F439356

General Info

Members Datasets Scaffolds Average Seq Length
418 252 411 250

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0710675|Ga0466967_0710675_43_855
Length 270
Sequence MSWAAVDPAILAPAFLAGLLVLATHVPLGAQVLRKGIVFIDLAIAQIAALGVVVAGLFEVASDGWPIQLAAAAAALAGALLLDWSERRWPQVQEAQIGVVFVLAATAGILLLANNPHGGEHLRDLLAGQILWVGYPRLAVPLVVTTALLGLWLARGARLSTRGFYLLFAVAVTVSVQLVGXXXVFASLIVPSLGSRDWPEGRRLPVAYAIGVAGYGAGLVLSAALDLPSGALIVWCLAVLAVLAHAAAPRRRGAPMPVQVHGVDRQAADG

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
159 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
176 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
203 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
213 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
214 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
218 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
223 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
235 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
236 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
237 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
238 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
239 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
240 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
241 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
242 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
243 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
244 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
245 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
246 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
247 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
248 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
249 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
250 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
251 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
252 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 0
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.42
Nodule 0
Rhizoplane 1.2
Rhizosphere 87.56
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1001046 3300002738 Bacteria 11018
2 JGI25153J46596_10000974 3300003215 Bacteria 17386
3 Ga0055526_1000023 3300003771 Bacteria 163444
4 Ga0065165_1001844 3300005262 Bacteria 20678
5 Ga0070676_10003060 3300005328 Bacteria 8639
6 Ga0070676_10003203 3300005328 Bacteria 8487
7 Ga0070676_10218191 3300005328 Bacteria 1258
8 Ga0070690_100002334 3300005330 Bacteria 10201
9 Ga0070670_100035011 3300005331 Bacteria 4322
10 Ga0070670_100094105 3300005331 Bacteria 2577
11 Ga0070670_100149786 3300005331 Bacteria 2019
12 Ga0070670_100306915 3300005331 Bacteria 1389
13 Ga0070670_100314275 3300005331 Bacteria 1372
14 Ga0070677_10006352 3300005333 Bacteria 3923
15 Ga0070677_10021494 3300005333 Bacteria 2368
16 Ga0068869_100000889 3300005334 Bacteria 17243
17 Ga0070666_10024231 3300005335 Bacteria 3952
18 Ga0070682_100012077 3300005337 Bacteria 4943
19 Ga0068868_100015625 3300005338 Bacteria 5621
20 Ga0068868_100018257 3300005338 Bacteria 5240
21 Ga0068868_100056521 3300005338 Bacteria 3098
22 Ga0068868_100070593 3300005338 Bacteria 2785
23 Ga0070687_100038491 3300005343 Bacteria 2398
24 Ga0070661_100153045 3300005344 Bacteria 1744
25 Ga0070668_100001329 3300005347 Bacteria 17646
26 Ga0070668_100019369 3300005347 Bacteria 5122
27 Ga0070668_100068077 3300005347 Bacteria 2767
28 Ga0070668_100292594 3300005347 Bacteria 1363
29 Ga0070669_100002377 3300005353 Bacteria 13608
30 Ga0070669_100074227 3300005353 Bacteria 2521
31 Ga0070669_100317310 3300005353 Bacteria 1258
32 Ga0070675_100047263 3300005354 Bacteria 3526
33 Ga0070675_100072042 3300005354 Bacteria 2868
34 Ga0070675_100075538 3300005354 Bacteria 2801
35 Ga0070671_100055230 3300005355 Bacteria 3304
36 Ga0070674_100001004 3300005356 Bacteria 14721
37 Ga0070674_100013612 3300005356 Bacteria 5034
38 Ga0070673_100003898 3300005364 Bacteria 9374
39 Ga0070673_100075960 3300005364 Bacteria 2711
40 Ga0070667_100000294 3300005367 Bacteria 56218
41 Ga0070667_100199468 3300005367 Bacteria 1775
42 Ga0070700_100103011 3300005441 Bacteria 1884
43 Ga0070678_100008075 3300005456 Bacteria 6280
44 Ga0070678_100434791 3300005456 Bacteria 1146
45 Ga0070678_100472754 3300005456 Bacteria 1102
46 Ga0070662_100137637 3300005457 Bacteria 1889
47 Ga0068867_100001003 3300005459 Bacteria 19259
48 Ga0068867_100008508 3300005459 Bacteria 7244
49 Ga0068867_100011686 3300005459 Bacteria 6200
50 Ga0068867_100066669 3300005459 Bacteria 2682
51 Ga0070706_100786522 3300005467 Bacteria 881
52 Ga0070672_100002739 3300005543 Bacteria 11283
53 Ga0070672_100030083 3300005543 Bacteria 4076
54 Ga0070672_100051658 3300005543 Bacteria 3207
55 Ga0070686_100016813 3300005544 Bacteria 4260
56 Ga0070665_100103201 3300005548 Bacteria 2855
57 Ga0070664_100084093 3300005564 Bacteria 2746
58 Ga0070664_100087025 3300005564 Bacteria 2700
59 Ga0068854_100028660 3300005578 Bacteria 3850
60 Ga0068854_100217784 3300005578 Bacteria 1509
61 Ga0068856_100137606 3300005614 Bacteria 2448
62 Ga0068856_100526111 3300005614 Bacteria 1204
63 Ga0068852_100183412 3300005616 Bacteria 1969
64 Ga0068852_100269628 3300005616 Bacteria 1637
65 Ga0068859_100053455 3300005617 Bacteria 4063
66 Ga0068864_100104006 3300005618 Bacteria 2522
67 Ga0068861_100120171 3300005719 Bacteria 2118
68 Ga0068861_100187966 3300005719 Bacteria 1724
69 Ga0068863_100001702 3300005841 Bacteria 21786
70 Ga0068863_100283562 3300005841 Bacteria 1605
71 Ga0068858_100001135 3300005842 Bacteria 27560
72 Ga0068860_100002478 3300005843 Bacteria 19367
73 Ga0068862_100018333 3300005844 Bacteria 5828
74 Ga0070715_10080679 3300006163 Bacteria 1476
75 Ga0075366_10191377 3300006195 Bacteria 1243
76 Ga0075370_10025652 3300006353 Bacteria 3262
77 Ga0068865_100053713 3300006881 Bacteria 2796
78 Ga0097620_100053455 3300006931 Bacteria 4063
79 Ga0105240_10251902 3300009093 Bacteria 2042
80 Ga0105243_10062055 3300009148 Bacteria 2991
81 Ga0105243_10094480 3300009148 Bacteria 2469
82 Ga0105248_10112117 3300009177 Bacteria 3076
83 Ga0105248_10383133 3300009177 Bacteria 1583
84 Ga0105248_10528405 3300009177 Bacteria 1330
85 Ga0105237_10080698 3300009545 Bacteria 3243
86 Ga0105249_10052907 3300009553 Bacteria 3710
87 Ga0105249_10666905 3300009553 Bacteria 1098
88 Ga0157370_10529596 3300013104 Bacteria 1081
89 Ga0157369_10624023 3300013105 Bacteria 1112
90 Ga0157378_10173599 3300013297 Bacteria 2023
91 Ga0163162_10016325 3300013306 Bacteria 7259
92 Ga0157372_10299719 3300013307 Bacteria 1870
93 Ga0157372_10301628 3300013307 Bacteria 1863
94 Ga0157372_10339189 3300013307 Bacteria 1750
95 Ga0157375_10068955 3300013308 Bacteria 3541
96 Ga0157375_10080797 3300013308 Bacteria 3290
97 Ga0157380_10061216 3300014326 Bacteria 3011
98 Ga0157377_10087259 3300014745 Bacteria 1836
99 Ga0157377_10245211 3300014745 Bacteria 1158
100 Ga0157379_10095087 3300014968 Bacteria 2674
101 Ga0157376_10219499 3300014969 Bacteria 1760
102 Ga0157376_10234517 3300014969 Bacteria 1706
103 Ga0163161_10010482 3300017792 Bacteria 6417
104 Ga0163161_10052445 3300017792 Bacteria 2956
105 Ga0213872_10000087 3300021361 Bacteria 84858
106 Ga0213872_10000157 3300021361 Bacteria 62892
107 Ga0209646_1000049 3300025246 Bacteria 301924
108 Ga0209026_1026569 3300025250 Bacteria 869
109 Ga0209564_1000002 3300025295 Bacteria 1636803
110 Ga0209758_1000057 3300025297 Bacteria 333111
111 Ga0209050_1000268 3300025298 Bacteria 111281
112 Ga0207697_10017271 3300025315 Bacteria 2966
113 Ga0207697_10022189 3300025315 Bacteria 2601
114 Ga0207656_10106603 3300025321 Bacteria 1290
115 Ga0207682_10000158 3300025893 Bacteria 30682
116 Ga0207682_10008631 3300025893 Bacteria 4028
117 Ga0207682_10012352 3300025893 Bacteria 3334
118 Ga0207680_10002802 3300025903 Bacteria 8158
119 Ga0207685_10049131 3300025905 Bacteria 1619
120 Ga0207645_10005861 3300025907 Bacteria 8853
121 Ga0207645_10013766 3300025907 Bacteria 5429
122 Ga0207645_10018732 3300025907 Bacteria 4547
123 Ga0207643_10027161 3300025908 Bacteria 3172
124 Ga0207695_10063109 3300025913 Bacteria 3820
125 Ga0207662_10031118 3300025918 Bacteria 3100
126 Ga0207649_10103522 3300025920 Bacteria 1889
127 Ga0207681_10000420 3300025923 Bacteria 29486
128 Ga0207681_10022630 3300025923 Bacteria 4011
129 Ga0207650_10000480 3300025925 Bacteria 33274
130 Ga0207650_10004705 3300025925 Bacteria 9326
131 Ga0207650_10424266 3300025925 Bacteria 1104
132 Ga0207659_10000118 3300025926 Bacteria 46531
133 Ga0207659_10034848 3300025926 Bacteria 3475
134 Ga0207659_10050972 3300025926 Bacteria 2942
135 Ga0207687_10021920 3300025927 Bacteria 4247
136 Ga0207644_10051277 3300025931 Bacteria 2961
137 Ga0207644_10133954 3300025931 Bacteria 1900
138 Ga0207706_10091106 3300025933 Bacteria 2681
139 Ga0207709_10003563 3300025935 Bacteria 9207
140 Ga0207669_10000706 3300025937 Bacteria 14412
141 Ga0207669_10011807 3300025937 Bacteria 4267
142 Ga0207704_10008820 3300025938 Bacteria 4841
143 Ga0207704_10013117 3300025938 Bacteria 4137
144 Ga0207704_10327835 3300025938 Bacteria 1183
145 Ga0207691_10000238 3300025940 Bacteria 53833
146 Ga0207691_10007468 3300025940 Bacteria 10522
147 Ga0207711_10088112 3300025941 Bacteria 2724
148 Ga0207689_10428688 3300025942 Bacteria 1104
149 Ga0207679_10660337 3300025945 Bacteria 946
150 Ga0207651_10001131 3300025960 Bacteria 11895
151 Ga0207651_10015153 3300025960 Bacteria 4471
152 Ga0207712_10050049 3300025961 Bacteria 2916
153 Ga0207712_10579405 3300025961 Bacteria 968
154 Ga0207668_10091743 3300025972 Bacteria 2233
155 Ga0207668_10117006 3300025972 Bacteria 2011
156 Ga0207640_10061281 3300025981 Bacteria 2491
157 Ga0207658_10007911 3300025986 Bacteria 7241
158 Ga0207658_10208291 3300025986 Bacteria 1637
159 Ga0207677_10005476 3300026023 Bacteria 6890
160 Ga0207677_10075513 3300026023 Bacteria 2396
161 Ga0207703_10006990 3300026035 Bacteria 8981
162 Ga0207639_10302392 3300026041 Bacteria 1414
163 Ga0207678_10087155 3300026067 Bacteria 2668
164 Ga0207708_10039501 3300026075 Bacteria 3596
165 Ga0207708_10130782 3300026075 Bacteria 1962
166 Ga0207702_10140470 3300026078 Bacteria 2185
167 Ga0207702_10244926 3300026078 Bacteria 1681
168 Ga0207641_10003717 3300026088 Bacteria 13438
169 Ga0207648_10002514 3300026089 Bacteria 19686
170 Ga0207648_10003526 3300026089 Bacteria 16384
171 Ga0207648_10029392 3300026089 Bacteria 4874
172 Ga0207648_10044866 3300026089 Bacteria 3879
173 Ga0207676_10034951 3300026095 Bacteria 3809
174 Ga0207676_10351883 3300026095 Bacteria 1362
175 Ga0207674_10206218 3300026116 Bacteria 1915
176 Ga0207675_100001432 3300026118 Bacteria 23904
177 Ga0207683_10013866 3300026121 Bacteria 6873
178 Ga0207683_10091918 3300026121 Bacteria 2704
179 Ga0207698_10039318 3300026142 Bacteria 3503
180 Ga0207698_10240983 3300026142 Bacteria 1648
181 Ga0207698_10489061 3300026142 Bacteria 1195
182 Ga0268266_10170929 3300028379 Bacteria 1973
183 Ga0268265_10016316 3300028380 Bacteria 5099
184 Ga0268264_10050289 3300028381 Bacteria 3470
185 Ga0307517_10069576 3300028786 Bacteria 3186
186 Ga0307515_10000727 3300028794 Bacteria 75922
187 Ga0307515_10000998 3300028794 Bacteria 64720
188 Ga0307512_10028189 3300030522 Bacteria 4928
189 Ga0307513_10134993 3300031456 Bacteria 2404
190 Ga0307508_10000004 3300031616 Bacteria 287547
191 Ga0307514_10101369 3300031649 Bacteria 2066
192 Ga0265314_10023311 3300031711 Bacteria 4720
193 Ga0307516_10425266 3300031730 Bacteria 986
194 Ga0307405_10005514 3300031731 Bacteria 6111
195 Ga0307413_10020711 3300031824 Bacteria 3505
196 Ga0307410_10057513 3300031852 Bacteria 2648
197 Ga0307407_10018688 3300031903 Bacteria 3512
198 Ga0307412_10006337 3300031911 Bacteria 6684
199 Ga0307409_100234675 3300031995 Bacteria 1665
200 Ga0307416_100197065 3300032002 Bacteria 1906
201 Ga0307414_10034527 3300032004 Bacteria 3355
202 Ga0307411_10001107 3300032005 Bacteria 10491
203 Ga0307411_10818282 3300032005 Bacteria 822
204 Ga0307415_100013879 3300032126 Bacteria 4717
205 Ga0373946_0088728 3300035171 Bacteria 1367
206 Ga0373947_0139235 3300035725 Bacteria 1555
207 Ga0373925_0223367 3300037068 Bacteria 1504
208 Ga0395899_0000012 3300037312 Bacteria 517561
209 Ga0395899_0000473 3300037312 Bacteria 45449
210 Ga0395899_0003993 3300037312 Bacteria 11622
211 Ga0395899_0020807 3300037312 Bacteria 4975
212 Ga0395900_0137282 3300037418 Bacteria 2505
213 Ga0395900_0196942 3300037418 Bacteria 2040
214 Ga0395898_0036856 3300037466 Bacteria 4853
215 Ga0395898_0057993 3300037466 Bacteria 3771
216 Ga0395905_0028841 3300037471 Bacteria 5231
217 Ga0395905_0095975 3300037471 Unclassified 2783
218 Ga0395905_0110777 3300037471 Bacteria 2578
219 Ga0395905_0586791 3300037471 Bacteria 1016
220 Ga0395901_0011855 3300038443 Bacteria 8838
221 Ga0395901_0044778 3300038443 Bacteria 4589
222 Ga0395901_0212867 3300038443 Bacteria 2022
223 Ga0395901_0272545 3300038443 Bacteria 1760
224 Ga0436361_0535327 3300039447 Bacteria 8954
225 Ga0436361_0537843 3300039447 Bacteria 16101
226 Ga0436361_0595316 3300039447 Bacteria 75842
227 Ga0436361_0883268 3300039447 Bacteria 15184
228 Ga0451789_0342494 3300041443 Bacteria 2194
229 Ga0451853_0277111 3300041512 Bacteria 1186
230 Ga0450904_000300 3300042139 Bacteria 10579
231 Ga0451577_0019454 3300042876 Bacteria 6244
232 Ga0451577_0048095 3300042876 Bacteria 3812
233 Ga0451577_0099964 3300042876 Bacteria 2591
234 Ga0451577_0104629 3300042876 Bacteria 2529
235 Ga0453683_0054961 3300044673 Bacteria 2492
236 Ga0466965_0001048 3300044683 Bacteria 10728
237 Ga0453684_0000189 3300044712 Bacteria 269690
238 Ga0453684_0000731 3300044712 Bacteria 115326
239 Ga0453684_0001597 3300044712 Bacteria 62266
240 Ga0453684_0171506 3300044712 Bacteria 2556
241 Ga0466968_0004157 3300044735 Bacteria 5393
242 Ga0466970_0023414 3300044765 Bacteria 3225
243 Ga0466959_0004039 3300045049 Bacteria 9760
244 Ga0451576_0000147 3300045051 Bacteria 179223
245 Ga0451576_0000272 3300045051 Bacteria 126530
246 Ga0451576_0012487 3300045051 Bacteria 9539
247 Ga0451576_0121173 3300045051 Bacteria 2723
248 Ga0466967_0710675 3300045976 Bacteria 996
249 Ga0495617_000178 3300046452 Bacteria 40156
250 Ga0495590_0000016 3300046457 Bacteria 225874
251 Ga0495629_0003994 3300046459 Bacteria 11088
252 Ga0495629_0101294 3300046459 Bacteria 2010
253 Ga0495638_0000057 3300046460 Bacteria 193690
254 Ga0495653_0039837 3300046463 Bacteria 3677
255 Ga0495650_0000317 3300046471 Bacteria 86483
256 Ga0495650_0001664 3300046471 Bacteria 20540
257 Ga0495605_0015521 3300046474 Bacteria 4139
258 Ga0495605_0069206 3300046474 Bacteria 1671
259 Ga0495605_0198255 3300046474 Bacteria 876
260 Ga0495584_0000001 3300046491 Bacteria 649329
261 Ga0495584_0001227 3300046491 Bacteria 15641
262 Ga0495584_0004782 3300046491 Bacteria 7240
263 Ga0495584_0075318 3300046491 Bacteria 1697
264 Ga0495585_0000002 3300046492 Bacteria 529316
265 Ga0495585_0000584 3300046492 Bacteria 34249
266 Ga0495585_0033124 3300046492 Bacteria 2926
267 Ga0495585_0045472 3300046492 Bacteria 2450
268 Ga0495594_0123608 3300046499 Bacteria 1463
269 Ga0495594_0217006 3300046499 Unclassified 1091
270 Ga0495596_0001241 3300046500 Bacteria 14835
271 Ga0495596_0010878 3300046500 Bacteria 3944
272 Ga0495596_0025972 3300046500 Bacteria 2362
273 Ga0495607_0001955 3300046501 Bacteria 17395
274 Ga0495607_0041055 3300046501 Bacteria 2750
275 Ga0495583_0000009 3300046506 Bacteria 372527
276 Ga0495583_0000026 3300046506 Bacteria 256777
277 Ga0495583_0000178 3300046506 Bacteria 108556
278 Ga0495583_0074573 3300046506 Bacteria 1485
279 Ga0495606_0000058 3300046507 Bacteria 194187
280 Ga0495606_0000066 3300046507 Bacteria 181028
281 Ga0495606_0013590 3300046507 Bacteria 6422
282 Ga0495606_0039730 3300046507 Bacteria 3167
283 Ga0495606_0040337 3300046507 Bacteria 3138
284 Ga0495606_0078582 3300046507 Bacteria 2057
285 Ga0495616_0001580 3300046513 Bacteria 15667
286 Ga0495616_0003358 3300046513 Bacteria 10273
287 Ga0495616_0105682 3300046513 Unclassified 1314
288 Ga0495620_0081238 3300046515 Bacteria 1311
289 Ga0495630_0022497 3300046517 Bacteria 4656
290 Ga0495631_0004465 3300046518 Bacteria 7449
291 Ga0495631_0024628 3300046518 Bacteria 2779
292 Ga0495632_0002326 3300046519 Bacteria 14624
293 Ga0495643_0000121 3300046522 Bacteria 125932
294 Ga0495643_0000491 3300046522 Bacteria 49785
295 Ga0495643_0068372 3300046522 Bacteria 1869
296 Ga0495643_0077733 3300046522 Bacteria 1733
297 Ga0495644_0002423 3300046523 Bacteria 7441
298 Ga0495648_0000002 3300046524 Bacteria 593972
299 Ga0495648_0000012 3300046524 Bacteria 294111
300 Ga0495648_0016459 3300046524 Bacteria 5333
301 Ga0495663_0002120 3300046525 Bacteria 6071
302 Ga0495663_0003757 3300046525 Bacteria 4328
303 Ga0495666_0002508 3300046526 Bacteria 9115
304 Ga0495642_0003031 3300046528 Bacteria 6689
305 Ga0495642_0005162 3300046528 Bacteria 5024
306 Ga0495642_0006414 3300046528 Bacteria 4513
307 Ga0495642_0020144 3300046528 Bacteria 2617
308 Ga0495642_0026084 3300046528 Bacteria 2319
309 Ga0495665_0001104 3300046531 Bacteria 14266
310 Ga0495665_0054698 3300046531 Bacteria 2108
311 Ga0495665_0251273 3300046531 Bacteria 910
312 Ga0495586_0005061 3300046535 Bacteria 7054
313 Ga0495587_0047420 3300046536 Bacteria 2547
314 Ga0495609_0026773 3300046538 Bacteria 2638
315 Ga0495609_0036602 3300046538 Bacteria 2215
316 Ga0495597_0000294 3300046542 Bacteria 44923
317 Ga0495597_0001705 3300046542 Bacteria 15220
318 Ga0495597_0092070 3300046542 Bacteria 1286
319 Ga0495645_0006342 3300046543 Bacteria 8207
320 Ga0495622_0000155 3300046557 Bacteria 58297
321 Ga0495622_0000344 3300046557 Bacteria 33349
322 Ga0495622_0002342 3300046557 Bacteria 9213
323 Ga0495622_0012071 3300046557 Bacteria 3995
324 Ga0495622_0012840 3300046557 Bacteria 3883
325 Ga0495622_0063918 3300046557 Bacteria 1702
326 Ga0495633_0001220 3300046558 Bacteria 20680
327 Ga0495633_0004566 3300046558 Bacteria 8736
328 Ga0495633_0019432 3300046558 Bacteria 3436
329 Ga0495633_0082561 3300046558 Bacteria 1495
330 Ga0495656_0176441 3300046615 Bacteria 1048
331 Ga0495668_0000495 3300046616 Bacteria 49167
332 Ga0495668_0005529 3300046616 Bacteria 8519
333 Ga0495668_0022880 3300046616 Bacteria 3569
334 Ga0495668_0157946 3300046616 Bacteria 1242
335 Ga0495634_0298853 3300046642 Bacteria 974
336 Ga0495611_0041169 3300046648 Bacteria 2060
337 Ga0495625_0000622 3300046660 Bacteria 51463
338 Ga0495625_0003036 3300046660 Bacteria 17217
339 Ga0495625_0046027 3300046660 Bacteria 3150
340 Ga0495661_0049384 3300046665 Bacteria 2551
341 Ga0495661_0091172 3300046665 Bacteria 1733
342 Ga0495661_0235259 3300046665 Bacteria 942
343 Ga0495588_0034689 3300046674 Bacteria 2553
344 Ga0495588_0043923 3300046674 Bacteria 2287
345 Ga0495647_0005737 3300046681 Bacteria 4083
346 Ga0495613_0064005 3300046689 Bacteria 2690
347 Ga0495624_0001419 3300046690 Bacteria 18653
348 Ga0495670_0001177 3300046691 Bacteria 12692
349 Ga0495671_0157792 3300046692 Bacteria 1104
350 Ga0495671_0161579 3300046692 Bacteria 1089
351 Ga0495671_0210505 3300046692 Bacteria 942
352 Ga0495589_0016112 3300046794 Bacteria 3840
353 Ga0495600_0002782 3300046809 Bacteria 10150
354 Ga0495660_0004214 3300046810 Bacteria 8738
355 Ga0495581_0008207 3300047315 Bacteria 6051
356 Ga0495604_0019962 3300047317 Bacteria 5357
357 Ga0495604_0043239 3300047317 Bacteria 3528
358 Ga0495674_0042916 3300047319 Bacteria 4029
359 Ga0495680_0249018 3300047322 Bacteria 1260
360 Ga0495683_0000009 3300047323 Bacteria 241385
361 Ga0495687_000209 3300047443 Bacteria 83956
362 Ga0495687_000623 3300047443 Bacteria 40772
363 Ga0495685_001136 3300047447 Bacteria 8138
364 Ga0495673_0005353 3300047469 Bacteria 7779
365 Ga0495681_0006041 3300047470 Bacteria 8007
366 Ga0495681_0025221 3300047470 Bacteria 3114
367 Ga0495681_0065852 3300047470 Bacteria 1655
368 Ga0495686_0095660 3300047472 Bacteria 1799
369 Ga0495593_0007398 3300047673 Bacteria 6431
370 Ga0495593_0023838 3300047673 Bacteria 3396
371 Ga0495615_0018623 3300048090 Bacteria 1531
372 Ga0495626_0009377 3300048091 Bacteria 5292
373 Ga0495626_0011972 3300048091 Bacteria 4565
374 Ga0495626_0026337 3300048091 Bacteria 2835
375 Ga0496102_0000234 3300048905 Bacteria 72781
376 Ga0496109_0274966 3300048912 Bacteria 1587
377 Ga0496115_0005488 3300048918 Bacteria 9230
378 Ga0496115_0176257 3300048918 Bacteria 1768
379 Ga0495678_045140 3300049459 Bacteria 1740
380 Ga0495682_0003380 3300049460 Bacteria 7108
381 Ga0501034_0062963 3300049571 Bacteria 3724
382 Ga0501034_0125583 3300049571 Bacteria 2551
383 Ga0501036_0114701 3300049572 Bacteria 2277
384 Ga0501047_0078846 3300049581 Bacteria 3167
385 Ga0501044_0151756 3300049823 Bacteria 2299
386 nmdc:mga0k408_66901_c1 3300050493 Bacteria 1510
387 nmdc:mga06z11_54487_c1 3300050494 Bacteria 2061
388 nmdc:mga07m45_18829_c1 3300050496 Bacteria 3734
389 nmdc:mga08y16_571559_c1 3300050511 Bacteria 1142
390 Ga0495601_0097962 3300053077 Bacteria 1892
391 Ga0495619_0012269 3300053085 Bacteria 5391
392 Ga0500578_0000011 3300053086 Bacteria 217243
393 Ga0500646_0081691 3300053090 Bacteria 987
394 Ga0500583_0044010 3300053092 Bacteria 2042
395 Ga0500651_0014582 3300053093 Bacteria 4809
396 Ga0500607_019867 3300053121 Bacteria 3798
397 Ga0500623_042556 3300053127 Bacteria 2317
398 Ga0500628_000724 3300053129 Bacteria 5857
399 Ga0500642_0008659 3300053130 Bacteria 3496
400 Ga0500652_000099 3300053131 Bacteria 34685
401 Ga0500658_0071748 3300053134 Bacteria 1463
402 Ga0500568_0054506 3300053139 Bacteria 1563
403 Ga0500577_0009170 3300053142 Bacteria 2861
404 Ga0500579_113932 3300053143 Bacteria 1346
405 Ga0500619_000122 3300053154 Bacteria 20397
406 Ga0500622_0000097 3300053156 Bacteria 89802
407 Ga0500622_0072464 3300053156 Bacteria 1739
408 Ga0500636_0000020 3300053177 Bacteria 96868
409 Ga0500570_095717 3300053724 Bacteria 1272
410 Ga0500584_046244 3300053726 Bacteria 1980
411 Ga0500625_011422 3300053729 Bacteria 4033

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_100066669 Ga0068867_1000666692 195
2 3300026089 Ga0207648_10029392 Ga0207648_100293926 195
3 3300005262 Ga0065165_1001844 Ga0065165_10018442 207
4 3300044712 Ga0453684_0000189 Ga0453684_0000189_79651_80388 208
5 3300025298 Ga0209050_1000268 Ga0209050_100026899 209
6 3300003215 JGI25153J46596_10000974 JGI25153J46596_100009744 210
7 3300006353 Ga0075370_10025652 Ga0075370_100256523 210
8 3300025297 Ga0209758_1000057 Ga0209758_100005778 210
9 3300050496 nmdc:mga07m45_18829_c1 nmdc:mga07m45_18829_c1_211_960 210
10 3300006195 Ga0075366_10191377 Ga0075366_101913772 211
11 3300028786 Ga0307517_10069576 Ga0307517_100695762 211
12 3300050494 nmdc:mga06z11_54487_c1 nmdc:mga06z11_54487_c1_344_1099 211
13 3300053156 Ga0500622_0072464 Ga0500622_0072464_464_1219 211
14 3300053726 Ga0500584_046244 Ga0500584_046244_123_878 211
15 3300046491 Ga0495584_0000001 Ga0495584_0000001_17468_18238 212
16 3300046507 Ga0495606_0013590 Ga0495606_0013590_79_849 212
17 3300050493 nmdc:mga0k408_66901_c1 nmdc:mga0k408_66901_c1_714_1475 214
18 3300053086 Ga0500578_0000011 Ga0500578_0000011_76681_77451 216
19 3300013307 Ga0157372_10339189 Ga0157372_103391892 217
20 3300041443 Ga0451789_0342494 Ga0451789_0342494_1193_1966 217
21 3300046515 Ga0495620_0081238 Ga0495620_0081238_337_1110 217
22 3300046519 Ga0495632_0002326 Ga0495632_0002326_10288_11061 217
23 3300047470 Ga0495681_0025221 Ga0495681_0025221_103_825 217
24 3300053090 Ga0500646_0081691 Ga0500646_0081691_86_859 217
25 3300053092 Ga0500583_0044010 Ga0500583_0044010_778_1551 217
26 3300053093 Ga0500651_0014582 Ga0500651_0014582_260_1033 217
27 3300053127 Ga0500623_042556 Ga0500623_042556_772_1545 217
28 3300053129 Ga0500628_000724 Ga0500628_000724_2996_3769 217
29 3300053130 Ga0500642_0008659 Ga0500642_0008659_2295_3068 217
30 3300053131 Ga0500652_000099 Ga0500652_000099_28288_29061 217
31 3300053134 Ga0500658_0071748 Ga0500658_0071748_344_1117 217
32 3300053139 Ga0500568_0054506 Ga0500568_0054506_540_1313 217
33 3300053142 Ga0500577_0009170 Ga0500577_0009170_460_1233 217
34 3300053143 Ga0500579_113932 Ga0500579_113932_433_1206 217
35 3300053156 Ga0500622_0000097 Ga0500622_0000097_45186_45959 217
36 3300053724 Ga0500570_095717 Ga0500570_095717_252_1025 217
37 3300045051 Ga0451576_0012487 Ga0451576_0012487_8153_8929 219
38 3300046499 Ga0495594_0123608 Ga0495594_0123608_197_1072 220
39 3300046507 Ga0495606_0040337 Ga0495606_0040337_1421_2182 222
40 3300053085 Ga0495619_0012269 Ga0495619_0012269_12_710 224
41 3300046459 Ga0495629_0101294 Ga0495629_0101294_61_852 225
42 3300046642 Ga0495634_0298853 Ga0495634_0298853_13_822 225
43 3300047673 Ga0495593_0007398 Ga0495593_0007398_2611_3420 225
44 3300049823 Ga0501044_0151756 Ga0501044_0151756_667_1431 225
45 3300005338 Ga0068868_100070593 Ga0068868_1000705934 226
46 3300005459 Ga0068867_100011686 Ga0068867_1000116865 226
47 3300005578 Ga0068854_100028660 Ga0068854_1000286605 226
48 3300025925 Ga0207650_10424266 Ga0207650_104242662 226
49 3300025981 Ga0207640_10061281 Ga0207640_100612812 226
50 3300026089 Ga0207648_10044866 Ga0207648_100448664 226
51 3300049571 Ga0501034_0125583 Ga0501034_0125583_1366_2130 226
52 3300049572 Ga0501036_0114701 Ga0501036_0114701_1278_2042 226
53 3300049581 Ga0501047_0078846 Ga0501047_0078846_2164_2928 226
54 3300030522 Ga0307512_10028189 Ga0307512_100281893 228
55 3300042876 Ga0451577_0019454 Ga0451577_0019454_5171_5917 228
56 3300044673 Ga0453683_0054961 Ga0453683_0054961_228_974 228
57 3300044712 Ga0453684_0001597 Ga0453684_0001597_29002_29748 228
58 3300045051 Ga0451576_0000272 Ga0451576_0000272_78310_79056 228
59 3300048918 Ga0496115_0176257 Ga0496115_0176257_476_1219 228
60 3300037312 Ga0395899_0003993 Ga0395899_0003993_8214_8972 229
61 3300037418 Ga0395900_0137282 Ga0395900_0137282_470_1228 229
62 3300037471 Ga0395905_0110777 Ga0395905_0110777_487_1245 229
63 3300038443 Ga0395901_0272545 Ga0395901_0272545_440_1198 229
64 3300046535 Ga0495586_0005061 Ga0495586_0005061_3928_4737 229
65 3300042139 Ga0450904_000300 Ga0450904_000300_1706_2467 230
66 3300046522 Ga0495643_0000121 Ga0495643_0000121_89337_90098 230
67 3300047472 Ga0495686_0095660 Ga0495686_0095660_1016_1780 230
68 3300005328 Ga0070676_10003203 Ga0070676_100032035 231
69 3300005355 Ga0070671_100055230 Ga0070671_1000552303 231
70 3300025907 Ga0207645_10005861 Ga0207645_1000586113 231
71 3300031616 Ga0307508_10000004 Ga0307508_10000004214 231
72 3300031649 Ga0307514_10101369 Ga0307514_101013692 231
73 3300037312 Ga0395899_0000012 Ga0395899_0000012_369090_369860 231
74 3300044712 Ga0453684_0000731 Ga0453684_0000731_13421_14170 231
75 3300046692 Ga0495671_0157792 Ga0495671_0157792_132_929 231
76 3300025986 Ga0207658_10208291 Ga0207658_102082912 232
77 3300028794 Ga0307515_10000998 Ga0307515_1000099819 232
78 3300046474 Ga0495605_0069206 Ga0495605_0069206_408_1178 232
79 3300046474 Ga0495605_0198255 Ga0495605_0198255_43_813 232
80 3300046491 Ga0495584_0004782 Ga0495584_0004782_6181_6951 232
81 3300046492 Ga0495585_0033124 Ga0495585_0033124_845_1615 232
82 3300046492 Ga0495585_0045472 Ga0495585_0045472_746_1516 232
83 3300046500 Ga0495596_0025972 Ga0495596_0025972_301_1071 232
84 3300046501 Ga0495607_0041055 Ga0495607_0041055_301_1071 232
85 3300046507 Ga0495606_0078582 Ga0495606_0078582_314_1060 232
86 3300046518 Ga0495631_0024628 Ga0495631_0024628_1393_2139 232
87 3300046522 Ga0495643_0077733 Ga0495643_0077733_10_780 232
88 3300046525 Ga0495663_0002120 Ga0495663_0002120_1184_1954 232
89 3300046528 Ga0495642_0006414 Ga0495642_0006414_2796_3542 232
90 3300046528 Ga0495642_0020144 Ga0495642_0020144_486_1256 232
91 3300046531 Ga0495665_0054698 Ga0495665_0054698_567_1337 232
92 3300046538 Ga0495609_0036602 Ga0495609_0036602_65_835 232
93 3300046558 Ga0495633_0082561 Ga0495633_0082561_468_1214 232
94 3300046616 Ga0495668_0022880 Ga0495668_0022880_1450_2220 232
95 3300046616 Ga0495668_0157946 Ga0495668_0157946_67_813 232
96 3300046648 Ga0495611_0041169 Ga0495611_0041169_464_1234 232
97 3300046660 Ga0495625_0046027 Ga0495625_0046027_1407_2177 232
98 3300046665 Ga0495661_0049384 Ga0495661_0049384_1358_2128 232
99 3300046665 Ga0495661_0091172 Ga0495661_0091172_118_864 232
100 3300046665 Ga0495661_0235259 Ga0495661_0235259_34_780 232
101 3300046692 Ga0495671_0161579 Ga0495671_0161579_59_805 232
102 3300046692 Ga0495671_0210505 Ga0495671_0210505_34_780 232
103 3300046794 Ga0495589_0016112 Ga0495589_0016112_1636_2406 232
104 3300047317 Ga0495604_0043239 Ga0495604_0043239_1820_2566 232
105 3300047322 Ga0495680_0249018 Ga0495680_0249018_179_949 232
106 3300047470 Ga0495681_0006041 Ga0495681_0006041_4433_5203 232
107 3300047470 Ga0495681_0065852 Ga0495681_0065852_846_1616 232
108 3300047673 Ga0495593_0023838 Ga0495593_0023838_959_1729 232
109 3300048091 Ga0495626_0026337 Ga0495626_0026337_1154_1924 232
110 3300049459 Ga0495678_045140 Ga0495678_045140_376_1146 232
111 3300049460 Ga0495682_0003380 Ga0495682_0003380_5495_6265 232
112 3300046459 Ga0495629_0003994 Ga0495629_0003994_2128_2898 233
113 3300046506 Ga0495583_0000026 Ga0495583_0000026_183861_184631 233
114 3300046506 Ga0495583_0074573 Ga0495583_0074573_146_916 233
115 3300046524 Ga0495648_0016459 Ga0495648_0016459_671_1441 233
116 3300046525 Ga0495663_0003757 Ga0495663_0003757_1702_2472 233
117 3300046528 Ga0495642_0026084 Ga0495642_0026084_1039_1809 233
118 3300046542 Ga0495597_0001705 Ga0495597_0001705_7249_8019 233
119 3300046542 Ga0495597_0092070 Ga0495597_0092070_67_837 233
120 3300047319 Ga0495674_0042916 Ga0495674_0042916_724_1494 233
121 3300047447 Ga0495685_001136 Ga0495685_001136_3050_3820 233
122 3300048091 Ga0495626_0009377 Ga0495626_0009377_1444_2214 233
123 3300048905 Ga0496102_0000234 Ga0496102_0000234_65216_65986 233
124 3300053121 Ga0500607_019867 Ga0500607_019867_2039_2827 233
125 3300053177 Ga0500636_0000020 Ga0500636_0000020_20896_21684 233
126 3300046491 Ga0495584_0001227 Ga0495584_0001227_7779_8549 234
127 3300046492 Ga0495585_0000584 Ga0495585_0000584_6470_7240 234
128 3300046500 Ga0495596_0010878 Ga0495596_0010878_2045_2815 234
129 3300046506 Ga0495583_0000009 Ga0495583_0000009_134516_135286 234
130 3300046513 Ga0495616_0003358 Ga0495616_0003358_1915_2685 234
131 3300046558 Ga0495633_0004566 Ga0495633_0004566_332_1102 234
132 3300046616 Ga0495668_0005529 Ga0495668_0005529_7597_8367 234
133 3300046660 Ga0495625_0003036 Ga0495625_0003036_4937_5746 234
134 3300046674 Ga0495588_0043923 Ga0495588_0043923_56_826 234
135 3300046691 Ga0495670_0001177 Ga0495670_0001177_3850_4620 234
136 3300047323 Ga0495683_0000009 Ga0495683_0000009_225897_226667 234
137 3300005347 Ga0070668_100068077 Ga0070668_1000680773 235
138 3300005441 Ga0070700_100103011 Ga0070700_1001030111 235
139 3300005467 Ga0070706_100786522 Ga0070706_1007865221 235
140 3300005614 Ga0068856_100526111 Ga0068856_1005261112 235
141 3300005719 Ga0068861_100187966 Ga0068861_1001879662 235
142 3300009093 Ga0105240_10251902 Ga0105240_102519022 235
143 3300009148 Ga0105243_10094480 Ga0105243_100944802 235
144 3300009545 Ga0105237_10080698 Ga0105237_100806983 235
145 3300025913 Ga0207695_10063109 Ga0207695_100631094 235
146 3300025938 Ga0207704_10013117 Ga0207704_100131174 235
147 3300026075 Ga0207708_10039501 Ga0207708_100395015 235
148 3300026078 Ga0207702_10244926 Ga0207702_102449262 235
149 3300005331 Ga0070670_100094105 Ga0070670_1000941052 236
150 3300005338 Ga0068868_100015625 Ga0068868_1000156254 236
151 3300014969 Ga0157376_10234517 Ga0157376_102345172 236
152 3300031711 Ga0265314_10023311 Ga0265314_100233114 236
153 3300044683 Ga0466965_0001048 Ga0466965_0001048_3751_4527 236
154 3300046491 Ga0495584_0075318 Ga0495584_0075318_134_913 236
155 3300046507 Ga0495606_0039730 Ga0495606_0039730_1016_1771 236
156 3300046513 Ga0495616_0105682 Ga0495616_0105682_321_1103 236
157 3300049571 Ga0501034_0062963 Ga0501034_0062963_155_910 236
158 3300053154 Ga0500619_000122 Ga0500619_000122_8669_9442 236
159 3300053729 Ga0500625_011422 Ga0500625_011422_2978_3775 236
160 iso_pu_bacteria 2643221592 2643972446 236
161 iso_pu_bacteria 2643221625 2644138546 236
162 iso_pu_bacteria 2643221648 2644272954 236
163 3300031730 Ga0307516_10425266 Ga0307516_104252662 237
164 3300042876 Ga0451577_0099964 Ga0451577_0099964_1440_2207 237
165 3300046452 Ga0495617_000178 Ga0495617_000178_6754_7524 237
166 3300046463 Ga0495653_0039837 Ga0495653_0039837_1852_2661 237
167 3300046474 Ga0495605_0015521 Ga0495605_0015521_3255_4097 237
168 3300046492 Ga0495585_0000002 Ga0495585_0000002_364300_365070 237
169 3300046499 Ga0495594_0217006 Ga0495594_0217006_44_886 237
170 3300046500 Ga0495596_0001241 Ga0495596_0001241_5967_6809 237
171 3300046513 Ga0495616_0001580 Ga0495616_0001580_8832_9602 237
172 3300046517 Ga0495630_0022497 Ga0495630_0022497_1049_1858 237
173 3300046518 Ga0495631_0004465 Ga0495631_0004465_2814_3656 237
174 3300046522 Ga0495643_0068372 Ga0495643_0068372_148_990 237
175 3300046523 Ga0495644_0002423 Ga0495644_0002423_2221_3063 237
176 3300046524 Ga0495648_0000012 Ga0495648_0000012_164247_165017 237
177 3300046536 Ga0495587_0047420 Ga0495587_0047420_1085_1894 237
178 3300046557 Ga0495622_0012071 Ga0495622_0012071_1445_2287 237
179 3300046557 Ga0495622_0012840 Ga0495622_0012840_1116_1925 237
180 3300046558 Ga0495633_0019432 Ga0495633_0019432_1576_2346 237
181 3300046689 Ga0495613_0064005 Ga0495613_0064005_1606_2415 237
182 3300046809 Ga0495600_0002782 Ga0495600_0002782_7232_8041 237
183 3300047469 Ga0495673_0005353 Ga0495673_0005353_3883_4725 237
184 3300048091 Ga0495626_0011972 Ga0495626_0011972_464_1306 237
185 iso_pu_bacteria 2585428058 2587733748 237
186 3300005331 Ga0070670_100306915 Ga0070670_1003069152 238
187 3300005333 Ga0070677_10006352 Ga0070677_100063522 238
188 3300005456 Ga0070678_100008075 Ga0070678_1000080757 238
189 3300005548 Ga0070665_100103201 Ga0070665_1001032013 238
190 3300031731 Ga0307405_10005514 Ga0307405_100055144 238
191 3300031824 Ga0307413_10020711 Ga0307413_100207113 238
192 3300031852 Ga0307410_10057513 Ga0307410_100575132 238
193 3300031903 Ga0307407_10018688 Ga0307407_100186882 238
194 3300031911 Ga0307412_10006337 Ga0307412_100063376 238
195 3300031995 Ga0307409_100234675 Ga0307409_1002346752 238
196 3300032002 Ga0307416_100197065 Ga0307416_1001970652 238
197 3300032004 Ga0307414_10034527 Ga0307414_100345272 238
198 3300032005 Ga0307411_10001107 Ga0307411_100011077 238
199 3300032126 Ga0307415_100013879 Ga0307415_1000138792 238
200 3300044735 Ga0466968_0004157 Ga0466968_0004157_3624_4406 238
201 3300028794 Ga0307515_10000727 Ga0307515_1000072728 239
202 3300031456 Ga0307513_10134993 Ga0307513_101349931 239
203 3300046526 Ga0495666_0002508 Ga0495666_0002508_2804_3613 239
204 3300046531 Ga0495665_0001104 Ga0495665_0001104_5483_6292 239
205 3300046531 Ga0495665_0251273 Ga0495665_0251273_58_867 239
206 3300046557 Ga0495622_0002342 Ga0495622_0002342_873_1682 239
207 3300046557 Ga0495622_0063918 Ga0495622_0063918_793_1602 239
208 3300046674 Ga0495588_0034689 Ga0495588_0034689_513_1322 239
209 3300046690 Ga0495624_0001419 Ga0495624_0001419_12826_13635 239
210 3300047315 Ga0495581_0008207 Ga0495581_0008207_557_1366 239
211 3300047317 Ga0495604_0019962 Ga0495604_0019962_1159_1968 239
212 iso_pu_bacteria 2588253510 2588291724 239
213 3300037068 Ga0373925_0223367 Ga0373925_0223367_597_1364 240
214 3300037471 Ga0395905_0586791 Ga0395905_0586791_105_875 240
215 3300046528 Ga0495642_0005162 Ga0495642_0005162_2053_2799 240
216 3300045051 Ga0451576_0000147 Ga0451576_0000147_80150_80935 241
217 iso_pu_bacteria 2585428057 2587727945 241
218 3300005331 Ga0070670_100314275 Ga0070670_1003142752 242
219 3300048918 Ga0496115_0005488 Ga0496115_0005488_3315_4091 242
220 3300048912 Ga0496109_0274966 Ga0496109_0274966_723_1505 243
221 3300032005 Ga0307411_10818282 Ga0307411_108182821 244
222 3300038443 Ga0395901_0011855 Ga0395901_0011855_6998_7771 244
223 3300044712 Ga0453684_0171506 Ga0453684_0171506_1100_1897 244
224 3300045051 Ga0451576_0121173 Ga0451576_0121173_1262_2059 244
225 3300046471 Ga0495650_0000317 Ga0495650_0000317_43276_44034 244
226 3300037312 Ga0395899_0000473 Ga0395899_0000473_35368_36129 245
227 3300037312 Ga0395899_0020807 Ga0395899_0020807_3873_4634 245
228 3300037418 Ga0395900_0196942 Ga0395900_0196942_487_1248 245
229 3300037466 Ga0395898_0036856 Ga0395898_0036856_1653_2414 245
230 3300038443 Ga0395901_0044778 Ga0395901_0044778_570_1331 245
231 3300038443 Ga0395901_0212867 Ga0395901_0212867_663_1424 245
232 3300005337 Ga0070682_100012077 Ga0070682_1000120773 246
233 iso_pu_bacteria 2643221603 2644027880 246
234 3300037466 Ga0395898_0057993 Ga0395898_0057993_13_783 247
235 3300037471 Ga0395905_0028841 Ga0395905_0028841_3628_4398 247
236 3300042876 Ga0451577_0104629 Ga0451577_0104629_1469_2266 247
237 3300005614 Ga0068856_100137606 Ga0068856_1001376062 248
238 3300013307 Ga0157372_10301628 Ga0157372_103016282 248
239 3300026078 Ga0207702_10140470 Ga0207702_101404703 248
240 3300042876 Ga0451577_0048095 Ga0451577_0048095_731_1525 248
241 3300044765 Ga0466970_0023414 Ga0466970_0023414_1937_2713 248
242 3300045049 Ga0466959_0004039 Ga0466959_0004039_7380_8156 248
243 3300005344 Ga0070661_100153045 Ga0070661_1001530452 249
244 3300005354 Ga0070675_100075538 Ga0070675_1000755382 249
245 3300009177 Ga0105248_10528405 Ga0105248_105284051 249
246 3300013104 Ga0157370_10529596 Ga0157370_105295962 249
247 3300013105 Ga0157369_10624023 Ga0157369_106240232 249
248 3300013307 Ga0157372_10299719 Ga0157372_102997191 249
249 3300025893 Ga0207682_10012352 Ga0207682_100123523 249
250 3300025920 Ga0207649_10103522 Ga0207649_101035222 249
251 3300026023 Ga0207677_10075513 Ga0207677_100755132 249
252 3300026041 Ga0207639_10302392 Ga0207639_103023922 249
253 3300026121 Ga0207683_10091918 Ga0207683_100919181 249
254 3300026142 Ga0207698_10240983 Ga0207698_102409832 249
255 3300035171 Ga0373946_0088728 Ga0373946_0088728_19_792 249
256 3300035725 Ga0373947_0139235 Ga0373947_0139235_508_1281 249
257 3300041512 Ga0451853_0277111 Ga0451853_0277111_289_1062 249
258 3300046543 Ga0495645_0006342 Ga0495645_0006342_1749_2522 249
259 3300053077 Ga0495601_0097962 Ga0495601_0097962_19_792 249
260 3300003771 Ga0055526_1000023 Ga0055526_1000023115 250
261 3300025295 Ga0209564_1000002 Ga0209564_1000002601 250
262 3300005328 Ga0070676_10003060 Ga0070676_100030602 251
263 3300005328 Ga0070676_10218191 Ga0070676_102181912 251
264 3300005330 Ga0070690_100002334 Ga0070690_1000023342 251
265 3300005331 Ga0070670_100035011 Ga0070670_1000350114 251
266 3300005331 Ga0070670_100149786 Ga0070670_1001497862 251
267 3300005333 Ga0070677_10021494 Ga0070677_100214942 251
268 3300005334 Ga0068869_100000889 Ga0068869_1000008892 251
269 3300005335 Ga0070666_10024231 Ga0070666_100242312 251
270 3300005338 Ga0068868_100018257 Ga0068868_1000182575 251
271 3300005338 Ga0068868_100056521 Ga0068868_1000565213 251
272 3300005343 Ga0070687_100038491 Ga0070687_1000384912 251
273 3300005347 Ga0070668_100001329 Ga0070668_10000132914 251
274 3300005347 Ga0070668_100019369 Ga0070668_1000193693 251
275 3300005347 Ga0070668_100292594 Ga0070668_1002925941 251
276 3300005353 Ga0070669_100002377 Ga0070669_10000237712 251
277 3300005353 Ga0070669_100074227 Ga0070669_1000742273 251
278 3300005353 Ga0070669_100317310 Ga0070669_1003173102 251
279 3300005354 Ga0070675_100047263 Ga0070675_1000472633 251
280 3300005354 Ga0070675_100072042 Ga0070675_1000720424 251
281 3300005356 Ga0070674_100001004 Ga0070674_1000010048 251
282 3300005356 Ga0070674_100013612 Ga0070674_1000136123 251
283 3300005364 Ga0070673_100003898 Ga0070673_1000038982 251
284 3300005364 Ga0070673_100075960 Ga0070673_1000759602 251
285 3300005367 Ga0070667_100000294 Ga0070667_10000029455 251
286 3300005367 Ga0070667_100199468 Ga0070667_1001994682 251
287 3300005456 Ga0070678_100434791 Ga0070678_1004347912 251
288 3300005456 Ga0070678_100472754 Ga0070678_1004727542 251
289 3300005457 Ga0070662_100137637 Ga0070662_1001376372 251
290 3300005459 Ga0068867_100001003 Ga0068867_1000010033 251
291 3300005459 Ga0068867_100008508 Ga0068867_1000085086 251
292 3300005543 Ga0070672_100002739 Ga0070672_1000027392 251
293 3300005543 Ga0070672_100030083 Ga0070672_1000300832 251
294 3300005543 Ga0070672_100051658 Ga0070672_1000516582 251
295 3300005544 Ga0070686_100016813 Ga0070686_1000168133 251
296 3300005564 Ga0070664_100084093 Ga0070664_1000840933 251
297 3300005564 Ga0070664_100087025 Ga0070664_1000870252 251
298 3300005578 Ga0068854_100217784 Ga0068854_1002177842 251
299 3300005616 Ga0068852_100183412 Ga0068852_1001834122 251
300 3300005616 Ga0068852_100269628 Ga0068852_1002696282 251
301 3300005617 Ga0068859_100053455 Ga0068859_1000534552 251
302 3300005618 Ga0068864_100104006 Ga0068864_1001040063 251
303 3300005719 Ga0068861_100120171 Ga0068861_1001201712 251
304 3300005841 Ga0068863_100001702 Ga0068863_10000170218 251
305 3300005841 Ga0068863_100283562 Ga0068863_1002835622 251
306 3300005842 Ga0068858_100001135 Ga0068858_10000113524 251
307 3300005843 Ga0068860_100002478 Ga0068860_10000247817 251
308 3300005844 Ga0068862_100018333 Ga0068862_1000183332 251
309 3300006163 Ga0070715_10080679 Ga0070715_100806792 251
310 3300006881 Ga0068865_100053713 Ga0068865_1000537133 251
311 3300006931 Ga0097620_100053455 Ga0097620_1000534554 251
312 3300009148 Ga0105243_10062055 Ga0105243_100620552 251
313 3300009177 Ga0105248_10112117 Ga0105248_101121173 251
314 3300009177 Ga0105248_10383133 Ga0105248_103831332 251
315 3300009553 Ga0105249_10052907 Ga0105249_100529073 251
316 3300009553 Ga0105249_10666905 Ga0105249_106669052 251
317 3300013297 Ga0157378_10173599 Ga0157378_101735992 251
318 3300013306 Ga0163162_10016325 Ga0163162_100163253 251
319 3300013308 Ga0157375_10068955 Ga0157375_100689553 251
320 3300013308 Ga0157375_10080797 Ga0157375_100807973 251
321 3300014326 Ga0157380_10061216 Ga0157380_100612163 251
322 3300014745 Ga0157377_10087259 Ga0157377_100872593 251
323 3300014745 Ga0157377_10245211 Ga0157377_102452112 251
324 3300014968 Ga0157379_10095087 Ga0157379_100950873 251
325 3300014969 Ga0157376_10219499 Ga0157376_102194991 251
326 3300017792 Ga0163161_10010482 Ga0163161_100104825 251
327 3300017792 Ga0163161_10052445 Ga0163161_100524453 251
328 3300021361 Ga0213872_10000087 Ga0213872_1000008759 251
329 3300025315 Ga0207697_10017271 Ga0207697_100172713 251
330 3300025315 Ga0207697_10022189 Ga0207697_100221892 251
331 3300025321 Ga0207656_10106603 Ga0207656_101066032 251
332 3300025893 Ga0207682_10000158 Ga0207682_1000015824 251
333 3300025893 Ga0207682_10008631 Ga0207682_100086313 251
334 3300025903 Ga0207680_10002802 Ga0207680_100028023 251
335 3300025905 Ga0207685_10049131 Ga0207685_100491312 251
336 3300025907 Ga0207645_10013766 Ga0207645_100137663 251
337 3300025907 Ga0207645_10018732 Ga0207645_100187325 251
338 3300025908 Ga0207643_10027161 Ga0207643_100271613 251
339 3300025918 Ga0207662_10031118 Ga0207662_100311183 251
340 3300025923 Ga0207681_10000420 Ga0207681_100004203 251
341 3300025923 Ga0207681_10022630 Ga0207681_100226304 251
342 3300025925 Ga0207650_10000480 Ga0207650_100004806 251
343 3300025925 Ga0207650_10004705 Ga0207650_100047052 251
344 3300025926 Ga0207659_10000118 Ga0207659_1000011827 251
345 3300025926 Ga0207659_10034848 Ga0207659_100348483 251
346 3300025926 Ga0207659_10050972 Ga0207659_100509722 251
347 3300025927 Ga0207687_10021920 Ga0207687_100219202 251
348 3300025931 Ga0207644_10051277 Ga0207644_100512772 251
349 3300025931 Ga0207644_10133954 Ga0207644_101339542 251
350 3300025933 Ga0207706_10091106 Ga0207706_100911063 251
351 3300025935 Ga0207709_10003563 Ga0207709_100035635 251
352 3300025937 Ga0207669_10000706 Ga0207669_100007067 251
353 3300025937 Ga0207669_10011807 Ga0207669_100118073 251
354 3300025938 Ga0207704_10008820 Ga0207704_100088203 251
355 3300025938 Ga0207704_10327835 Ga0207704_103278352 251
356 3300025940 Ga0207691_10000238 Ga0207691_1000023834 251
357 3300025940 Ga0207691_10007468 Ga0207691_100074689 251
358 3300025941 Ga0207711_10088112 Ga0207711_100881122 251
359 3300025942 Ga0207689_10428688 Ga0207689_104286882 251
360 3300025945 Ga0207679_10660337 Ga0207679_106603371 251
361 3300025960 Ga0207651_10001131 Ga0207651_100011316 251
362 3300025960 Ga0207651_10015153 Ga0207651_100151533 251
363 3300025961 Ga0207712_10050049 Ga0207712_100500493 251
364 3300025961 Ga0207712_10579405 Ga0207712_105794052 251
365 3300025972 Ga0207668_10091743 Ga0207668_100917433 251
366 3300025972 Ga0207668_10117006 Ga0207668_101170062 251
367 3300025986 Ga0207658_10007911 Ga0207658_100079111 251
368 3300026023 Ga0207677_10005476 Ga0207677_100054767 251
369 3300026035 Ga0207703_10006990 Ga0207703_100069902 251
370 3300026067 Ga0207678_10087155 Ga0207678_100871552 251
371 3300026075 Ga0207708_10130782 Ga0207708_101307822 251
372 3300026088 Ga0207641_10003717 Ga0207641_100037172 251
373 3300026089 Ga0207648_10002514 Ga0207648_100025143 251
374 3300026089 Ga0207648_10003526 Ga0207648_100035262 251
375 3300026095 Ga0207676_10034951 Ga0207676_100349515 251
376 3300026095 Ga0207676_10351883 Ga0207676_103518832 251
377 3300026116 Ga0207674_10206218 Ga0207674_102062182 251
378 3300026118 Ga0207675_100001432 Ga0207675_1000014327 251
379 3300026121 Ga0207683_10013866 Ga0207683_1001386610 251
380 3300026142 Ga0207698_10039318 Ga0207698_100393183 251
381 3300026142 Ga0207698_10489061 Ga0207698_104890612 251
382 3300028379 Ga0268266_10170929 Ga0268266_101709292 251
383 3300028380 Ga0268265_10016316 Ga0268265_100163163 251
384 3300028381 Ga0268264_10050289 Ga0268264_100502893 251
385 3300037471 Ga0395905_0095975 Ga0395905_0095975_1406_2197 251
386 3300039447 Ga0436361_0595316 Ga0436361_0595316_14299_15078 251
387 3300046615 Ga0495656_0176441 Ga0495656_0176441_106_888 251
388 3300046681 Ga0495647_0005737 Ga0495647_0005737_2402_3184 251
389 3300050511 nmdc:mga08y16_571559_c1 nmdc:mga08y16_571559_c1_168_950 251
390 3300002738 JGI25154J39366_1001046 JGI25154J39366_10010463 252
391 3300021361 Ga0213872_10000157 Ga0213872_1000015714 252
392 3300025246 Ga0209646_1000049 Ga0209646_1000049203 252
393 3300025250 Ga0209026_1026569 Ga0209026_10265691 252
394 3300039447 Ga0436361_0535327 Ga0436361_0535327_2890_3678 252
395 3300039447 Ga0436361_0537843 Ga0436361_0537843_621_1409 252
396 3300039447 Ga0436361_0883268 Ga0436361_0883268_1754_2542 252
397 3300045976 Ga0466967_0710675 Ga0466967_0710675_43_855 252
398 3300046457 Ga0495590_0000016 Ga0495590_0000016_41346_42128 252
399 3300046460 Ga0495638_0000057 Ga0495638_0000057_153011_153793 252
400 3300046471 Ga0495650_0001664 Ga0495650_0001664_10675_11457 252
401 3300046501 Ga0495607_0001955 Ga0495607_0001955_4742_5524 252
402 3300046506 Ga0495583_0000178 Ga0495583_0000178_42349_43131 252
403 3300046507 Ga0495606_0000058 Ga0495606_0000058_151979_152761 252
404 3300046507 Ga0495606_0000066 Ga0495606_0000066_172060_172842 252
405 3300046522 Ga0495643_0000491 Ga0495643_0000491_10723_11505 252
406 3300046524 Ga0495648_0000002 Ga0495648_0000002_550657_551439 252
407 3300046528 Ga0495642_0003031 Ga0495642_0003031_1962_2744 252
408 3300046538 Ga0495609_0026773 Ga0495609_0026773_605_1387 252
409 3300046542 Ga0495597_0000294 Ga0495597_0000294_10765_11547 252
410 3300046557 Ga0495622_0000155 Ga0495622_0000155_35103_35885 252
411 3300046557 Ga0495622_0000344 Ga0495622_0000344_25737_26519 252
412 3300046558 Ga0495633_0001220 Ga0495633_0001220_6745_7527 252
413 3300046616 Ga0495668_0000495 Ga0495668_0000495_36109_36891 252
414 3300046660 Ga0495625_0000622 Ga0495625_0000622_37388_38170 252
415 3300046810 Ga0495660_0004214 Ga0495660_0004214_5917_6699 252
416 3300047443 Ga0495687_000209 Ga0495687_000209_23604_24386 252
417 3300047443 Ga0495687_000623 Ga0495687_000623_23511_24293 252
418 3300048090 Ga0495615_0018623 Ga0495615_0018623_136_918 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00950

ABC-3

ABC 3 transport family

7

156

0.92

PF00950

ABC-3

ABC 3 transport family

154

248

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.619 1 242
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.6172 10 243
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5957 1 242
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5748 10 243
4x8k-assembly1.cif.gz_A mycobacterium tuberculosis rbpa-sid in complex with sigmaa domain 2 0.3953 135 239
ID Description Score Start End Superfamily
af_O86339_1_133_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8056 135 239 1.10.1760.20
af_O86339_1_133_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6496 135 239 1.10.1760.20
af_Q2G2D9_6_271_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6116 10 239 1.10.3470.10
af_P39832_7_260_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.5976 13 245 1.10.3470.10
af_P0A0J0_129_207_1.20.120.1810 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5907 182 245 1.20.120.1810
ID Description Score Start End GO Terms
AF-A0A3B9L8W4-F1-model_v4 Zinc/manganese transporter permease 0.8919 120 239 GO:0010043
GO:0043190
GO:0055085
AF-A0A7X9DGB3-F1-model_v4 Metal ABC transporter permease 0.8699 157 239 GO:0043190
GO:0055085
AF-A0A3B9L8W4-F1-model_v4 Zinc/manganese transporter permease 0.8656 120 239 GO:0010043
GO:0043190
GO:0055085
AF-J9UPL2-F1-model_v4 ABC 3 transport family protein 0.831 88 239 GO:0010043
GO:0043190
GO:0055085
AF-A0A7X9DGB3-F1-model_v4 Metal ABC transporter permease 0.8174 157 239 GO:0043190
GO:0055085

Feature Viewer

pLDDT pTM Quality
80.36 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map