F439440

General Info

Members Datasets Scaffolds Average Seq Length
419 392 139 305

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1000014|JGI25159J45721_100001475
Length 316
Sequence MTAQTLYPAERGNLRLSFEYFPPKTDEMEVQLFQTAGDLSIFGPAFVTVTYGAGGSTKARSLTTVRRMVEEKGFTNTAAHLTCVGAPKAEVDAVIDEYIDYGVRHFVALRGDPQGGIGSAYQPHPDGYASSTDLVRAIRARGDDIEISVSSYPEKHPESPDVAADIDMLKRKVDAGANRALTQFFFDNNDFERYLERVRRAGINIPIVPGILPINNLAQVQKFAGLCGASVPEAIVTRLVHLEDRPAERFKEATHIAAEQIVDLARRGVRDFHLYTMNRSPLVTAVLDLVGFEQVALEANNALDEAPRTRAAGAAA

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
7 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
8 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
9 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
10 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
11 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
12 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
13 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
14 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
15 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
16 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
17 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
18 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
19 2516143018 Ensifer sp. BR816 Isolate Nodule
20 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
21 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
22 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
23 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
24 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
25 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
26 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
27 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
28 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
29 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
30 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
31 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
32 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
33 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
34 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
35 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
36 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
37 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
38 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
39 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
40 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
41 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
42 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
43 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
44 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
45 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
46 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
47 2643221557 Ensifer sp. Root558 Isolate Unclassified
48 2643221607 Rhizobium sp. Root73 Isolate Unclassified
49 2643221610 Ensifer sp. Root74 Isolate Unclassified
50 2643221618 Ensifer sp. Root231 Isolate Unclassified
51 2643221626 Ensifer sp. Root31 Isolate Unclassified
52 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
53 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
54 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
55 2643221655 Ensifer sp. Root1252 Isolate Unclassified
56 2643221659 Ensifer sp. Root127 Isolate Unclassified
57 2643221668 Ensifer sp. Root423 Isolate Unclassified
58 2643221675 Ensifer sp. Root1298 Isolate Unclassified
59 2643221680 Ensifer sp. Root1312 Isolate Unclassified
60 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
61 2643221688 Rhizobium sp. Root482 Isolate Unclassified
62 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
63 2643221698 Ensifer sp. Root142 Isolate Unclassified
64 2643221712 Ensifer sp. Root258 Isolate Unclassified
65 2643221718 Rhizobium sp. Root268 Isolate Unclassified
66 2643221723 Ensifer sp. Root278 Isolate Unclassified
67 2643221726 Ensifer sp. Root954 Isolate Unclassified
68 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
69 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
70 2718217882 Rhizobium sp. N741 Isolate Nodule
71 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
72 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
73 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
74 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
75 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
76 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
77 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
78 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
79 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
80 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
81 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
82 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
83 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
84 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
85 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
86 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
87 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
88 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
89 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
90 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
91 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
92 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
93 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
94 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
95 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
96 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
97 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
98 2844163670 Ensifer sp. 1H6 Isolate Unclassified
99 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
100 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
101 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
102 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
103 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
104 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
105 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
106 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
107 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
108 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
109 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
110 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
111 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
112 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
113 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
114 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
115 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
116 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
117 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
118 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
119 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
120 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
121 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
122 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
123 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
124 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
125 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
126 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
127 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
128 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
129 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
130 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
131 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
132 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
133 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
134 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
135 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
136 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
137 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
138 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
139 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
140 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
141 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
142 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
143 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
144 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
145 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
146 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
147 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
148 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
149 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
150 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
151 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
152 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
153 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
154 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
155 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
156 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
157 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
158 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
159 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
160 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
161 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
162 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
163 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
164 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
165 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
166 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
167 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
168 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
169 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
170 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
171 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
172 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
173 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
174 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
175 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
176 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
177 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
178 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
179 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
180 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
181 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
182 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
183 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
184 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
185 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
186 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
187 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
188 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
189 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
190 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
191 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
192 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
193 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
194 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
195 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
196 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
197 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
198 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
199 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
200 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
201 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
202 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
203 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
204 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
205 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
206 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
207 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
208 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
209 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
210 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
211 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
212 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
213 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
214 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
215 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
216 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
217 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
218 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
219 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
220 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
221 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
222 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
223 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
224 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
225 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
226 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
227 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
228 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
229 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
230 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
231 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
232 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
233 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
234 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
235 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
236 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
237 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
238 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
239 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
240 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
241 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
242 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
243 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
244 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
245 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
246 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
247 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
248 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
249 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
250 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
251 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
252 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
253 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
254 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
255 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
256 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
257 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
258 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
259 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
260 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
261 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
262 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
263 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
264 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
265 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
266 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
267 2996893221 Rhizobium sp. R635 Isolate Nodule
268 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
269 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
270 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
271 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
272 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
273 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
274 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
275 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
276 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
277 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
278 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
279 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
280 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
281 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
282 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
283 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
284 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
285 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
286 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
287 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
288 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
289 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
290 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
291 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
292 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
293 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
294 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
295 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
296 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
297 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
298 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
299 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
300 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
301 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
302 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
303 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
304 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
305 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
306 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
307 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
308 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
309 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
310 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
311 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
312 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
313 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
314 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
315 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
316 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
318 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
320 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
321 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
322 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
323 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
325 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
326 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
327 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
328 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
329 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
330 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
331 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
332 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
333 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
334 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
335 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
336 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
337 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
338 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
339 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
340 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
341 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
342 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
343 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
344 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
345 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
346 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
347 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
348 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
349 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
350 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
351 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
352 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
353 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
354 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
355 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
356 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
357 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
358 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
359 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
360 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
361 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
362 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
363 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
364 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
365 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
373 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
374 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
375 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
376 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
377 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
378 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
379 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
380 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
383 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
384 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
385 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
386 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
387 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
388 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
389 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
390 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
391 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
392 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 32.7
Metatranscriptomes 0.48
Isolates 66.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.5
Nodule 55.85
Rhizoplane 0.48
Rhizosphere 14.08
Stem 0
Stem Tuber 0
Unclassified 19.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C10235 2010549000 Bacteria 1214
2 JGI24740J21852_10000504 3300001979 Bacteria 16777
3 JGI25155J39150_1000001 3300002704 Bacteria 354543
4 JGI25156J39149_1000001 3300002705 Bacteria 354557
5 JGI25162J39368_1000366 3300002737 Bacteria 38535
6 JGI25162J39368_1000368 3300002737 Bacteria 38495
7 JGI25154J39366_1000122 3300002738 Bacteria 61892
8 JGI25158J39367_1000325 3300002739 Bacteria 10567
9 JGI25157J39369_1000044 3300002741 Bacteria 122466
10 JGI25152J39213_1004106 3300002773 Bacteria 4708
11 JGI25150J39212_1009558 3300002774 Bacteria 1838
12 JGI25159J45721_1000014 3300002987 Bacteria 147809
13 JGI25159J45721_1004042 3300002987 Bacteria 4989
14 JGI25151J46595_10003192 3300003187 Bacteria 9187
15 JGI25165J46597_1000516 3300003214 Bacteria 36635
16 JGI25165J46597_1002113 3300003214 Bacteria 7222
17 rootH2_10049022 3300003320 Bacteria 4811
18 rootL2_10010590 3300003322 Bacteria 17548
19 rootL2_10339331 3300003322 Bacteria 1961
20 rootH1_10166190 3300003323 Bacteria 3805
21 JGI25160J50197_1000001 3300003354 Bacteria 782301
22 JGI25160J50197_1000020 3300003354 Bacteria 232739
23 JGI25161J50226_1000843 3300003374 Bacteria 11421
24 Ga0055526_1003164 3300003771 Bacteria 10669
25 Ga0055526_1005167 3300003771 Bacteria 7592
26 Ga0055524_1002147 3300003775 Bacteria 10378
27 Ga0055536_1003419 3300003781 Bacteria 8534
28 Ga0055528_1030757 3300003790 Bacteria 1414
29 Ga0055543_1000047 3300004625 Bacteria 111073
30 Ga0065165_1000013 3300005262 Bacteria 301887
31 Ga0070665_100232788 3300005548 Bacteria 1842
32 Ga0075364_10000023 3300006051 Bacteria 52112
33 Ga0075370_10107030 3300006353 Bacteria 1622
34 Ga0075428_100385688 3300006844 Bacteria 1502
35 Ga0079104_1004188 3300006946 Bacteria 6279
36 Ga0123341_1000007 3300009765 Bacteria 147072
37 Ga0157373_10315034 3300013100 Bacteria 1112
38 Ga0157370_10039669 3300013104 Bacteria 4550
39 Ga0171463_1003 3300013249 Bacteria 695693
40 Ga0183363_1158 3300015690 Bacteria 16472
41 Ga0214544_1003096 3300021320 Bacteria 34775
42 Ga0214542_1000012 3300021321 Bacteria 235800
43 Ga0214542_1022571 3300021321 Bacteria 4002
44 Ga0214543_1000024 3300021327 Bacteria 235745
45 Ga0214543_1000038 3300021327 Bacteria 182106
46 Ga0228711_1000008 3300022739 Bacteria 169893
47 Ga0228710_1000009 3300022740 Bacteria 169770
48 Ga0209435_100012 3300025206 Bacteria 401621
49 Ga0209436_106541 3300025208 Bacteria 2541
50 Ga0209437_100098 3300025233 Bacteria 229766
51 Ga0209646_1000026 3300025246 Bacteria 401621
52 Ga0209026_1000014 3300025250 Bacteria 401621
53 Ga0209148_1003967 3300025254 Bacteria 3802
54 Ga0209759_1000012 3300025256 Bacteria 401621
55 Ga0209233_1000095 3300025261 Bacteria 303783
56 Ga0209565_1019078 3300025263 Bacteria 1471
57 Ga0209455_1003089 3300025272 Bacteria 6076
58 Ga0209130_1000034 3300025284 Bacteria 302439
59 Ga0209676_1016115 3300025292 Bacteria 2717
60 Ga0209025_1000140 3300025294 Bacteria 184765
61 Ga0209564_1000013 3300025295 Bacteria 775755
62 Ga0209256_1000396 3300025299 Bacteria 69216
63 Ga0209256_1001575 3300025299 Bacteria 22398
64 Ga0207426_1000006 3300025302 Bacteria 1025969
65 Ga0209051_1009570 3300025303 Bacteria 4981
66 Ga0209281_1000106 3300027111 Bacteria 219666
67 Ga0209281_1000318 3300027111 Bacteria 85039
68 Ga0209282_1000024 3300027666 Bacteria 170348
69 Ga0209971_1008553 3300027682 Bacteria 2429
70 Ga0209974_10007691 3300027876 Bacteria 3707
71 Ga0307515_10003171 3300028794 Bacteria 34790
72 Ga0307515_10024662 3300028794 Bacteria 10461
73 Ga0307513_10070798 3300031456 Bacteria 3643
74 Ga0307408_100162566 3300031548 Bacteria 1775
75 Ga0307412_10130624 3300031911 Bacteria 1824
76 Ga0315914_1000012 3300031967 Bacteria 169896
77 Ga0307416_100189608 3300032002 Bacteria 1937
78 Ga0307414_10110176 3300032004 Bacteria 2093
79 Ga0315913_1000006 3300033430 Bacteria 169893
80 Ga0315915_1000010 3300033464 Bacteria 240214
81 Ga0395905_0009335 3300037471 Bacteria 9593
82 Ga0395905_0027015 3300037471 Bacteria 5412
83 Ga0400484_23959 3300038725 Bacteria 1210
84 Ga0400483_020048 3300039062 Bacteria 2604
85 Ga0400483_077901 3300039062 Bacteria 2412
86 Ga0400483_169415 3300039062 Bacteria 1643
87 Ga0400483_201631 3300039062 Bacteria 7005
88 Ga0439436_0005264 3300041404 Bacteria 3961
89 Ga0439439_0016413 3300041406 Bacteria 1813
90 Ga0439439_0059105 3300041406 Bacteria 1015
91 Ga0439465_0000968 3300041413 Bacteria 9139
92 Ga0439465_0022316 3300041413 Bacteria 1988
93 Ga0451849_0068144 3300041505 Bacteria 2237
94 Ga0439449_0024568 3300042007 Bacteria 2252
95 Ga0450906_003444 3300042145 Bacteria 3403
96 Ga0450907_009518 3300042146 Bacteria 1610
97 Ga0450918_002667 3300042531 Bacteria 3360
98 Ga0466963_0055077 3300044694 Bacteria 2644
99 Ga0466970_0001585 3300044765 Bacteria 10982
100 Ga0466958_0031738 3300045836 Bacteria 3140
101 Ga0495638_0079800 3300046460 Bacteria 1989
102 Ga0495583_0018024 3300046506 Bacteria 3731
103 Ga0495632_0029814 3300046519 Bacteria 2837
104 Ga0495625_0114175 3300046660 Bacteria 1844
105 Ga0495661_0091572 3300046665 Bacteria 1729
106 Ga0496117_0032165 3300048920 Bacteria 3990
107 Ga0496119_0010204 3300048922 Bacteria 7927
108 Ga0496120_0024044 3300048923 Bacteria 3806
109 Ga0496120_0088061 3300048923 Bacteria 1665
110 Ga0496121_0001116 3300048924 Bacteria 47237
111 Ga0496122_0000840 3300048925 Bacteria 58107
112 Ga0496122_0059272 3300048925 Bacteria 2826
113 Ga0496123_0000336 3300048926 Bacteria 89161
114 Ga0496123_0066534 3300048926 Bacteria 2282
115 Ga0496124_0003209 3300048927 Bacteria 20191
116 Ga0496124_0040780 3300048927 Bacteria 4013
117 Ga0496124_0077115 3300048927 Bacteria 2749
118 Ga0496124_0144773 3300048927 Bacteria 1871
119 Ga0496125_0000248 3300048928 Bacteria 110840
120 Ga0496125_0065892 3300048928 Bacteria 2866
121 Ga0496126_0000866 3300048929 Bacteria 53241
122 Ga0501032_0054453 3300049569 Bacteria 2692
123 Ga0501033_0000483 3300049570 Bacteria 37535
124 Ga0501033_0139981 3300049570 Bacteria 1749
125 Ga0501034_0104725 3300049571 Bacteria 2822
126 Ga0501036_0482583 3300049572 Bacteria 1032
127 Ga0501038_0099208 3300049574 Bacteria 2428
128 Ga0501039_0101795 3300049575 Bacteria 2242
129 Ga0501043_0076052 3300049579 Bacteria 2637
130 Ga0501035_0154476 3300049822 Bacteria 1989
131 Ga0500644_0066070 3300053088 Bacteria 1289
132 Ga0500651_0044368 3300053093 Bacteria 2800
133 Ga0500556_0032567 3300053104 Bacteria 1782
134 Ga0500608_031878 3300053122 Bacteria 2503
135 Ga0500618_006853 3300053125 Bacteria 3303
136 Ga0500622_0000627 3300053156 Bacteria 31781
137 Ga0500627_0211901 3300053158 Bacteria 866
138 Ga0587106_004282 3300059605 Bacteria 1560
139 Ga0587079_026932 3300059647 Bacteria 1078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0482583 Ga0501036_0482583_23_793 253
2 3300013104 Ga0157370_10039669 Ga0157370_100396693 263
3 3300006844 Ga0075428_100385688 Ga0075428_1003856882 272
4 3300053158 Ga0500627_0211901 Ga0500627_0211901_25_855 272
5 3300027682 Ga0209971_1008553 Ga0209971_10085532 273
6 3300027876 Ga0209974_10007691 Ga0209974_100076912 273
7 3300002737 JGI25162J39368_1000368 JGI25162J39368_10003683 277
8 3300003214 JGI25165J46597_1000516 JGI25165J46597_100051631 277
9 3300013100 Ga0157373_10315034 Ga0157373_103150342 277
10 3300025233 Ga0209437_100098 Ga0209437_100098151 277
11 3300025261 Ga0209233_1000095 Ga0209233_1000095268 277
12 3300048922 Ga0496119_0010204 Ga0496119_0010204_50_952 277
13 3300048923 Ga0496120_0024044 Ga0496120_0024044_1445_2347 277
14 3300048925 Ga0496122_0059272 Ga0496122_0059272_54_956 277
15 3300048926 Ga0496123_0066534 Ga0496123_0066534_1095_1997 277
16 3300048927 Ga0496124_0040780 Ga0496124_0040780_1252_2154 277
17 3300038725 Ga0400484_23959 Ga0400484_23959_310_1167 280
18 3300039062 Ga0400483_020048 Ga0400483_020048_266_1126 280
19 3300039062 Ga0400483_077901 Ga0400483_077901_568_1428 280
20 3300039062 Ga0400483_169415 Ga0400483_169415_196_1053 280
21 3300039062 Ga0400483_201631 Ga0400483_201631_2931_3788 280
22 3300059605 Ga0587106_004282 Ga0587106_004282_609_1511 283
23 3300059647 Ga0587079_026932 Ga0587079_026932_55_957 283
24 3300003320 rootH2_10049022 rootH2_100490223 284
25 3300003322 rootL2_10010590 rootL2_1001059014 284
26 3300003323 rootH1_10166190 rootH1_101661902 284
27 3300032002 Ga0307416_100189608 Ga0307416_1001896081 284
28 3300048924 Ga0496121_0001116 Ga0496121_0001116_11731_12636 285
29 3300001979 JGI24740J21852_10000504 JGI24740J21852_1000050416 286
30 iso_pu_bacteria 2995392953 2995393262 288
31 3300003322 rootL2_10339331 rootL2_103393312 290
32 3300002704 JGI25155J39150_1000001 JGI25155J39150_1000001310 291
33 3300002705 JGI25156J39149_1000001 JGI25156J39149_100000122 291
34 3300002738 JGI25154J39366_1000122 JGI25154J39366_100012234 291
35 3300002741 JGI25157J39369_1000044 JGI25157J39369_100004422 291
36 3300025206 Ga0209435_100012 Ga0209435_100012360 291
37 3300025246 Ga0209646_1000026 Ga0209646_1000026360 291
38 3300025250 Ga0209026_1000014 Ga0209026_1000014360 291
39 3300025256 Ga0209759_1000012 Ga0209759_1000012360 291
40 iso_pu_bacteria 2791355253 2793280288 291
41 3300044694 Ga0466963_0055077 Ga0466963_0055077_120_1022 292
42 3300044765 Ga0466970_0001585 Ga0466970_0001585_8375_9277 292
43 3300045836 Ga0466958_0031738 Ga0466958_0031738_1438_2340 292
44 3300046460 Ga0495638_0079800 Ga0495638_0079800_1068_1958 292
45 3300046519 Ga0495632_0029814 Ga0495632_0029814_348_1247 292
46 3300053088 Ga0500644_0066070 Ga0500644_0066070_74_964 292
47 3300053122 Ga0500608_031878 Ga0500608_031878_1182_2072 292
48 3300053156 Ga0500622_0000627 Ga0500622_0000627_29368_30258 292
49 iso_pu_bacteria 2510917022 2511135418 292
50 iso_pu_bacteria 2582581307 2585271155 292
51 iso_pu_bacteria 2585427531 2585558879 292
52 iso_pu_bacteria 2585427608 2585898260 292
53 iso_pu_bacteria 2585427609 2585904151 292
54 iso_pu_bacteria 2585428125 2587980732 292
55 iso_pu_bacteria 2891048133 2891051821 292
56 iso_pu_bacteria 8054558443 8054558626 292
57 iso_pu_bacteria 2582581299 2585231760 293
58 iso_pu_bacteria 2643221634 2644193526 293
59 iso_pu_bacteria 2838661181 2838661572 293
60 3300037471 Ga0395905_0009335 Ga0395905_0009335_6454_7350 294
61 3300037471 Ga0395905_0027015 Ga0395905_0027015_695_1594 294
62 3300053104 Ga0500556_0032567 Ga0500556_0032567_801_1700 294
63 iso_pu_bacteria 2508501122 2509108378 294
64 iso_pu_bacteria 2509276019 2509376489 294
65 iso_pu_bacteria 2509276033 2509445630 294
66 iso_pu_bacteria 2509276033 2509447069 294
67 iso_pu_bacteria 2510065057 2510306472 294
68 iso_pu_bacteria 2511231052 2511502262 294
69 iso_pu_bacteria 2512047086 2512533635 294
70 iso_pu_bacteria 2512875026 2512970665 294
71 iso_pu_bacteria 2513237086 2513584366 294
72 iso_pu_bacteria 2513237089 2513604292 294
73 iso_pu_bacteria 2513237091 2513618822 294
74 iso_pu_bacteria 2513237140 2513884387 294
75 iso_pu_bacteria 2513237143 2513905027 294
76 iso_pu_bacteria 2513237156 2513988371 294
77 iso_pu_bacteria 2513237159 2514001485 294
78 iso_pu_bacteria 2513237160 2514006360 294
79 iso_pu_bacteria 2515154107 2515609038 294
80 iso_pu_bacteria 2516143018 2516204163 294
81 iso_pu_bacteria 2516653046 2516893641 294
82 iso_pu_bacteria 2517487022 2517570364 294
83 iso_pu_bacteria 2524023207 2524448538 294
84 iso_pu_bacteria 2524023209 2524459605 294
85 iso_pu_bacteria 2551306084 2551674525 294
86 iso_pu_bacteria 2551306084 2551677906 294
87 iso_pu_bacteria 2551306085 2551687719 294
88 iso_pu_bacteria 2551306086 2551691406 294
89 iso_pu_bacteria 2551306087 2551698038 294
90 iso_pu_bacteria 2551306089 2551715597 294
91 iso_pu_bacteria 2551306090 2551715860 294
92 iso_pu_bacteria 2551306093 2551744450 294
93 iso_pu_bacteria 2558860100 2558864443 294
94 iso_pu_bacteria 2582581283 2585166368 294
95 iso_pu_bacteria 2582581306 2585267404 294
96 iso_pu_bacteria 2582581316 2585331459 294
97 iso_pu_bacteria 2582581865 2585386472 294
98 iso_pu_bacteria 2582581866 2585393274 294
99 iso_pu_bacteria 2599185156 2599331769 294
100 iso_pu_bacteria 2599185352 2600195501 294
101 iso_pu_bacteria 2615840698 2616554245 294
102 iso_pu_bacteria 2617270742 2617383586 294
103 iso_pu_bacteria 2643221557 2643803070 294
104 iso_pu_bacteria 2643221607 2644050499 294
105 iso_pu_bacteria 2643221610 2644063432 294
106 iso_pu_bacteria 2643221618 2644107260 294
107 iso_pu_bacteria 2643221626 2644150826 294
108 iso_pu_bacteria 2643221636 2644205727 294
109 iso_pu_bacteria 2643221637 2644209010 294
110 iso_pu_bacteria 2643221655 2644308655 294
111 iso_pu_bacteria 2643221659 2644335473 294
112 iso_pu_bacteria 2643221668 2644374715 294
113 iso_pu_bacteria 2643221675 2644414195 294
114 iso_pu_bacteria 2643221680 2644447723 294
115 iso_pu_bacteria 2643221686 2644483417 294
116 iso_pu_bacteria 2643221688 2644492048 294
117 iso_pu_bacteria 2643221689 2644499629 294
118 iso_pu_bacteria 2643221698 2644539878 294
119 iso_pu_bacteria 2643221712 2644614596 294
120 iso_pu_bacteria 2643221718 2644652540 294
121 iso_pu_bacteria 2643221723 2644676061 294
122 iso_pu_bacteria 2643221726 2644690196 294
123 iso_pu_bacteria 2690316117 2692315523 294
124 iso_pu_bacteria 2718217882 2719181823 294
125 iso_pu_bacteria 2751185821 2753462045 294
126 iso_pu_bacteria 2775507266 2778175433 294
127 iso_pu_bacteria 2791355091 2792620753 294
128 iso_pu_bacteria 2791355092 2792626112 294
129 iso_pu_bacteria 2791355094 2792639049 294
130 iso_pu_bacteria 2791355259 2793314527 294
131 iso_pu_bacteria 2802428858 2802720060 294
132 iso_pu_bacteria 2802428859 2802727007 294
133 iso_pu_bacteria 2802428860 2802731990 294
134 iso_pu_bacteria 2802428861 2802739321 294
135 iso_pu_bacteria 2802428862 2802745698 294
136 iso_pu_bacteria 2802428863 2802752299 294
137 iso_pu_bacteria 2818991448 2819609165 294
138 iso_pu_bacteria 2838029111 2838029788 294
139 iso_pu_bacteria 2838074704 2838076841 294
140 iso_pu_bacteria 2842298080 2842301387 294
141 iso_pu_bacteria 2842357229 2842357924 294
142 iso_pu_bacteria 2842475841 2842476927 294
143 iso_pu_bacteria 2842482326 2842484543 294
144 iso_pu_bacteria 2842502639 2842503316 294
145 iso_pu_bacteria 2842509118 2842511112 294
146 iso_pu_bacteria 2842521101 2842521833 294
147 iso_pu_bacteria 2842922631 2842924175 294
148 iso_pu_bacteria 2844163670 2844164594 294
149 iso_pu_bacteria 2847417321 2847419415 294
150 iso_pu_bacteria 2848992105 2848994443 294
151 iso_pu_bacteria 2850079185 2850081486 294
152 iso_pu_bacteria 2855825444 2855826363 294
153 iso_pu_bacteria 2855839649 2855841752 294
154 iso_pu_bacteria 2855872281 2855872503 294
155 iso_pu_bacteria 2858800743 2858802537 294
156 iso_pu_bacteria 2891373044 2891373367 294
157 iso_pu_bacteria 2896384573 2896389008 294
158 iso_pu_bacteria 2915980308 2915981471 294
159 iso_pu_bacteria 2915986958 2915991465 294
160 iso_pu_bacteria 2915993759 2915998722 294
161 iso_pu_bacteria 2916000859 2916003464 294
162 iso_pu_bacteria 2916007675 2916009823 294
163 iso_pu_bacteria 2916014648 2916019562 294
164 iso_pu_bacteria 2916021584 2916024936 294
165 iso_pu_bacteria 2916035215 2916037888 294
166 iso_pu_bacteria 2916041962 2916045312 294
167 iso_pu_bacteria 2916048683 2916049064 294
168 iso_pu_bacteria 2916055098 2916055698 294
169 iso_pu_bacteria 2916061851 2916064872 294
170 iso_pu_bacteria 2919408235 2919409997 294
171 iso_pu_bacteria 2920760137 2920761502 294
172 iso_pu_bacteria 2920822456 2920825234 294
173 iso_pu_bacteria 2921208531 2921209532 294
174 iso_pu_bacteria 2921237296 2921240908 294
175 iso_pu_bacteria 2921244191 2921246752 294
176 iso_pu_bacteria 2921250672 2921252118 294
177 iso_pu_bacteria 2921257292 2921263788 294
178 iso_pu_bacteria 2921263974 2921266231 294
179 iso_pu_bacteria 2921282425 2921287997 294
180 iso_pu_bacteria 2921289301 2921290934 294
181 iso_pu_bacteria 2921296804 2921299059 294
182 iso_pu_bacteria 2924144063 2924146732 294
183 iso_pu_bacteria 2924150972 2924157970 294
184 iso_pu_bacteria 2924158325 2924159296 294
185 iso_pu_bacteria 2924165586 2924169138 294
186 iso_pu_bacteria 2924172951 2924174547 294
187 iso_pu_bacteria 2924179722 2924182978 294
188 iso_pu_bacteria 2924186466 2924192689 294
189 iso_pu_bacteria 2924193448 2924195406 294
190 iso_pu_bacteria 2924200457 2924203303 294
191 iso_pu_bacteria 2924207177 2924210722 294
192 iso_pu_bacteria 2924214083 2924216803 294
193 iso_pu_bacteria 2924221636 2924223272 294
194 iso_pu_bacteria 2924228884 2924230542 294
195 iso_pu_bacteria 2936996657 2937000726 294
196 iso_pu_bacteria 2937002841 2937004537 294
197 iso_pu_bacteria 2937009748 2937011219 294
198 iso_pu_bacteria 2937016420 2937019802 294
199 iso_pu_bacteria 2937023124 2937024606 294
200 iso_pu_bacteria 2937029754 2937030318 294
201 iso_pu_bacteria 2937036028 2937042700 294
202 iso_pu_bacteria 2937042894 2937047964 294
203 iso_pu_bacteria 2937049772 2937056175 294
204 iso_pu_bacteria 2937056579 2937063549 294
205 iso_pu_bacteria 2937063883 2937067795 294
206 iso_pu_bacteria 2937071275 2937074412 294
207 iso_pu_bacteria 2937078374 2937080244 294
208 iso_pu_bacteria 2937084907 2937086362 294
209 iso_pu_bacteria 2937091812 2937097242 294
210 iso_pu_bacteria 2937106411 2937111278 294
211 iso_pu_bacteria 2937113482 2937116122 294
212 iso_pu_bacteria 2937119839 2937122006 294
213 iso_pu_bacteria 2937126314 2937128847 294
214 iso_pu_bacteria 2941499720 2941502117 294
215 iso_pu_bacteria 2957375807 2957376353 294
216 iso_pu_bacteria 2957382221 2957384256 294
217 iso_pu_bacteria 2957388812 2957390719 294
218 iso_pu_bacteria 2957395598 2957395874 294
219 iso_pu_bacteria 2957402308 2957404481 294
220 iso_pu_bacteria 2957415311 2957421230 294
221 iso_pu_bacteria 2957422303 2957429633 294
222 iso_pu_bacteria 2957430029 2957431737 294
223 iso_pu_bacteria 2957437181 2957439387 294
224 iso_pu_bacteria 2957443900 2957446887 294
225 iso_pu_bacteria 2957450854 2957453729 294
226 iso_pu_bacteria 2957457609 2957461925 294
227 iso_pu_bacteria 2957464669 2957467023 294
228 iso_pu_bacteria 2957478035 2957479583 294
229 iso_pu_bacteria 2957484790 2957490441 294
230 iso_pu_bacteria 2957491536 2957494128 294
231 iso_pu_bacteria 2957498199 2957503331 294
232 iso_pu_bacteria 2957505466 2957510635 294
233 iso_pu_bacteria 2960584000 2960584498 294
234 iso_pu_bacteria 2960591022 2960592118 294
235 iso_pu_bacteria 2960597568 2960599972 294
236 iso_pu_bacteria 2960603979 2960610610 294
237 iso_pu_bacteria 2960610863 2960612295 294
238 iso_pu_bacteria 2960617483 2960620485 294
239 iso_pu_bacteria 2960624210 2960624460 294
240 iso_pu_bacteria 2960631154 2960632078 294
241 iso_pu_bacteria 2960652885 2960656505 294
242 iso_pu_bacteria 2960660292 2960665546 294
243 iso_pu_bacteria 2960667422 2960669679 294
244 iso_pu_bacteria 2960674078 2960675139 294
245 iso_pu_bacteria 2960680706 2960681653 294
246 iso_pu_bacteria 2960687367 2960692514 294
247 iso_pu_bacteria 2960693952 2960694771 294
248 iso_pu_bacteria 2964607997 2964614146 294
249 iso_pu_bacteria 2964615318 2964617726 294
250 iso_pu_bacteria 2964621998 2964623612 294
251 iso_pu_bacteria 2964628898 2964632607 294
252 iso_pu_bacteria 2964636051 2964640798 294
253 iso_pu_bacteria 2964643177 2964645665 294
254 iso_pu_bacteria 2964649959 2964651576 294
255 iso_pu_bacteria 2964656573 2964660546 294
256 iso_pu_bacteria 2964663802 2964666902 294
257 iso_pu_bacteria 2964670856 2964671982 294
258 iso_pu_bacteria 2964678106 2964682895 294
259 iso_pu_bacteria 2964685014 2964688503 294
260 iso_pu_bacteria 2964691889 2964692500 294
261 iso_pu_bacteria 2964698721 2964701622 294
262 iso_pu_bacteria 2964705432 2964711072 294
263 iso_pu_bacteria 2964719344 2964720699 294
264 iso_pu_bacteria 2967671571 2967678393 294
265 iso_pu_bacteria 2967678726 2967684405 294
266 iso_pu_bacteria 2967686174 2967692101 294
267 iso_pu_bacteria 2967693043 2967694664 294
268 iso_pu_bacteria 2967706974 2967708642 294
269 iso_pu_bacteria 2967714385 2967714895 294
270 iso_pu_bacteria 2967728569 2967728963 294
271 iso_pu_bacteria 2967735183 2967737168 294
272 iso_pu_bacteria 2967742019 2967742777 294
273 iso_pu_bacteria 2967748971 2967751582 294
274 iso_pu_bacteria 2967755722 2967757891 294
275 iso_pu_bacteria 2967762386 2967767689 294
276 iso_pu_bacteria 2967769361 2967772100 294
277 iso_pu_bacteria 2967775926 2967779001 294
278 iso_pu_bacteria 2970019648 2970021041 294
279 iso_pu_bacteria 2970026789 2970028313 294
280 iso_pu_bacteria 2970033650 2970040310 294
281 iso_pu_bacteria 2970040964 2970042660 294
282 iso_pu_bacteria 2970047711 2970050991 294
283 iso_pu_bacteria 2970054988 2970056721 294
284 iso_pu_bacteria 2970061556 2970067163 294
285 iso_pu_bacteria 2970068827 2970071607 294
286 iso_pu_bacteria 2970076120 2970078283 294
287 iso_pu_bacteria 2970082768 2970085265 294
288 iso_pu_bacteria 2970088815 2970092567 294
289 iso_pu_bacteria 2970095765 2970097230 294
290 iso_pu_bacteria 2970102677 2970107977 294
291 iso_pu_bacteria 2970109326 2970110729 294
292 iso_pu_bacteria 2970116247 2970117375 294
293 iso_pu_bacteria 2970122695 2970125792 294
294 iso_pu_bacteria 2970129317 2970131145 294
295 iso_pu_bacteria 2970136068 2970136313 294
296 iso_pu_bacteria 2970143518 2970146698 294
297 iso_pu_bacteria 2970149975 2970151595 294
298 iso_pu_bacteria 2970156795 2970159588 294
299 iso_pu_bacteria 2970164137 2970166957 294
300 iso_pu_bacteria 2970170962 2970174263 294
301 iso_pu_bacteria 2970177841 2970180845 294
302 iso_pu_bacteria 2970184632 2970189190 294
303 iso_pu_bacteria 2970191845 2970193620 294
304 iso_pu_bacteria 2977523885 2977528849 294
305 iso_pu_bacteria 2977530762 2977534025 294
306 iso_pu_bacteria 2977537788 2977539646 294
307 iso_pu_bacteria 2977544691 2977546390 294
308 iso_pu_bacteria 2977551784 2977558452 294
309 iso_pu_bacteria 2977558990 2977563193 294
310 iso_pu_bacteria 2977565890 2977567686 294
311 iso_pu_bacteria 2977572785 2977575726 294
312 iso_pu_bacteria 2977579622 2977581977 294
313 iso_pu_bacteria 2989349275 2989349691 294
314 iso_pu_bacteria 2996893221 2996894313 294
315 iso_pu_bacteria 643692032 643826329 294
316 iso_pu_bacteria 648276728 648739230 294
317 iso_pu_bacteria 8003992118 8003994186 294
318 iso_pu_bacteria 8003999396 8004001828 294
319 iso_pu_bacteria 8005301065 8005303140 294
320 iso_pu_bacteria 8005682033 8005682872 294
321 iso_pu_bacteria 8005688590 8005692092 294
322 iso_pu_bacteria 8046767195 8046771951 294
323 iso_pu_bacteria 8057575449 8057575720 294
324 3300049570 Ga0501033_0000483 Ga0501033_0000483_22847_23761 295
325 iso_pu_bacteria 2657244999 2657681579 295
326 iso_pu_bacteria 2791355082 2792585110 295
327 iso_pu_bacteria 2802429268 2804752770 295
328 iso_pu_bacteria 2913295892 2913299293 295
329 iso_pu_bacteria 3003930520 3003934086 295
330 iso_pu_bacteria 8049293176 8049295340 295
331 3300002773 JGI25152J39213_1004106 JGI25152J39213_10041062 297
332 3300041413 Ga0439465_0000968 Ga0439465_0000968_5378_6280 297
333 3300046506 Ga0495583_0018024 Ga0495583_0018024_1150_2049 297
334 3300046660 Ga0495625_0114175 Ga0495625_0114175_358_1257 297
335 3300046665 Ga0495661_0091572 Ga0495661_0091572_129_1028 297
336 3300048927 Ga0496124_0077115 Ga0496124_0077115_687_1586 297
337 3300048927 Ga0496124_0144773 Ga0496124_0144773_36_935 297
338 3300002737 JGI25162J39368_1000366 JGI25162J39368_10003663 298
339 3300002739 JGI25158J39367_1000325 JGI25158J39367_10003253 298
340 3300002774 JGI25150J39212_1009558 JGI25150J39212_10095582 298
341 3300002987 JGI25159J45721_1000014 JGI25159J45721_100001475 298
342 3300002987 JGI25159J45721_1004042 JGI25159J45721_10040423 298
343 3300003187 JGI25151J46595_10003192 JGI25151J46595_100031926 298
344 3300003214 JGI25165J46597_1002113 JGI25165J46597_10021135 298
345 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001636 298
346 3300003354 JGI25160J50197_1000020 JGI25160J50197_100002075 298
347 3300003374 JGI25161J50226_1000843 JGI25161J50226_10008433 298
348 3300003771 Ga0055526_1003164 Ga0055526_10031648 298
349 3300003771 Ga0055526_1005167 Ga0055526_10051674 298
350 3300003775 Ga0055524_1002147 Ga0055524_10021477 298
351 3300003781 Ga0055536_1003419 Ga0055536_10034197 298
352 3300003790 Ga0055528_1030757 Ga0055528_10307572 298
353 3300004625 Ga0055543_1000047 Ga0055543_100004721 298
354 3300005262 Ga0065165_1000013 Ga0065165_1000013143 298
355 3300005548 Ga0070665_100232788 Ga0070665_1002327883 298
356 3300006051 Ga0075364_10000023 Ga0075364_1000002345 298
357 3300006946 Ga0079104_1004188 Ga0079104_10041885 298
358 3300009765 Ga0123341_1000007 Ga0123341_100000767 298
359 3300013249 Ga0171463_1003 Ga0171463_1003146 298
360 3300015690 Ga0183363_1158 Ga0183363_115811 298
361 3300021321 Ga0214542_1022571 Ga0214542_10225711 298
362 3300021327 Ga0214543_1000038 Ga0214543_100003848 298
363 3300022739 Ga0228711_1000008 Ga0228711_10000088 298
364 3300022740 Ga0228710_1000009 Ga0228710_10000097 298
365 3300025208 Ga0209436_106541 Ga0209436_1065412 298
366 3300025254 Ga0209148_1003967 Ga0209148_10039674 298
367 3300025263 Ga0209565_1019078 Ga0209565_10190782 298
368 3300025272 Ga0209455_1003089 Ga0209455_10030893 298
369 3300025284 Ga0209130_1000034 Ga0209130_1000034140 298
370 3300025292 Ga0209676_1016115 Ga0209676_10161151 298
371 3300025294 Ga0209025_1000140 Ga0209025_100014051 298
372 3300025295 Ga0209564_1000013 Ga0209564_1000013140 298
373 3300025299 Ga0209256_1000396 Ga0209256_100039622 298
374 3300025299 Ga0209256_1001575 Ga0209256_100157519 298
375 3300025302 Ga0207426_1000006 Ga0207426_1000006513 298
376 3300025303 Ga0209051_1009570 Ga0209051_10095701 298
377 3300027111 Ga0209281_1000106 Ga0209281_1000106224 298
378 3300027111 Ga0209281_1000318 Ga0209281_10003187 298
379 3300027666 Ga0209282_1000024 Ga0209282_1000024155 298
380 3300028794 Ga0307515_10003171 Ga0307515_100031719 298
381 3300028794 Ga0307515_10024662 Ga0307515_1002466210 298
382 3300031456 Ga0307513_10070798 Ga0307513_100707983 298
383 3300031548 Ga0307408_100162566 Ga0307408_1001625662 298
384 3300031911 Ga0307412_10130624 Ga0307412_101306241 298
385 3300031967 Ga0315914_1000012 Ga0315914_10000128 298
386 3300032004 Ga0307414_10110176 Ga0307414_101101762 298
387 3300033430 Ga0315913_1000006 Ga0315913_10000068 298
388 3300033464 Ga0315915_1000010 Ga0315915_1000010257 298
389 3300041406 Ga0439439_0059105 Ga0439439_0059105_18_950 298
390 3300041413 Ga0439465_0022316 Ga0439465_0022316_666_1592 298
391 3300041505 Ga0451849_0068144 Ga0451849_0068144_1310_2218 298
392 3300042007 Ga0439449_0024568 Ga0439449_0024568_419_1360 298
393 3300042146 Ga0450907_009518 Ga0450907_009518_517_1443 298
394 3300048920 Ga0496117_0032165 Ga0496117_0032165_1578_2495 298
395 3300048923 Ga0496120_0088061 Ga0496120_0088061_412_1317 298
396 3300048925 Ga0496122_0000840 Ga0496122_0000840_44386_45291 298
397 3300048926 Ga0496123_0000336 Ga0496123_0000336_37062_37967 298
398 3300048927 Ga0496124_0003209 Ga0496124_0003209_2299_3204 298
399 3300048928 Ga0496125_0000248 Ga0496125_0000248_72705_73622 298
400 3300048928 Ga0496125_0065892 Ga0496125_0065892_753_1658 298
401 3300048929 Ga0496126_0000866 Ga0496126_0000866_37010_37915 298
402 3300049569 Ga0501032_0054453 Ga0501032_0054453_375_1280 298
403 3300049570 Ga0501033_0139981 Ga0501033_0139981_125_1030 298
404 3300049571 Ga0501034_0104725 Ga0501034_0104725_627_1532 298
405 3300049574 Ga0501038_0099208 Ga0501038_0099208_750_1655 298
406 3300049575 Ga0501039_0101795 Ga0501039_0101795_1307_2212 298
407 3300049579 Ga0501043_0076052 Ga0501043_0076052_1686_2591 298
408 3300049822 Ga0501035_0154476 Ga0501035_0154476_158_1063 298
409 3300053125 Ga0500618_006853 Ga0500618_006853_1738_2640 298
410 3300021320 Ga0214544_1003096 Ga0214544_100309628 299
411 3300021321 Ga0214542_1000012 Ga0214542_100001270 299
412 3300021327 Ga0214543_1000024 Ga0214543_100002471 299
413 3300006353 Ga0075370_10107030 Ga0075370_101070301 300
414 3300041404 Ga0439436_0005264 Ga0439436_0005264_1567_2511 300
415 3300041406 Ga0439439_0016413 Ga0439439_0016413_84_1028 300
416 3300042145 Ga0450906_003444 Ga0450906_003444_1023_1967 300
417 3300042531 Ga0450918_002667 Ga0450918_002667_425_1369 300
418 3300053093 Ga0500651_0044368 Ga0500651_0044368_890_1882 303
419 2010549000 RicEn_C10235 RicEn_177970 309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02219

MTHFR

Methylenetetrahydrofolate reductase

5

291

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zpt-assembly1.cif.gz_A escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 7.25 0.9644 12 291
2fmo-assembly1.cif.gz_B-1 ala177val mutant of e. coli methylenetetrahydrofolate reductase 0.9629 14 291
1zp3-assembly2.cif.gz_A e. coli methylenetetrahydrofolate reductase (oxidized) 0.962 12 291
6pey-assembly2.cif.gz_B mthfr with mutation asp120ala 0.9614 14 291
1zpt-assembly1.cif.gz_B escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 7.25 0.9598 12 291
ID Description Score Start End Superfamily
1zp3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9587 12 291 3.20.20.220
af_Q75HE6_1_304_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9382 13 290 3.20.20.220
1v93A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9368 10 293 3.20.20.220
af_Q9WU20_42_335_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9289 14 288 3.20.20.220
af_A0A1D6GER4_1_215_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9222 85 288 3.20.20.220
ID Description Score Start End GO Terms
AF-A0A7X6EMB3-F1-model_v4 deleted 0.9943 163 258
AF-A0A3R8NNS2-F1-model_v4 Methylenetetrahydrofolate reductase 0.9892 16 108 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A359BGI4-F1-model_v4 Methylenetetrahydrofolate reductase 0.9843 15 150 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A521T562-F1-model_v4 deleted 0.9821 11 138
AF-Q0BVP8-F1-model_v4 Methylenetetrahydrofolate reductase (EC 1.5.1.54) 0.9772 14 296 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312

Feature Viewer

pLDDT pTM Quality
87.64 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map