F439365

General Info

Members Datasets Scaffolds Average Seq Length
418 271 836 251

Family's Representative Sequence

Representative Sequence 3300046476|Ga0495662_0198269|Ga0495662_0198269_100_978
Length 284
Sequence VFAEEAGLGLAMNFRAGRGLVFWTDSRTATEAIMSDGLGTAGLPGAGAVADRAAWQARLDALLIREKAHTRAGDAIAAARRRLPMVEVDAAIPVIGGRGPVPLLEVFEGRSQLIVYFHMWHAGHPAAAQCEGCTFFNGQIRELSYLHSRDVTYATFCQGPYAESVRYRDFMDWDVPWYSAQDSADALLAGRWFGLQVCYLRHGNRVFETYWTSGRGAEAMAPSYGLLDMTVYGRQETWEDSPPGWPQPFATDGDQFRSNGRPAAQWSRLAAGRSDYLSTGQHDQ

Samples

Sample ID Description Type Environment
1 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
163 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
164 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
253 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
264 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
266 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
267 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
268 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
269 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
270 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
271 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.65
Metatranscriptomes 1.91
Isolates 1.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.66
Nodule 0
Rhizoplane 5.98
Rhizosphere 80.38
Stem 0
Stem Tuber 0.24
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495662_0198269 3300046476 Bacteria 990
2 Ga0055536_1004580 3300003781 Bacteria 7014
3 JGI25405J52794_10006060 3300003911 Bacteria 2202
4 Ga0058860_10829559 3300004801 Bacteria 908
5 Ga0070676_10051001 3300005328 Bacteria 2428
6 Ga0070683_100014924 3300005329 Bacteria 6809
7 Ga0070683_100068658 3300005329 Bacteria 3303
8 Ga0070683_100574391 3300005329 Bacteria 1078
9 Ga0070690_100282970 3300005330 Bacteria 1183
10 Ga0068869_100089598 3300005334 Bacteria 2311
11 Ga0070680_100357917 3300005336 Bacteria 1241
12 Ga0070682_100082749 3300005337 Bacteria 2081
13 Ga0068868_100133568 3300005338 Bacteria 2033
14 Ga0068868_100135639 3300005338 Bacteria 2017
15 Ga0070691_10021036 3300005341 Bacteria 3016
16 Ga0070687_100011998 3300005343 Bacteria 3810
17 Ga0070661_100063079 3300005344 Bacteria 2721
18 Ga0070671_100090881 3300005355 Bacteria 2556
19 Ga0070688_100062475 3300005365 Bacteria 2358
20 Ga0070667_100123027 3300005367 Bacteria 2259
21 Ga0070709_10111740 3300005434 Bacteria 1837
22 Ga0070709_10120631 3300005434 Bacteria 1777
23 Ga0070714_100007785 3300005435 Bacteria 8345
24 Ga0070714_100076605 3300005435 Bacteria 2904
25 Ga0070714_100331406 3300005435 Bacteria 1425
26 Ga0070713_100041723 3300005436 Bacteria 3741
27 Ga0070713_100124186 3300005436 Bacteria 2268
28 Ga0070713_100206052 3300005436 Bacteria 1778
29 Ga0070713_100430330 3300005436 Bacteria 1236
30 Ga0070713_100470867 3300005436 Bacteria 1182
31 Ga0070710_10013826 3300005437 Bacteria 4051
32 Ga0070710_10316989 3300005437 Bacteria 1022
33 Ga0070711_100047162 3300005439 Bacteria 2940
34 Ga0070711_100070560 3300005439 Bacteria 2460
35 Ga0070705_100098560 3300005440 Bacteria 1840
36 Ga0070694_100369662 3300005444 Bacteria 1116
37 Ga0070678_100018079 3300005456 Bacteria 4560
38 Ga0070681_10082585 3300005458 Bacteria 3168
39 Ga0070706_100133182 3300005467 Bacteria 2320
40 Ga0070707_100180570 3300005468 Bacteria 2057
41 Ga0070707_100253871 3300005468 Bacteria 1711
42 Ga0070707_100276631 3300005468 Bacteria 1632
43 Ga0070698_100098167 3300005471 Bacteria 2903
44 Ga0070684_100018188 3300005535 Bacteria 5784
45 Ga0070684_100056820 3300005535 Bacteria 3416
46 Ga0070684_100107500 3300005535 Bacteria 2499
47 Ga0070684_100112933 3300005535 Bacteria 2437
48 Ga0070697_100704111 3300005536 Bacteria 891
49 Ga0068853_100135046 3300005539 Bacteria 2211
50 Ga0068853_100414647 3300005539 Bacteria 1262
51 Ga0070672_100111878 3300005543 Bacteria 2226
52 Ga0070672_100520710 3300005543 Bacteria 1030
53 Ga0070686_100027464 3300005544 Bacteria 3445
54 Ga0070695_100398766 3300005545 Bacteria 1042
55 Ga0070696_100165928 3300005546 Bacteria 1629
56 Ga0070665_100139399 3300005548 Bacteria 2429
57 Ga0070665_100147733 3300005548 Bacteria 2353
58 Ga0068855_100244871 3300005563 Bacteria 2002
59 Ga0068855_100659199 3300005563 Bacteria 1123
60 Ga0070664_100135451 3300005564 Bacteria 2165
61 Ga0068856_100027552 3300005614 Bacteria 5542
62 Ga0068856_100113446 3300005614 Bacteria 2708
63 Ga0070702_100035246 3300005615 Bacteria 2764
64 Ga0068864_100177677 3300005618 Bacteria 1944
65 Ga0068861_100267275 3300005719 Bacteria 1467
66 Ga0068861_100578309 3300005719 Bacteria 1028
67 Ga0068863_100405788 3300005841 Bacteria 1333
68 Ga0068858_100062885 3300005842 Bacteria 3433
69 Ga0068858_100145563 3300005842 Bacteria 2225
70 Ga0068858_100194713 3300005842 Bacteria 1915
71 Ga0068860_100243749 3300005843 Bacteria 1748
72 Ga0068860_100271883 3300005843 Bacteria 1654
73 Ga0068862_100630581 3300005844 Bacteria 1032
74 Ga0081455_10002276 3300005937 Bacteria 22904
75 Ga0081538_10024026 3300005981 Bacteria 4356
76 Ga0081539_10004644 3300005985 Bacteria 14953
77 Ga0070717_10185269 3300006028 Bacteria 1816
78 Ga0070717_10330634 3300006028 Bacteria 1359
79 Ga0070717_10331777 3300006028 Bacteria 1357
80 Ga0070717_10383303 3300006028 Unclassified 1261
81 Ga0070717_10442692 3300006028 Bacteria 1170
82 Ga0075365_10010245 3300006038 Bacteria 5448
83 Ga0075365_10021159 3300006038 Bacteria 4052
84 Ga0075363_100008742 3300006048 Bacteria 4731
85 Ga0075364_10022482 3300006051 Bacteria 3982
86 Ga0075364_10092772 3300006051 Bacteria 2004
87 Ga0075364_10348106 3300006051 Bacteria 1010
88 Ga0070715_10016027 3300006163 Bacteria 2807
89 Ga0070715_10030668 3300006163 Bacteria 2176
90 Ga0070716_100009210 3300006173 Bacteria 4917
91 Ga0070716_100138233 3300006173 Bacteria 1550
92 Ga0070712_100007122 3300006175 Bacteria 6977
93 Ga0075362_10012895 3300006177 Bacteria 3332
94 Ga0075367_10014003 3300006178 Bacteria 4331
95 Ga0075367_10067451 3300006178 Bacteria 2145
96 Ga0075369_10006026 3300006186 Bacteria 4566
97 Ga0075369_10014327 3300006186 Bacteria 3166
98 Ga0075369_10049023 3300006186 Bacteria 1824
99 Ga0075369_10198909 3300006186 Bacteria 924
100 Ga0075366_10049154 3300006195 Bacteria 2503
101 Ga0097621_100394873 3300006237 Bacteria 1237
102 Ga0075370_10001529 3300006353 Bacteria 10120
103 Ga0075370_10098147 3300006353 Bacteria 1694
104 Ga0068871_100535958 3300006358 Bacteria 1059
105 Ga0075428_100000373 3300006844 Bacteria 44416
106 Ga0075428_100059100 3300006844 Bacteria 4199
107 Ga0075430_100115995 3300006846 Bacteria 2231
108 Ga0075431_100005251 3300006847 Bacteria 12756
109 Ga0075431_100190942 3300006847 Bacteria 2098
110 Ga0075431_100398925 3300006847 Bacteria 1377
111 Ga0075429_100002265 3300006880 Bacteria 16132
112 Ga0075429_100176323 3300006880 Bacteria 1873
113 Ga0075435_100114149 3300007076 Bacteria 2249
114 Ga0105251_10035437 3300009011 Bacteria 2462
115 Ga0105240_10142056 3300009093 Bacteria 2869
116 Ga0111539_10020931 3300009094 Bacteria 8054
117 Ga0105245_10007019 3300009098 Bacteria 9882
118 Ga0105245_10074881 3300009098 Bacteria 3081
119 Ga0105245_10302132 3300009098 Bacteria 1571
120 Ga0114129_10024855 3300009147 Bacteria 8493
121 Ga0114129_10226201 3300009147 Bacteria 2521
122 Ga0114129_10614439 3300009147 Bacteria 1407
123 Ga0105243_10023266 3300009148 Bacteria 4715
124 Ga0105243_10190273 3300009148 Bacteria 1792
125 Ga0105242_10116810 3300009176 Bacteria 2283
126 Ga0105242_10398200 3300009176 Bacteria 1284
127 Ga0105248_10065925 3300009177 Bacteria 4066
128 Ga0105248_10259745 3300009177 Bacteria 1955
129 Ga0105237_10165209 3300009545 Bacteria 2212
130 Ga0105237_10441371 3300009545 Bacteria 1307
131 Ga0105238_10167461 3300009551 Bacteria 2173
132 Ga0105238_10505621 3300009551 Bacteria 1210
133 Ga0105239_10494188 3300010375 Bacteria 1391
134 Ga0105246_10268315 3300011119 Bacteria 1363
135 Ga0157370_10299601 3300013104 Bacteria 1484
136 Ga0157374_10176983 3300013296 Bacteria 2082
137 Ga0157378_10551699 3300013297 Bacteria 1158
138 Ga0163162_10393549 3300013306 Bacteria 1518
139 Ga0163162_10489540 3300013306 Bacteria 1361
140 Ga0157375_10125512 3300013308 Bacteria 2681
141 Ga0163163_10202421 3300014325 Bacteria 2034
142 Ga0157377_10025984 3300014745 Bacteria 3128
143 Ga0157379_10175850 3300014968 Bacteria 1933
144 Ga0157379_10403312 3300014968 Bacteria 1257
145 Ga0157379_10456709 3300014968 Bacteria 1180
146 Ga0157376_10016592 3300014969 Bacteria 5596
147 Ga0197907_10437188 3300020069 Bacteria 1016
148 Ga0197907_10445965 3300020069 Bacteria 916
149 Ga0206351_10946436 3300020077 Bacteria 892
150 Ga0206350_11407092 3300020080 Bacteria 858
151 Ga0213876_10036762 3300021384 Bacteria 2583
152 Ga0213875_10146846 3300021388 Bacteria 1105
153 Ga0224712_10069772 3300022467 Bacteria 1424
154 Ga0224712_10196315 3300022467 Bacteria 916
155 Ga0224572_1001367 3300024225 Bacteria 3573
156 Ga0224572_1003143 3300024225 Bacteria 2763
157 Ga0207692_10008731 3300025898 Bacteria 4207
158 Ga0207688_10038682 3300025901 Bacteria 2648
159 Ga0207699_10000761 3300025906 Bacteria 15434
160 Ga0207699_10129401 3300025906 Bacteria 1644
161 Ga0207699_10443392 3300025906 Bacteria 930
162 Ga0207645_10265612 3300025907 Bacteria 1137
163 Ga0207684_10062537 3300025910 Bacteria 3161
164 Ga0207654_10230113 3300025911 Bacteria 1234
165 Ga0207654_10403622 3300025911 Bacteria 951
166 Ga0207707_10258975 3300025912 Bacteria 1510
167 Ga0207707_10380851 3300025912 Bacteria 1213
168 Ga0207695_10722133 3300025913 Bacteria 877
169 Ga0207671_10099366 3300025914 Bacteria 2202
170 Ga0207693_10010684 3300025915 Bacteria 7452
171 Ga0207693_10092962 3300025915 Bacteria 2364
172 Ga0207693_10238756 3300025915 Bacteria 1427
173 Ga0207663_10003111 3300025916 Bacteria 8050
174 Ga0207663_10040039 3300025916 Bacteria 2845
175 Ga0207662_10016014 3300025918 Bacteria 4226
176 Ga0207657_10005390 3300025919 Bacteria 13373
177 Ga0207649_10122653 3300025920 Bacteria 1754
178 Ga0207646_10048706 3300025922 Bacteria 3798
179 Ga0207646_10329151 3300025922 Bacteria 1380
180 Ga0207687_10010301 3300025927 Bacteria 6108
181 Ga0207687_10198932 3300025927 Bacteria 1565
182 Ga0207700_10059443 3300025928 Bacteria 2891
183 Ga0207700_10159812 3300025928 Bacteria 1870
184 Ga0207700_10177400 3300025928 Bacteria 1781
185 Ga0207700_10339752 3300025928 Bacteria 1305
186 Ga0207700_10431932 3300025928 Bacteria 1158
187 Ga0207700_10629225 3300025928 Bacteria 956
188 Ga0207664_10001977 3300025929 Bacteria 13492
189 Ga0207664_10029419 3300025929 Bacteria 4183
190 Ga0207664_10060725 3300025929 Bacteria 3014
191 Ga0207664_10195554 3300025929 Bacteria 1743
192 Ga0207686_10057439 3300025934 Bacteria 2450
193 Ga0207709_10307141 3300025935 Bacteria 1182
194 Ga0207665_10003552 3300025939 Bacteria 10416
195 Ga0207665_10014174 3300025939 Bacteria 5244
196 Ga0207665_10194796 3300025939 Bacteria 1474
197 Ga0207665_10220534 3300025939 Bacteria 1390
198 Ga0207691_10191017 3300025940 Bacteria 1786
199 Ga0207711_10045664 3300025941 Bacteria 3744
200 Ga0207711_10195934 3300025941 Bacteria 1842
201 Ga0207689_10024046 3300025942 Bacteria 5110
202 Ga0207661_10041949 3300025944 Bacteria 3605
203 Ga0207661_10185319 3300025944 Bacteria 1821
204 Ga0207679_10397099 3300025945 Bacteria 1212
205 Ga0207667_10584340 3300025949 Bacteria 1127
206 Ga0207677_10062541 3300026023 Bacteria 2582
207 Ga0207677_10275603 3300026023 Bacteria 1378
208 Ga0207677_10289164 3300026023 Bacteria 1349
209 Ga0207703_10648445 3300026035 Bacteria 1001
210 Ga0207702_10103835 3300026078 Bacteria 2514
211 Ga0207702_10273151 3300026078 Bacteria 1595
212 Ga0207641_10349530 3300026088 Bacteria 1409
213 Ga0207676_10061517 3300026095 Bacteria 2973
214 Ga0207676_10350841 3300026095 Bacteria 1364
215 Ga0207674_10005055 3300026116 Bacteria 15745
216 Ga0207674_10080982 3300026116 Bacteria 3249
217 Ga0207675_100118496 3300026118 Bacteria 2503
218 Ga0207683_10005287 3300026121 Bacteria 11078
219 Ga0207698_10879606 3300026142 Bacteria 902
220 Ga0207428_10009934 3300027907 Bacteria 8524
221 Ga0268266_10179316 3300028379 Bacteria 1928
222 Ga0268265_10354002 3300028380 Bacteria 1342
223 Ga0307517_10059592 3300028786 Bacteria 3652
224 Ga0265338_10005823 3300028800 Bacteria 15903
225 Ga0265338_10017768 3300028800 Bacteria 7647
226 Ga0265338_10264503 3300028800 Bacteria 1263
227 Ga0265770_1039966 3300030878 Bacteria 817
228 Ga0265320_10036068 3300031240 Bacteria 2502
229 Ga0307513_10036583 3300031456 Bacteria 5473
230 Ga0307513_10161708 3300031456 Bacteria 2131
231 Ga0307410_10121407 3300031852 Bacteria 1906
232 Ga0307406_10035014 3300031901 Bacteria 3085
233 Ga0307406_10090921 3300031901 Bacteria 2055
234 Ga0307407_10399860 3300031903 Bacteria 985
235 Ga0307412_10037497 3300031911 Bacteria 3115
236 Ga0307409_100165579 3300031995 Bacteria 1939
237 Ga0307409_100414559 3300031995 Bacteria 1290
238 Ga0373923_0073807 3300035111 Bacteria 1469
239 Ga0373936_0006672 3300035113 Bacteria 4346
240 Ga0373957_0031217 3300035120 Bacteria 1956
241 Ga0373946_0212093 3300035171 Bacteria 932
242 Ga0373955_0036060 3300035172 Bacteria 2622
243 Ga0373924_0011598 3300035410 Bacteria 3276
244 Ga0373935_0004918 3300035692 Bacteria 7852
245 Ga0373933_0046161 3300035724 Bacteria 2585
246 Ga0373933_0070582 3300035724 Bacteria 2125
247 Ga0373937_0037834 3300036401 Bacteria 4397
248 Ga0373937_0079670 3300036401 Bacteria 3027
249 Ga0373937_0401067 3300036401 Bacteria 1301
250 Ga0373925_0055500 3300037068 Bacteria 2966
251 Ga0373925_0124023 3300037068 Bacteria 2008
252 Ga0395900_0057812 3300037418 Bacteria 3993
253 Ga0436364_0048914 3300037853 Bacteria 1961
254 Ga0436364_0680757 3300037853 Bacteria 1090
255 Ga0436364_1222829 3300037853 Bacteria 4073
256 Ga0436364_1464512 3300037853 Bacteria 3600
257 Ga0395901_0028339 3300038443 Bacteria 5759
258 Ga0395901_0625727 3300038443 Bacteria 1083
259 Ga0436365_0997577 3300039437 Bacteria 19986
260 Ga0436365_1757023 3300039437 Bacteria 1803
261 Ga0436363_0460693 3300039450 Bacteria 976
262 Ga0439466_0013353 3300041411 Bacteria 3008
263 Ga0439465_0002504 3300041413 Bacteria 5996
264 Ga0451843_1428166 3300041509 Bacteria 2266
265 Ga0451853_3094198 3300041512 Bacteria 989
266 Ga0439445_0004539 3300042004 Bacteria 3144
267 Ga0466969_0079452 3300044656 Bacteria 1567
268 Ga0466961_0050392 3300044693 Bacteria 2659
269 Ga0466963_0003258 3300044694 Bacteria 9256
270 Ga0466957_0047596 3300044842 Bacteria 2606
271 Ga0466959_0001074 3300045049 Bacteria 16346
272 Ga0466958_0011708 3300045836 Bacteria 4948
273 Ga0466958_0111532 3300045836 Bacteria 1708
274 Ga0466958_0144356 3300045836 Bacteria 1499
275 Ga0466967_0308760 3300045976 Bacteria 1523
276 Ga0495592_0238858 3300046454 Bacteria 1206
277 Ga0495603_0067068 3300046455 Bacteria 2113
278 Ga0495629_0003928 3300046459 Bacteria 11178
279 Ga0495638_0014310 3300046460 Bacteria 5369
280 Ga0495641_0014137 3300046461 Bacteria 4334
281 Ga0495641_0062858 3300046461 Bacteria 1674
282 Ga0495651_0003641 3300046462 Bacteria 11801
283 Ga0495651_0033393 3300046462 Bacteria 4013
284 Ga0495651_0214252 3300046462 Bacteria 1338
285 Ga0495653_0007677 3300046463 Bacteria 8828
286 Ga0495653_0032474 3300046463 Bacteria 4143
287 Ga0495580_0097140 3300046472 Bacteria 2049
288 Ga0495639_0123783 3300046475 Bacteria 1234
289 Ga0495662_0064032 3300046476 Bacteria 1777
290 Ga0495664_0056612 3300046477 Bacteria 2332
291 Ga0495664_0098070 3300046477 Bacteria 1764
292 Ga0495608_0019525 3300046511 Bacteria 4663
293 Ga0495618_0146614 3300046514 Bacteria 1508
294 Ga0495628_0016789 3300046516 Bacteria 6099
295 Ga0495628_0054631 3300046516 Bacteria 3147
296 Ga0495628_0150446 3300046516 Bacteria 1773
297 Ga0495630_0178195 3300046517 Bacteria 1620
298 Ga0495652_0020980 3300046529 Bacteria 5806
299 Ga0495652_0049821 3300046529 Bacteria 3583
300 Ga0495665_0011689 3300046531 Bacteria 4756
301 Ga0495640_0008226 3300046533 Bacteria 8186
302 Ga0495640_0019266 3300046533 Bacteria 5039
303 Ga0495586_0011782 3300046535 Bacteria 4648
304 Ga0495587_0001347 3300046536 Bacteria 16314
305 Ga0495587_0012274 3300046536 Bacteria 5402
306 Ga0495645_0074964 3300046543 Bacteria 2435
307 Ga0495645_0106747 3300046543 Bacteria 1985
308 Ga0495667_0074351 3300046559 Bacteria 2212
309 Ga0495668_0000079 3300046616 Bacteria 157703
310 Ga0495634_0090165 3300046642 Bacteria 1992
311 Ga0495635_0026141 3300046663 Bacteria 4064
312 Ga0495635_0081679 3300046663 Bacteria 2211
313 Ga0495588_0164171 3300046674 Bacteria 1174
314 Ga0495657_0042627 3300046675 Bacteria 3097
315 Ga0495599_0002162 3300046678 Bacteria 11421
316 Ga0495599_0184220 3300046678 Bacteria 1286
317 Ga0495623_0058223 3300046679 Bacteria 2429
318 Ga0495623_0096511 3300046679 Bacteria 1806
319 Ga0495646_0030647 3300046680 Bacteria 3357
320 Ga0495646_0234207 3300046680 Bacteria 989
321 Ga0495658_0375575 3300046683 Bacteria 905
322 Ga0495658_0406369 3300046683 Bacteria 868
323 Ga0495613_0234157 3300046689 Bacteria 1286
324 Ga0495624_0010697 3300046690 Bacteria 6319
325 Ga0495600_0000353 3300046809 Bacteria 24355
326 Ga0495600_0085927 3300046809 Bacteria 2052
327 Ga0495581_0034297 3300047315 Bacteria 2936
328 Ga0495604_0008959 3300047317 Bacteria 7911
329 Ga0495604_0115032 3300047317 Bacteria 1955
330 Ga0495674_0009070 3300047319 Bacteria 9448
331 Ga0495674_0010136 3300047319 Bacteria 8928
332 Ga0495680_0037656 3300047322 Bacteria 3873
333 Ga0495675_0001599 3300047444 Bacteria 13614
334 Ga0495675_0024863 3300047444 Bacteria 3820
335 Ga0495684_0010312 3300047471 Bacteria 7227
336 Ga0495684_0068854 3300047471 Bacteria 2690
337 Ga0495593_0006787 3300047673 Bacteria 6702
338 Ga0495602_0053896 3300048088 Bacteria 3557
339 Ga0496101_0000595 3300048904 Bacteria 22001
340 Ga0496101_0427451 3300048904 Bacteria 1044
341 Ga0496102_0000001 3300048905 Bacteria 873433
342 Ga0496102_0261535 3300048905 Bacteria 1631
343 Ga0496102_0269522 3300048905 Bacteria 1605
344 Ga0496102_0299696 3300048905 Bacteria 1515
345 Ga0496102_0345666 3300048905 Bacteria 1401
346 Ga0496103_0000007 3300048906 Bacteria 354915
347 Ga0496103_0165443 3300048906 Bacteria 1419
348 Ga0496104_0018743 3300048907 Bacteria 6319
349 Ga0496104_0218461 3300048907 Bacteria 1818
350 Ga0496105_0035884 3300048908 Bacteria 4083
351 Ga0496106_0013103 3300048909 Bacteria 6119
352 Ga0496106_0068460 3300048909 Bacteria 2707
353 Ga0496107_0256182 3300048910 Bacteria 1302
354 Ga0496108_0028218 3300048911 Bacteria 4643
355 Ga0496109_0061948 3300048912 Bacteria 3421
356 Ga0496110_0087084 3300048913 Bacteria 2789
357 Ga0496110_0552391 3300048913 Bacteria 1046
358 Ga0496111_0153152 3300048914 Bacteria 1710
359 Ga0496112_0444774 3300048915 Bacteria 1234
360 Ga0496113_0076652 3300048916 Bacteria 2554
361 Ga0496114_0217950 3300048917 Bacteria 1675
362 Ga0496114_0330721 3300048917 Bacteria 1347
363 Ga0496115_0004129 3300048918 Bacteria 10481
364 Ga0496116_0000823 3300048919 Bacteria 39132
365 Ga0496117_0000015 3300048920 Bacteria 583316
366 Ga0496118_0000012 3300048921 Bacteria 583316
367 Ga0496119_0022237 3300048922 Bacteria 4550
368 Ga0496121_0004356 3300048924 Bacteria 19131
369 Ga0496126_0000902 3300048929 Bacteria 51705
370 Ga0501034_0161027 3300049571 Bacteria 2215
371 Ga0501034_0550478 3300049571 Bacteria 1063
372 Ga0501036_0250533 3300049572 Bacteria 1484
373 Ga0501037_0030708 3300049573 Bacteria 3970
374 Ga0501042_0038440 3300049578 Bacteria 3399
375 Ga0501043_0275917 3300049579 Bacteria 1290
376 Ga0501067_0000108 3300049583 Bacteria 46789
377 Ga0501068_0000024 3300049584 Bacteria 56906
378 Ga0501069_0000240 3300049585 Bacteria 24588
379 Ga0501071_0278658 3300049587 Bacteria 1265
380 Ga0501080_1105812 3300049742 Bacteria 684
381 Ga0501044_0003621 3300049823 Bacteria 17381
382 nmdc:mga03683_20730_c1 3300050489 Bacteria 2526
383 nmdc:mga03683_40734_c1 3300050489 Bacteria 1906
384 nmdc:mga03n38_1886_c1 3300050490 Bacteria 6271
385 nmdc:mga03n38_29558_c1 3300050490 Bacteria 2295
386 nmdc:mga00v17_116332_c1 3300050491 Bacteria 1700
387 nmdc:mga00v17_143360_c1 3300050491 Bacteria 1533
388 nmdc:mga0yw44_558120_c1 3300050492 Bacteria 778
389 nmdc:mga06z11_107673_c1 3300050494 Bacteria 1539
390 nmdc:mga06z11_48483_c1 3300050494 Bacteria 2162
391 nmdc:mga04h51_107987_c1 3300050495 Bacteria 1022
392 nmdc:mga07m45_96119_c1 3300050496 Bacteria 1700
393 nmdc:mga05p37_22353_c1 3300050507 Bacteria 7672
394 nmdc:mga05p37_3068_c1 3300050507 Bacteria 19404
395 nmdc:mga05p37_576557_c1 3300050507 Bacteria 1275
396 nmdc:mga09592_377448_c1 3300050508 Bacteria 1226
397 nmdc:mga09592_483_c1 3300050508 Bacteria 29797
398 nmdc:mga06r32_434_c1 3300050510 Bacteria 35341
399 nmdc:mga08y16_18315_c1 3300050511 Bacteria 7378
400 nmdc:mga08y16_2764_c1 3300050511 Bacteria 17986
401 nmdc:mga0sz30_21330_c1 3300050516 Bacteria 2621
402 nmdc:mga0sz30_70672_c1 3300050516 Bacteria 1502
403 Ga0495601_0020207 3300053077 Bacteria 4066
404 Ga0495601_0037009 3300053077 Bacteria 3050
405 Ga0495612_0006449 3300053078 Bacteria 4822
406 Ga0495595_0016148 3300053084 Bacteria 3189
407 Ga0495619_0002196 3300053085 Bacteria 12932
408 Ga0495619_0012435 3300053085 Bacteria 5360
409 Ga0495619_0255372 3300053085 Bacteria 1214
410 Ga0500641_0032656 3300053096 Bacteria 2061
411 Ga0500568_0000764 3300053139 Bacteria 22849
412 Ga0530510_0001392 3300061734 Bacteria 16223
413 2558906288 2558860112 Bacteria 9931328
414 2643832789 2643221563 Bacteria 4726935
415 2644053416 2643221608 Bacteria 4724829
416 2899375857 2899370129 Bacteria 6781179
417 2939583752 2939582691 Bacteria 7088898
418 8056212778 8056207758 Bacteria 8639239
419 Ga0495662_0198269
420 Ga0055536_1004580
421 JGI25405J52794_10006060
422 Ga0058860_10829559
423 Ga0070676_10051001
424 Ga0070683_100014924
425 Ga0070683_100068658
426 Ga0070683_100574391
427 Ga0070690_100282970
428 Ga0068869_100089598
429 Ga0070680_100357917
430 Ga0070682_100082749
431 Ga0068868_100133568
432 Ga0068868_100135639
433 Ga0070691_10021036
434 Ga0070687_100011998
435 Ga0070661_100063079
436 Ga0070671_100090881
437 Ga0070688_100062475
438 Ga0070667_100123027
439 Ga0070709_10111740
440 Ga0070709_10120631
441 Ga0070714_100007785
442 Ga0070714_100076605
443 Ga0070714_100331406
444 Ga0070713_100041723
445 Ga0070713_100124186
446 Ga0070713_100206052
447 Ga0070713_100430330
448 Ga0070713_100470867
449 Ga0070710_10013826
450 Ga0070710_10316989
451 Ga0070711_100047162
452 Ga0070711_100070560
453 Ga0070705_100098560
454 Ga0070694_100369662
455 Ga0070678_100018079
456 Ga0070681_10082585
457 Ga0070706_100133182
458 Ga0070707_100180570
459 Ga0070707_100253871
460 Ga0070707_100276631
461 Ga0070698_100098167
462 Ga0070684_100018188
463 Ga0070684_100056820
464 Ga0070684_100107500
465 Ga0070684_100112933
466 Ga0070697_100704111
467 Ga0068853_100135046
468 Ga0068853_100414647
469 Ga0070672_100111878
470 Ga0070672_100520710
471 Ga0070686_100027464
472 Ga0070695_100398766
473 Ga0070696_100165928
474 Ga0070665_100139399
475 Ga0070665_100147733
476 Ga0068855_100244871
477 Ga0068855_100659199
478 Ga0070664_100135451
479 Ga0068856_100027552
480 Ga0068856_100113446
481 Ga0070702_100035246
482 Ga0068864_100177677
483 Ga0068861_100267275
484 Ga0068861_100578309
485 Ga0068863_100405788
486 Ga0068858_100062885
487 Ga0068858_100145563
488 Ga0068858_100194713
489 Ga0068860_100243749
490 Ga0068860_100271883
491 Ga0068862_100630581
492 Ga0081455_10002276
493 Ga0081538_10024026
494 Ga0081539_10004644
495 Ga0070717_10185269
496 Ga0070717_10330634
497 Ga0070717_10331777
498 Ga0070717_10383303
499 Ga0070717_10442692
500 Ga0075365_10010245
501 Ga0075365_10021159
502 Ga0075363_100008742
503 Ga0075364_10022482
504 Ga0075364_10092772
505 Ga0075364_10348106
506 Ga0070715_10016027
507 Ga0070715_10030668
508 Ga0070716_100009210
509 Ga0070716_100138233
510 Ga0070712_100007122
511 Ga0075362_10012895
512 Ga0075367_10014003
513 Ga0075367_10067451
514 Ga0075369_10006026
515 Ga0075369_10014327
516 Ga0075369_10049023
517 Ga0075369_10198909
518 Ga0075366_10049154
519 Ga0097621_100394873
520 Ga0075370_10001529
521 Ga0075370_10098147
522 Ga0068871_100535958
523 Ga0075428_100000373
524 Ga0075428_100059100
525 Ga0075430_100115995
526 Ga0075431_100005251
527 Ga0075431_100190942
528 Ga0075431_100398925
529 Ga0075429_100002265
530 Ga0075429_100176323
531 Ga0075435_100114149
532 Ga0105251_10035437
533 Ga0105240_10142056
534 Ga0111539_10020931
535 Ga0105245_10007019
536 Ga0105245_10074881
537 Ga0105245_10302132
538 Ga0114129_10024855
539 Ga0114129_10226201
540 Ga0114129_10614439
541 Ga0105243_10023266
542 Ga0105243_10190273
543 Ga0105242_10116810
544 Ga0105242_10398200
545 Ga0105248_10065925
546 Ga0105248_10259745
547 Ga0105237_10165209
548 Ga0105237_10441371
549 Ga0105238_10167461
550 Ga0105238_10505621
551 Ga0105239_10494188
552 Ga0105246_10268315
553 Ga0157370_10299601
554 Ga0157374_10176983
555 Ga0157378_10551699
556 Ga0163162_10393549
557 Ga0163162_10489540
558 Ga0157375_10125512
559 Ga0163163_10202421
560 Ga0157377_10025984
561 Ga0157379_10175850
562 Ga0157379_10403312
563 Ga0157379_10456709
564 Ga0157376_10016592
565 Ga0197907_10437188
566 Ga0197907_10445965
567 Ga0206351_10946436
568 Ga0206350_11407092
569 Ga0213876_10036762
570 Ga0213875_10146846
571 Ga0224712_10069772
572 Ga0224712_10196315
573 Ga0224572_1001367
574 Ga0224572_1003143
575 Ga0207692_10008731
576 Ga0207688_10038682
577 Ga0207699_10000761
578 Ga0207699_10129401
579 Ga0207699_10443392
580 Ga0207645_10265612
581 Ga0207684_10062537
582 Ga0207654_10230113
583 Ga0207654_10403622
584 Ga0207707_10258975
585 Ga0207707_10380851
586 Ga0207695_10722133
587 Ga0207671_10099366
588 Ga0207693_10010684
589 Ga0207693_10092962
590 Ga0207693_10238756
591 Ga0207663_10003111
592 Ga0207663_10040039
593 Ga0207662_10016014
594 Ga0207657_10005390
595 Ga0207649_10122653
596 Ga0207646_10048706
597 Ga0207646_10329151
598 Ga0207687_10010301
599 Ga0207687_10198932
600 Ga0207700_10059443
601 Ga0207700_10159812
602 Ga0207700_10177400
603 Ga0207700_10339752
604 Ga0207700_10431932
605 Ga0207700_10629225
606 Ga0207664_10001977
607 Ga0207664_10029419
608 Ga0207664_10060725
609 Ga0207664_10195554
610 Ga0207686_10057439
611 Ga0207709_10307141
612 Ga0207665_10003552
613 Ga0207665_10014174
614 Ga0207665_10194796
615 Ga0207665_10220534
616 Ga0207691_10191017
617 Ga0207711_10045664
618 Ga0207711_10195934
619 Ga0207689_10024046
620 Ga0207661_10041949
621 Ga0207661_10185319
622 Ga0207679_10397099
623 Ga0207667_10584340
624 Ga0207677_10062541
625 Ga0207677_10275603
626 Ga0207677_10289164
627 Ga0207703_10648445
628 Ga0207702_10103835
629 Ga0207702_10273151
630 Ga0207641_10349530
631 Ga0207676_10061517
632 Ga0207676_10350841
633 Ga0207674_10005055
634 Ga0207674_10080982
635 Ga0207675_100118496
636 Ga0207683_10005287
637 Ga0207698_10879606
638 Ga0207428_10009934
639 Ga0268266_10179316
640 Ga0268265_10354002
641 Ga0307517_10059592
642 Ga0265338_10005823
643 Ga0265338_10017768
644 Ga0265338_10264503
645 Ga0265770_1039966
646 Ga0265320_10036068
647 Ga0307513_10036583
648 Ga0307513_10161708
649 Ga0307410_10121407
650 Ga0307406_10035014
651 Ga0307406_10090921
652 Ga0307407_10399860
653 Ga0307412_10037497
654 Ga0307409_100165579
655 Ga0307409_100414559
656 Ga0373923_0073807
657 Ga0373936_0006672
658 Ga0373957_0031217
659 Ga0373946_0212093
660 Ga0373955_0036060
661 Ga0373924_0011598
662 Ga0373935_0004918
663 Ga0373933_0046161
664 Ga0373933_0070582
665 Ga0373937_0037834
666 Ga0373937_0079670
667 Ga0373937_0401067
668 Ga0373925_0055500
669 Ga0373925_0124023
670 Ga0395900_0057812
671 Ga0436364_0048914
672 Ga0436364_0680757
673 Ga0436364_1222829
674 Ga0436364_1464512
675 Ga0395901_0028339
676 Ga0395901_0625727
677 Ga0436365_0997577
678 Ga0436365_1757023
679 Ga0436363_0460693
680 Ga0439466_0013353
681 Ga0439465_0002504
682 Ga0451843_1428166
683 Ga0451853_3094198
684 Ga0439445_0004539
685 Ga0466969_0079452
686 Ga0466961_0050392
687 Ga0466963_0003258
688 Ga0466957_0047596
689 Ga0466959_0001074
690 Ga0466958_0011708
691 Ga0466958_0111532
692 Ga0466958_0144356
693 Ga0466967_0308760
694 Ga0495592_0238858
695 Ga0495603_0067068
696 Ga0495629_0003928
697 Ga0495638_0014310
698 Ga0495641_0014137
699 Ga0495641_0062858
700 Ga0495651_0003641
701 Ga0495651_0033393
702 Ga0495651_0214252
703 Ga0495653_0007677
704 Ga0495653_0032474
705 Ga0495580_0097140
706 Ga0495639_0123783
707 Ga0495662_0064032
708 Ga0495664_0056612
709 Ga0495664_0098070
710 Ga0495608_0019525
711 Ga0495618_0146614
712 Ga0495628_0016789
713 Ga0495628_0054631
714 Ga0495628_0150446
715 Ga0495630_0178195
716 Ga0495652_0020980
717 Ga0495652_0049821
718 Ga0495665_0011689
719 Ga0495640_0008226
720 Ga0495640_0019266
721 Ga0495586_0011782
722 Ga0495587_0001347
723 Ga0495587_0012274
724 Ga0495645_0074964
725 Ga0495645_0106747
726 Ga0495667_0074351
727 Ga0495668_0000079
728 Ga0495634_0090165
729 Ga0495635_0026141
730 Ga0495635_0081679
731 Ga0495588_0164171
732 Ga0495657_0042627
733 Ga0495599_0002162
734 Ga0495599_0184220
735 Ga0495623_0058223
736 Ga0495623_0096511
737 Ga0495646_0030647
738 Ga0495646_0234207
739 Ga0495658_0375575
740 Ga0495658_0406369
741 Ga0495613_0234157
742 Ga0495624_0010697
743 Ga0495600_0000353
744 Ga0495600_0085927
745 Ga0495581_0034297
746 Ga0495604_0008959
747 Ga0495604_0115032
748 Ga0495674_0009070
749 Ga0495674_0010136
750 Ga0495680_0037656
751 Ga0495675_0001599
752 Ga0495675_0024863
753 Ga0495684_0010312
754 Ga0495684_0068854
755 Ga0495593_0006787
756 Ga0495602_0053896
757 Ga0496101_0000595
758 Ga0496101_0427451
759 Ga0496102_0000001
760 Ga0496102_0261535
761 Ga0496102_0269522
762 Ga0496102_0299696
763 Ga0496102_0345666
764 Ga0496103_0000007
765 Ga0496103_0165443
766 Ga0496104_0018743
767 Ga0496104_0218461
768 Ga0496105_0035884
769 Ga0496106_0013103
770 Ga0496106_0068460
771 Ga0496107_0256182
772 Ga0496108_0028218
773 Ga0496109_0061948
774 Ga0496110_0087084
775 Ga0496110_0552391
776 Ga0496111_0153152
777 Ga0496112_0444774
778 Ga0496113_0076652
779 Ga0496114_0217950
780 Ga0496114_0330721
781 Ga0496115_0004129
782 Ga0496116_0000823
783 Ga0496117_0000015
784 Ga0496118_0000012
785 Ga0496119_0022237
786 Ga0496121_0004356
787 Ga0496126_0000902
788 Ga0501034_0161027
789 Ga0501034_0550478
790 Ga0501036_0250533
791 Ga0501037_0030708
792 Ga0501042_0038440
793 Ga0501043_0275917
794 Ga0501067_0000108
795 Ga0501068_0000024
796 Ga0501069_0000240
797 Ga0501071_0278658
798 Ga0501080_1105812
799 Ga0501044_0003621
800 nmdc:mga03683_20730_c1
801 nmdc:mga03683_40734_c1
802 nmdc:mga03n38_1886_c1
803 nmdc:mga03n38_29558_c1
804 nmdc:mga00v17_116332_c1
805 nmdc:mga00v17_143360_c1
806 nmdc:mga0yw44_558120_c1
807 nmdc:mga06z11_107673_c1
808 nmdc:mga06z11_48483_c1
809 nmdc:mga04h51_107987_c1
810 nmdc:mga07m45_96119_c1
811 nmdc:mga05p37_22353_c1
812 nmdc:mga05p37_3068_c1
813 nmdc:mga05p37_576557_c1
814 nmdc:mga09592_377448_c1
815 nmdc:mga09592_483_c1
816 nmdc:mga06r32_434_c1
817 nmdc:mga08y16_18315_c1
818 nmdc:mga08y16_2764_c1
819 nmdc:mga0sz30_21330_c1
820 nmdc:mga0sz30_70672_c1
821 Ga0495601_0020207
822 Ga0495601_0037009
823 Ga0495612_0006449
824 Ga0495595_0016148
825 Ga0495619_0002196
826 Ga0495619_0012435
827 Ga0495619_0255372
828 Ga0500641_0032656
829 Ga0500568_0000764
830 Ga0530510_0001392
831 2558906288
832 2643832789
833 2644053416
834 2899375857
835 2939583752
836 8056212778

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

44

261

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.7122 59 203
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.6875 58 206
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.6875 58 206
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.6792 59 204
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.6775 58 201
ID Description Score Start End Superfamily
af_P54675_890_1043_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.8249 171 192 2.60.40.150
af_Q9D1A0_27_140_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7689 65 169 3.40.30.10
af_P9WLI7_63_230_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.7447 168 192 2.40.10.10
3drnB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7122 59 203 3.40.30.10
af_Q8IJD0_13_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7083 66 200 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1H5RET5-F1-model_v4 Predicted dithiol-disulfide oxidoreductase, DUF899 family 0.9816 23 224
AF-A0A4Q3JBH4-F1-model_v4 DUF899 domain-containing protein 0.9811 19 254
AF-A0A419HRC0-F1-model_v4 DUF899 domain-containing protein 0.9805 23 257
AF-A0A4R4NXS5-F1-model_v4 DUF899 domain-containing protein 0.9795 20 255
AF-A0A7W3QQF3-F1-model_v4 Putative dithiol-disulfide oxidoreductase (DUF899 family) 0.9746 64 258

Map