_109652432	253
189	3300015265	Ga0182005_1035671	Ga0182005_10356712	253
190	3300021388	Ga0213875_10002024	Ga0213875_100020246	253
191	3300021388	Ga0213875_10015620	Ga0213875_100156204	253
192	3300035111	Ga0373923_0019502	Ga0373923_0019502_521_1321	253
193	3300035113	Ga0373936_0005842	Ga0373936_0005842_3662_4462	253
194	3300035117	Ga0373953_0143809	Ga0373953_0143809_27_827	253
195	3300035172	Ga0373955_0106198	Ga0373955_0106198_454_1254	253
196	3300035692	Ga0373935_0112811	Ga0373935_0112811_216_1016	253
197	3300035724	Ga0373933_0049368	Ga0373933_0049368_1501_2301	253
198	3300037471	Ga0395905_0009426	Ga0395905_0009426_950_1729	253
199	3300037853	Ga0436364_0820797	Ga0436364_0820797_4551_5324	253
200	3300037853	Ga0436364_1489807	Ga0436364_1489807_8983_9768	253
201	3300039447	Ga0436361_1147847	Ga0436361_1147847_286_1098	253
202	3300044694	Ga0466963_0261559	Ga0466963_0261559_393_1166	253
203	3300046462	Ga0495651_0090277	Ga0495651_0090277_18_818	253
204	3300046463	Ga0495653_0069057	Ga0495653_0069057_1567_2367	253
205	3300046511	Ga0495608_0236792	Ga0495608_0236792_96_896	253
206	3300046663	Ga0495635_0029986	Ga0495635_0029986_2616_3416	253
207	3300046675	Ga0495657_0047984	Ga0495657_0047984_614_1414	253
208	3300046679	Ga0495623_0063271	Ga0495623_0063271_1483_2283	253
209	3300046680	Ga0495646_0285269	Ga0495646_0285269_34_834	253
210	3300046809	Ga0495600_0167214	Ga0495600_0167214_100_900	253
211	3300047319	Ga0495674_0132653	Ga0495674_0132653_1211_2011	253
212	3300047322	Ga0495680_0080814	Ga0495680_0080814_1481_2281	253
213	3300047471	Ga0495684_0036876	Ga0495684_0036876_330_1130	253
214	3300048088	Ga0495602_0234471	Ga0495602_0234471_376_1176	253
215	3300049590	Ga0501074_0362272	Ga0501074_0362272_112_906	253
216	3300049591	Ga0501075_0161614	Ga0501075_0161614_319_1113	253
217	3300049593	Ga0501077_0115844	Ga0501077_0115844_398_1192	253
218	3300049741	Ga0501079_0557211	Ga0501079_0557211_41_835	253
219	3300050509	nmdc:mga0qj67_178142_c1	nmdc:mga0qj67_178142_c1_705_1499	253
220	3300005564	Ga0070664_100598270	Ga0070664_1005982701	254
221	3300005937	Ga0081455_10037104	Ga0081455_100371043	254
222	3300006847	Ga0075431_100067490	Ga0075431_1000674904	254
223	3300009177	Ga0105248_10012340	Ga0105248_1001234012	254
224	3300025909	Ga0207705_10426087	Ga0207705_104260871	254
225	3300032004	Ga0307414_10252900	Ga0307414_102529002	254
226	3300037853	Ga0436364_0342969	Ga0436364_0342969_788_1582	254
227	3300037853	Ga0436364_1261114	Ga0436364_1261114_11_793	254
228	3300050510	nmdc:mga06r32_2940_c1	nmdc:mga06r32_2940_c1_13994_14821	254
229	3300046454	Ga0495592_0049850	Ga0495592_0049850_877_1677	255
230	3300046462	Ga0495651_0000359	Ga0495651_0000359_27598_28398	255
231	3300046463	Ga0495653_0027640	Ga0495653_0027640_3379_4179	255
232	3300046472	Ga0495580_0019393	Ga0495580_0019393_142_942	255
233	3300046476	Ga0495662_0000404	Ga0495662_0000404_15070_15870	255
234	3300046477	Ga0495664_0011154	Ga0495664_0011154_1527_2327	255
235	3300046511	Ga0495608_0005016	Ga0495608_0005016_3282_4082	255
236	3300046516	Ga0495628_0004126	Ga0495628_0004126_10725_11525	255
237	3300046517	Ga0495630_0219151	Ga0495630_0219151_291_1091	255
238	3300046526	Ga0495666_0003482	Ga0495666_0003482_3454_4254	255
239	3300046529	Ga0495652_0017459	Ga0495652_0017459_1705_2505	255
240	3300046531	Ga0495665_0006777	Ga0495665_0006777_3458_4258	255
241	3300046533	Ga0495640_0004992	Ga0495640_0004992_1604_2404	255
242	3300046536	Ga0495587_0000983	Ga0495587_0000983_17025_17825	255
243	3300046559	Ga0495667_0034235	Ga0495667_0034235_1848_2648	255
244	3300046642	Ga0495634_0058949	Ga0495634_0058949_1397_2197	255
245	3300046663	Ga0495635_0057791	Ga0495635_0057791_35_835	255
246	3300046675	Ga0495657_0015436	Ga0495657_0015436_4499_5299	255
247	3300046678	Ga0495599_0073457	Ga0495599_0073457_973_1773	255
248	3300046679	Ga0495623_0064120	Ga0495623_0064120_527_1327	255
249	3300046680	Ga0495646_0001104	Ga0495646_0001104_12908_13708	255
250	3300046689	Ga0495613_0011632	Ga0495613_0011632_4769_5569	255
251	3300046809	Ga0495600_0048800	Ga0495600_0048800_655_1455	255
252	3300047315	Ga0495581_0006157	Ga0495581_0006157_3453_4253	255
253	3300047317	Ga0495604_0000685	Ga0495604_0000685_11439_12239	255
254	3300047444	Ga0495675_0027018	Ga0495675_0027018_2204_3004	255
255	3300047471	Ga0495684_0055917	Ga0495684_0055917_1848_2648	255
256	3300047673	Ga0495593_0028747	Ga0495593_0028747_202_1002	255
257	3300048088	Ga0495602_0007450	Ga0495602_0007450_10285_11085	255
258	3300049822	Ga0501035_0060746	Ga0501035_0060746_1723_2538	255
259	3300053077	Ga0495601_0014857	Ga0495601_0014857_3411_4211	255
260	3300005327	Ga0070658_10036153	Ga0070658_100361533	256
261	3300005329	Ga0070683_100128148	Ga0070683_1001281483	256
262	3300005344	Ga0070661_100010045	Ga0070661_1000100456	256
263	3300005344	Ga0070661_100548532	Ga0070661_1005485321	256
264	3300005366	Ga0070659_100097908	Ga0070659_1000979082	256
265	3300005458	Ga0070681_10195540	Ga0070681_101955402	256
266	3300005530	Ga0070679_100102681	Ga0070679_1001026813	256
267	3300005535	Ga0070684_100064204	Ga0070684_1000642043	256
268	3300005564	Ga0070664_100206916	Ga0070664_1002069162	256
269	3300009545	Ga0105237_10434622	Ga0105237_104346222	256
270	3300010375	Ga0105239_10491957	Ga0105239_104919572	256
271	3300013104	Ga0157370_10172754	Ga0157370_101727542	256
272	3300013105	Ga0157369_10019322	Ga0157369_100193223	256
273	3300025912	Ga0207707_10096780	Ga0207707_100967802	256
274	3300025926	Ga0207659_10258123	Ga0207659_102581231	256
275	3300025944	Ga0207661_10026854	Ga0207661_100268543	256
276	3300044901	Ga0466960_0015992	Ga0466960_0015992_76_870	256
277	3300046463	Ga0495653_0138281	Ga0495653_0138281_191_1024	256
278	3300053085	Ga0495619_0235394	Ga0495619_0235394_390_1223	256
279	3300005456	Ga0070678_100001193	Ga0070678_1000011938	257
280	3300044694	Ga0466963_0351077	Ga0466963_0351077_146_931	257
281	3300047320	Ga0495672_0105769	Ga0495672_0105769_451_1275	257
282	3300048915	Ga0496112_0317096	Ga0496112_0317096_43_861	257
283	iso_pu_bacteria	2867302475	2867308083	257
284	3300005435	Ga0070714_100007958	Ga0070714_1000079587	258
285	3300005435	Ga0070714_100387006	Ga0070714_1003870061	258
286	3300005436	Ga0070713_100042942	Ga0070713_1000429422	258
287	3300005436	Ga0070713_100123555	Ga0070713_1001235551	258
288	3300005437	Ga0070710_10000532	Ga0070710_100005324	258
289	3300005445	Ga0070708_100337684	Ga0070708_1003376842	258
290	3300005467	Ga0070706_100556345	Ga0070706_1005563451	258
291	3300006028	Ga0070717_10045573	Ga0070717_100455735	258
292	3300006028	Ga0070717_10134990	Ga0070717_101349901	258
293	3300009147	Ga0114129_10493834	Ga0114129_104938342	258
294	3300025898	Ga0207692_10003997	Ga0207692_100039974	258
295	3300025906	Ga0207699_10000195	Ga0207699_1000019536	258
296	3300025928	Ga0207700_10004625	Ga0207700_100046252	258
297	3300025928	Ga0207700_10032316	Ga0207700_100323163	258
298	3300025929	Ga0207664_10001763	Ga0207664_100017638	258
299	3300025939	Ga0207665_10009304	Ga0207665_100093042	258
300	3300035111	Ga0373923_0014886	Ga0373923_0014886_1299_2105	258
301	3300035116	Ga0373945_0109498	Ga0373945_0109498_62_868	258
302	3300035119	Ga0373956_0025457	Ga0373956_0025457_678_1484	258
303	3300035120	Ga0373957_0002018	Ga0373957_0002018_3798_4604	258
304	3300035172	Ga0373955_0057028	Ga0373955_0057028_112_918	258
305	3300035692	Ga0373935_0013137	Ga0373935_0013137_512_1318	258
306	3300035695	Ga0373927_0373512	Ga0373927_0373512_99_905	258
307	3300037068	Ga0373925_0053119	Ga0373925_0053119_1315_2121	258
308	3300046454	Ga0495592_0010534	Ga0495592_0010534_5535_6341	258
309	3300046459	Ga0495629_0013474	Ga0495629_0013474_3969_4775	258
310	3300046461	Ga0495641_0020014	Ga0495641_0020014_2419_3225	258
311	3300046473	Ga0495582_0012573	Ga0495582_0012573_3572_4378	258
312	3300046476	Ga0495662_0003731	Ga0495662_0003731_844_1650	258
313	3300046516	Ga0495628_0021977	Ga0495628_0021977_2609_3415	258
314	3300046531	Ga0495665_0013229	Ga0495665_0013229_3596_4402	258
315	3300046642	Ga0495634_0012912	Ga0495634_0012912_2674_3480	258
316	3300046675	Ga0495657_0138964	Ga0495657_0138964_162_968	258
317	3300046678	Ga0495599_0268926	Ga0495599_0268926_117_923	258
318	3300046679	Ga0495623_0013533	Ga0495623_0013533_3325_4131	258
319	3300046683	Ga0495658_0005054	Ga0495658_0005054_1970_2776	258
320	3300046690	Ga0495624_0015745	Ga0495624_0015745_3087_3893	258
321	3300046809	Ga0495600_0017342	Ga0495600_0017342_3270_4076	258
322	3300047315	Ga0495581_0008881	Ga0495581_0008881_1239_2045	258
323	3300047319	Ga0495674_0097408	Ga0495674_0097408_976_1782	258
324	3300047322	Ga0495680_0084456	Ga0495680_0084456_1298_2104	258
325	3300047673	Ga0495593_0020081	Ga0495593_0020081_2756_3562	258
326	3300048088	Ga0495602_0125742	Ga0495602_0125742_353_1159	258
327	3300053077	Ga0495601_0012450	Ga0495601_0012450_706_1512	258
328	3300053078	Ga0495612_0003584	Ga0495612_0003584_2542_3348	258
329	3300053084	Ga0495595_0006963	Ga0495595_0006963_723_1529	258
330	3300003187	JGI25151J46595_10000130	JGI25151J46595_10000130100	259
331	3300003187	JGI25151J46595_10000917	JGI25151J46595_100009176	259
332	3300021384	Ga0213876_10110099	Ga0213876_101100992	259
333	3300025294	Ga0209025_1000152	Ga0209025_1000152133	259
334	3300025297	Ga0209758_1013021	Ga0209758_10130214	259
335	3300039437	Ga0436365_1862477	Ga0436365_1862477_9745_10551	259
336	3300003763	Ga0055529_1000826	Ga0055529_10008267	260
337	3300025228	Ga0209672_102978	Ga0209672_1029783	260
338	3300025242	Ga0209258_103426	Ga0209258_1034264	260
339	3300025272	Ga0209455_1000470	Ga0209455_100047021	260
340	3300025922	Ga0207646_10590473	Ga0207646_105904731	260
341	3300039447	Ga0436361_0108546	Ga0436361_0108546_1458_2291	260
342	3300044658	Ga0466972_0222051	Ga0466972_0222051_68_865	260
343	3300044693	Ga0466961_0148783	Ga0466961_0148783_165_1016	260
344	3300045049	Ga0466959_0010388	Ga0466959_0010388_4273_5124	260
345	3300046477	Ga0495664_0053725	Ga0495664_0053725_1045_1884	260
346	3300046535	Ga0495586_0044497	Ga0495586_0044497_453_1292	260
347	3300046543	Ga0495645_0057425	Ga0495645_0057425_219_1058	260
348	3300047319	Ga0495674_0081828	Ga0495674_0081828_930_1769	260
349	3300053077	Ga0495601_0047767	Ga0495601_0047767_927_1766	260
350	3300053078	Ga0495612_0009980	Ga0495612_0009980_1718_2557	260
351	3300060353	Ga0501082_0269406	Ga0501082_0269406_580_1413	260
352	iso_pu_bacteria	2512875024	2512962215	260
353	3300005436	Ga0070713_100564624	Ga0070713_1005646242	261
354	3300005467	Ga0070706_100082790	Ga0070706_1000827905	261
355	3300005471	Ga0070698_100052374	Ga0070698_1000523743	261
356	3300021361	Ga0213872_10011470	Ga0213872_100114703	261
357	3300025910	Ga0207684_10096554	Ga0207684_100965542	261
358	3300025928	Ga0207700_10498840	Ga0207700_104988401	261
359	3300039447	Ga0436361_0153264	Ga0436361_0153264_1612_2448	261
360	3300050513	nmdc:mga0rr50_383261_c1	nmdc:mga0rr50_383261_c1_241_1062	261
361	3300002987	JGI25159J45721_1003305	JGI25159J45721_10033055	262
362	3300003354	JGI25160J50197_1000095	JGI25160J50197_100009576	262
363	3300003374	JGI25161J50226_1000071	JGI25161J50226_10000718	262
364	3300004625	Ga0055543_1000250	Ga0055543_10002508	262
365	3300005262	Ga0065165_1000408	Ga0065165_100040858	262
366	3300005435	Ga0070714_100001791	Ga0070714_10000179112	262
367	3300005436	Ga0070713_100036681	Ga0070713_1000366812	262
368	3300025284	Ga0209130_1000180	Ga0209130_10001808	262
369	3300025302	Ga0207426_1000017	Ga0207426_1000017463	262
370	3300046507	Ga0495606_0103013	Ga0495606_0103013_611_1450	262
371	3300046512	Ga0495610_0059613	Ga0495610_0059613_25_906	262
372	3300048922	Ga0496119_0038712	Ga0496119_0038712_1390_2229	262
373	3300048928	Ga0496125_0121859	Ga0496125_0121859_494_1333	262
374	3300053139	Ga0500568_0047199	Ga0500568_0047199_753_1592	262
375	3300005436	Ga0070713_100069556	Ga0070713_1000695562	263
376	3300014968	Ga0157379_10005028	Ga0157379_100050285	263
377	3300025915	Ga0207693_10084193	Ga0207693_100841933	263
378	3300038443	Ga0395901_0290220	Ga0395901_0290220_511_1386	263
379	3300005329	Ga0070683_100429877	Ga0070683_1004298771	264
380	3300005434	Ga0070709_10000764	Ga0070709_100007649	264
381	3300005435	Ga0070714_100004707	Ga0070714_1000047073	264
382	3300005436	Ga0070713_100025607	Ga0070713_1000256073	264
383	3300005437	Ga0070710_10000570	Ga0070710_100005704	264
384	3300005439	Ga0070711_100000642	Ga0070711_1000006428	264
385	3300005456	Ga0070678_100035394	Ga0070678_1000353944	264
386	3300006028	Ga0070717_10001066	Ga0070717_100010666	264
387	3300006173	Ga0070716_100000606	Ga0070716_1000006064	264
388	3300006175	Ga0070712_100026610	Ga0070712_1000266102	264
389	3300006852	Ga0075433_10037693	Ga0075433_100376934	264
390	3300007076	Ga0075435_100040114	Ga0075435_1000401141	264
391	3300013296	Ga0157374_10203351	Ga0157374_102033512	264
392	3300025898	Ga0207692_10000658	Ga0207692_100006582	264
393	3300025905	Ga0207685_10001556	Ga0207685_100015565	264
394	3300025906	Ga0207699_10000582	Ga0207699_1000058216	264
395	3300025915	Ga0207693_10184432	Ga0207693_101844322	264
396	3300025916	Ga0207663_10000642	Ga0207663_100006424	264
397	3300025919	Ga0207657_10187653	Ga0207657_101876532	264
398	3300025928	Ga0207700_10000855	Ga0207700_100008559	264
399	3300025929	Ga0207664_10005203	Ga0207664_100052034	264
400	3300025939	Ga0207665_10004153	Ga0207665_100041536	264
401	3300025944	Ga0207661_10303159	Ga0207661_103031591	264
402	3300026121	Ga0207683_10041659	Ga0207683_100416592	264
403	3300035691	Ga0373931_0025403	Ga0373931_0025403_1052_1891	264
404	3300039450	Ga0436363_0482250	Ga0436363_0482250_26_847	264
405	3300048908	Ga0496105_0305572	Ga0496105_0305572_312_1190	264
406	3300048917	Ga0496114_0230437	Ga0496114_0230437_432_1310	264
407	3300050513	nmdc:mga0rr50_12951_c1	nmdc:mga0rr50_12951_c1_1760_2599	264
408	3300050514	nmdc:mga08x19_19992_c1	nmdc:mga08x19_19992_c1_573_1412	264
409	3300050515	nmdc:mga0a205_69782_c1	nmdc:mga0a205_69782_c1_1948_2787	264
410	iso_pu_bacteria	2643221578	2643904319	264
411	iso_pu_bacteria	2643221673	2644402673	264
412	iso_pu_bacteria	2946045630	2946047296	264
413	3300006028	Ga0070717_10189640	Ga0070717_101896403	265
414	3300025912	Ga0207707_10120947	Ga0207707_101209475	265
415	3300025928	Ga0207700_10066318	Ga0207700_100663182	265
416	3300025929	Ga0207664_10008682	Ga0207664_100086822	265
417	3300031456	Ga0307513_10011745	Ga0307513_100117456	265
418	3300048907	Ga0496104_0270235	Ga0496104_0270235_201_1058	265
419	3300002067	JGI24735J21928_10007649	JGI24735J21928_100076492	266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

58

111

0.98 PF13560

HTH_31

Helix-turn-helix domain

53

115

0.95 PF17765

MLTR_LBD

MmyB-like transcription regulator ligand binding domain

138

302

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3eus-assembly1.cif.gz_A	the crystal structure of the dna binding protein from silicibacter pomeroyi	0.9419	8	60
6rnz-assembly2.cif.gz_B	crystal structure of the n-terminal hth dna-binding domain of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti)	0.9373	7	66
1y7y-assembly1.cif.gz_A	high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila	0.9355	8	66
3zkc-assembly1.cif.gz_A	crystal structure of the master regulator for biofilm formation sinr in complex with dna.	0.9333	9	61
1y7y-assembly1.cif.gz_B	high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila	0.9289	8	66

ID	Description	Score	Start	End	Superfamily
1y9qA01	Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains	0.9432	8	60	1.10.260.40
3eusA00	Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains	0.9419	8	60	1.10.260.40
1y7yA00	Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains	0.9355	8	66	1.10.260.40
3zkcA00	Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains	0.9333	9	61	1.10.260.40
1y7yB00	Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains	0.9289	8	66	1.10.260.40

ID	Description	Score	Start	End	GO Terms
AF-A0A3D1V0W1-F1-model_v4	Transcriptional regulator	0.9855	1	80	GO:0003677
AF-A0A7C2JT67-F1-model_v4	XRE family transcriptional regulator	0.9836	2	75	GO:0003677
AF-A0A359KLR9-F1-model_v4	Transcriptional regulator	0.9821	1	76	GO:0003677
AF-A0A6G6WM46-F1-model_v4	Helix-turn-helix transcriptional regulator	0.9805	1	247	GO:0003677
AF-I4WJI1-F1-model_v4	Helix-turn-helix transcriptional regulatory protein	0.9755	6	260	GO:0003677

Feature Viewer

pLDDT	pTM	Quality
89.75	0.84	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F439471

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01381

HTH_3

Helix-turn-helix

58

111

0.98

PF13560

HTH_31

Helix-turn-helix domain

53

115

0.95

PF17765

MLTR_LBD

MmyB-like transcription regulator ligand binding domain

138

302

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map