F439353

General Info

Members Datasets Scaffolds Average Seq Length
418 272 836 139

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0119885|Ga0466965_0119885_252_740
Length 162
Sequence MIPAAASRLFPAGSRPPERPAEENAMSVQLNPYLNFRNNTREAMEFYASVFGGTLSISTFKEFQASSDPSEDDLVMHSQLEGEHGVVFMASDTPSRMEYRPGTNFSMSLSGDDETVLRGWFDALADGGTVAMPLDKAPWGDLFGMVTDRFGVSWLVNVSPQG

Samples

Sample ID Description Type Environment
1 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
117 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
191 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
192 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
193 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
194 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
195 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
256 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
268 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere
271 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
272 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.5
Metatranscriptomes 5.26
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.7
Nodule 0
Rhizoplane 5.5
Rhizosphere 86.84
Stem 0
Stem Tuber 0
Unclassified 10.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466965_0119885 3300044683 Bacteria 1358
2 Ga0058861_10579025 3300004800 Bacteria 790
3 Ga0058861_12032931 3300004800 Bacteria 659
4 Ga0058862_12539098 3300004803 Bacteria 707
5 Ga0065707_10103324 3300005295 Bacteria 2755
6 Ga0070658_10168667 3300005327 Bacteria 1838
7 Ga0070676_10281047 3300005328 Bacteria 1122
8 Ga0070683_100165855 3300005329 Bacteria 2096
9 Ga0070690_100055947 3300005330 Bacteria 2528
10 Ga0070690_100204418 3300005330 Bacteria 1376
11 Ga0068869_100239307 3300005334 Bacteria 1446
12 Ga0070666_10328582 3300005335 Bacteria 1092
13 Ga0070680_100626226 3300005336 Bacteria 924
14 Ga0070682_100253349 3300005337 Unclassified 1270
15 Ga0070682_100359934 3300005337 Bacteria 1088
16 Ga0070682_101526357 3300005337 Bacteria 575
17 Ga0068868_100004201 3300005338 Bacteria 10070
18 Ga0068868_100196717 3300005338 Unclassified 1679
19 Ga0070660_100019406 3300005339 Bacteria 4982
20 Ga0070660_100177044 3300005339 Unclassified 1725
21 Ga0070689_100004295 3300005340 Bacteria 9615
22 Ga0070689_100477105 3300005340 Bacteria 1065
23 Ga0070691_10377521 3300005341 Bacteria 793
24 Ga0070687_100259714 3300005343 Bacteria 1083
25 Ga0070661_100261293 3300005344 Bacteria 1339
26 Ga0070661_100704629 3300005344 Bacteria 823
27 Ga0070692_10029490 3300005345 Bacteria 2735
28 Ga0070692_10246462 3300005345 Bacteria 1067
29 Ga0070668_100010675 3300005347 Bacteria 6829
30 Ga0070669_100835484 3300005353 Bacteria 784
31 Ga0070675_100043580 3300005354 Unclassified 3667
32 Ga0070675_100098902 3300005354 Bacteria 2455
33 Ga0070675_100121398 3300005354 Unclassified 2220
34 Ga0070671_100052988 3300005355 Bacteria 3373
35 Ga0070671_100153654 3300005355 Bacteria 1944
36 Ga0070673_100278361 3300005364 Bacteria 1467
37 Ga0070688_100003306 3300005365 Bacteria 8267
38 Ga0070688_100568229 3300005365 Bacteria 864
39 Ga0070688_101074848 3300005365 Bacteria 642
40 Ga0070659_100004783 3300005366 Bacteria 9680
41 Ga0070659_100242351 3300005366 Bacteria 1492
42 Ga0070659_100245544 3300005366 Bacteria 1483
43 Ga0070703_10061748 3300005406 Bacteria 1228
44 Ga0070709_10023305 3300005434 Bacteria 3632
45 Ga0070714_100017270 3300005435 Bacteria 5843
46 Ga0070714_100454476 3300005435 Bacteria 1217
47 Ga0070713_100381478 3300005436 Bacteria 1313
48 Ga0070713_100384248 3300005436 Bacteria 1308
49 Ga0070713_100834031 3300005436 Bacteria 885
50 Ga0070710_10073671 3300005437 Bacteria 1975
51 Ga0070701_10587631 3300005438 Bacteria 736
52 Ga0070711_100049479 3300005439 Bacteria 2878
53 Ga0070705_100041263 3300005440 Bacteria 2630
54 Ga0070700_100115490 3300005441 Bacteria 1791
55 Ga0070694_100133927 3300005444 Bacteria 1794
56 Ga0070663_100031467 3300005455 Bacteria 3646
57 Ga0070663_100155940 3300005455 Bacteria 1754
58 Ga0070678_100043697 3300005456 Bacteria 3194
59 Ga0070662_100214604 3300005457 Bacteria 1533
60 Ga0068867_100170167 3300005459 Unclassified 1725
61 Ga0070699_100245609 3300005518 Bacteria 1599
62 Ga0070679_100389662 3300005530 Bacteria 1339
63 Ga0070679_100635738 3300005530 Bacteria 1010
64 Ga0070684_100270204 3300005535 Bacteria 1556
65 Ga0070684_101094032 3300005535 Bacteria 749
66 Ga0068853_100057179 3300005539 Bacteria 3365
67 Ga0070672_100223517 3300005543 Bacteria 1580
68 Ga0070672_100727518 3300005543 Bacteria 870
69 Ga0070686_100004764 3300005544 Bacteria 7485
70 Ga0070695_100383178 3300005545 Bacteria 1061
71 Ga0070696_100122764 3300005546 Bacteria 1881
72 Ga0070693_100027511 3300005547 Bacteria 3083
73 Ga0070665_100331452 3300005548 Bacteria 1526
74 Ga0070704_100189916 3300005549 Bacteria 1650
75 Ga0070704_100663552 3300005549 Bacteria 922
76 Ga0068855_100006713 3300005563 Bacteria 13966
77 Ga0070664_100982403 3300005564 Bacteria 793
78 Ga0070664_102040924 3300005564 Bacteria 544
79 Ga0068857_100430342 3300005577 Bacteria 1231
80 Ga0068854_100044646 3300005578 Bacteria 3147
81 Ga0068854_101380379 3300005578 Bacteria 636
82 Ga0068856_100427612 3300005614 Bacteria 1344
83 Ga0070702_100139081 3300005615 Bacteria 1544
84 Ga0068852_100974004 3300005616 Bacteria 866
85 Ga0068852_100984886 3300005616 Bacteria 862
86 Ga0068859_100019914 3300005617 Bacteria 6736
87 Ga0068859_100135454 3300005617 Bacteria 2536
88 Ga0068864_100045297 3300005618 Bacteria 3773
89 Ga0068864_100174694 3300005618 Bacteria 1960
90 Ga0068864_101157208 3300005618 Bacteria 771
91 Ga0068866_10671139 3300005718 Bacteria 708
92 Ga0068861_100077864 3300005719 Bacteria 2588
93 Ga0068861_100346076 3300005719 Unclassified 1302
94 Ga0068861_101146827 3300005719 Bacteria 749
95 Ga0068851_10538287 3300005834 Bacteria 704
96 Ga0068863_100203172 3300005841 Bacteria 1907
97 Ga0068863_100269611 3300005841 Bacteria 1647
98 Ga0068858_100020503 3300005842 Bacteria 6178
99 Ga0068860_100408975 3300005843 Bacteria 1343
100 Ga0068862_100165308 3300005844 Unclassified 1978
101 Ga0068862_100450835 3300005844 Bacteria 1213
102 Ga0068862_100541723 3300005844 Bacteria 1110
103 Ga0081455_10000680 3300005937 Bacteria 44122
104 Ga0081455_10001930 3300005937 Bacteria 24900
105 Ga0081455_10016693 3300005937 Bacteria 7073
106 Ga0081538_10264068 3300005981 Unclassified 648
107 Ga0081539_10014631 3300005985 Bacteria 5780
108 Ga0081539_10481488 3300005985 Bacteria 514
109 Ga0070717_10499288 3300006028 Bacteria 1099
110 Ga0075365_10124092 3300006038 Bacteria 1783
111 Ga0075365_10742593 3300006038 Bacteria 693
112 Ga0075368_10000128 3300006042 Bacteria 20142
113 Ga0075363_100004663 3300006048 Bacteria 6028
114 Ga0075364_10016984 3300006051 Bacteria 4536
115 Ga0070715_10007537 3300006163 Bacteria 3752
116 Ga0070715_10010737 3300006163 Bacteria 3273
117 Ga0070716_100021433 3300006173 Bacteria 3405
118 Ga0075362_10041761 3300006177 Bacteria 2024
119 Ga0075367_10029095 3300006178 Bacteria 3157
120 Ga0075369_10006153 3300006186 Bacteria 4528
121 Ga0075366_10256827 3300006195 Bacteria 1066
122 Ga0097621_100083506 3300006237 Bacteria 2662
123 Ga0075370_10007286 3300006353 Bacteria 5632
124 Ga0075370_10112680 3300006353 Bacteria 1580
125 Ga0068871_100078063 3300006358 Bacteria 2737
126 Ga0075428_100979924 3300006844 Unclassified 895
127 Ga0075433_10008524 3300006852 Bacteria 8177
128 Ga0075434_100005251 3300006871 Bacteria 11770
129 Ga0075434_100063895 3300006871 Bacteria 3664
130 Ga0068865_100414254 3300006881 Unclassified 1106
131 Ga0068865_100972554 3300006881 Bacteria 742
132 Ga0075436_100066067 3300006914 Bacteria 2500
133 Ga0097620_100019914 3300006931 Bacteria 6736
134 Ga0097620_100135452 3300006931 Bacteria 2536
135 Ga0075435_100076768 3300007076 Bacteria 2738
136 Ga0105251_10033204 3300009011 Bacteria 2564
137 Ga0105240_10789945 3300009093 Bacteria 1029
138 Ga0105240_11493509 3300009093 Bacteria 709
139 Ga0111539_12877124 3300009094 Unclassified 557
140 Ga0105245_10046448 3300009098 Unclassified 3881
141 Ga0105245_10050275 3300009098 Bacteria 3735
142 Ga0105245_10126147 3300009098 Bacteria 2397
143 Ga0105245_10794690 3300009098 Unclassified 984
144 Ga0105245_12149062 3300009098 Bacteria 612
145 Ga0105247_10255923 3300009101 Bacteria 1199
146 Ga0114129_11662494 3300009147 Unclassified 780
147 Ga0105241_10710095 3300009174 Bacteria 919
148 Ga0105248_11091724 3300009177 Bacteria 902
149 Ga0105237_10124235 3300009545 Bacteria 2575
150 Ga0105238_10549306 3300009551 Bacteria 1159
151 Ga0105249_10069273 3300009553 Bacteria 3256
152 Ga0105249_10080652 3300009553 Bacteria 3024
153 Ga0105249_10211819 3300009553 Unclassified 1902
154 Ga0105239_10607979 3300010375 Bacteria 1247
155 Ga0105239_11509049 3300010375 Unclassified 777
156 Ga0154012_103949 3300013059 Bacteria 502
157 Ga0157373_10522076 3300013100 Bacteria 859
158 Ga0157373_11337050 3300013100 Unclassified 543
159 Ga0157370_11236350 3300013104 Bacteria 673
160 Ga0157372_10129794 3300013307 Bacteria 2899
161 Ga0157375_12717699 3300013308 Bacteria 592
162 Ga0163163_10214696 3300014325 Bacteria 1973
163 Ga0163163_11636901 3300014325 Bacteria 705
164 Ga0157380_10148353 3300014326 Bacteria 2024
165 Ga0157380_11206745 3300014326 Unclassified 800
166 Ga0157379_10237308 3300014968 Bacteria 1653
167 Ga0163161_10012425 3300017792 Bacteria 5912
168 Ga0197907_10427092 3300020069 Bacteria 857
169 Ga0197907_10839235 3300020069 Bacteria 743
170 Ga0206356_10937008 3300020070 Bacteria 721
171 Ga0206356_11246495 3300020070 Unclassified 1465
172 Ga0206349_1450896 3300020075 Bacteria 846
173 Ga0206349_1701448 3300020075 Unclassified 855
174 Ga0206355_1562593 3300020076 Bacteria 549
175 Ga0206351_10631673 3300020077 Bacteria 602
176 Ga0206352_10212396 3300020078 Bacteria 516
177 Ga0206352_10846361 3300020078 Bacteria 642
178 Ga0206350_10056094 3300020080 Bacteria 1115
179 Ga0206350_10585588 3300020080 Unclassified 1258
180 Ga0206354_10339703 3300020081 Bacteria 933
181 Ga0206354_10760788 3300020081 Bacteria 724
182 Ga0206353_11320043 3300020082 Bacteria 1096
183 Ga0213875_10435288 3300021388 Bacteria 627
184 Ga0224712_10215086 3300022467 Bacteria 878
185 Ga0224712_10262755 3300022467 Bacteria 800
186 Ga0224712_10284757 3300022467 Bacteria 770
187 Ga0207692_10132951 3300025898 Bacteria 1407
188 Ga0207688_10005065 3300025901 Bacteria 7168
189 Ga0207688_10062784 3300025901 Bacteria 2094
190 Ga0207680_10008204 3300025903 Bacteria 5120
191 Ga0207647_10051256 3300025904 Bacteria 2552
192 Ga0207685_10011800 3300025905 Bacteria 2642
193 Ga0207699_10063608 3300025906 Bacteria 2229
194 Ga0207705_10229230 3300025909 Bacteria 1412
195 Ga0207654_11058608 3300025911 Bacteria 591
196 Ga0207695_10265818 3300025913 Bacteria 1612
197 Ga0207695_11080200 3300025913 Bacteria 682
198 Ga0207693_10045363 3300025915 Bacteria 3454
199 Ga0207663_10040599 3300025916 Bacteria 2830
200 Ga0207660_10565524 3300025917 Bacteria 925
201 Ga0207662_10051501 3300025918 Bacteria 2450
202 Ga0207657_10019794 3300025919 Bacteria 6380
203 Ga0207649_10249639 3300025920 Bacteria 1277
204 Ga0207646_10152120 3300025922 Bacteria 2087
205 Ga0207681_10288911 3300025923 Bacteria 1294
206 Ga0207681_10678085 3300025923 Bacteria 856
207 Ga0207694_10414704 3300025924 Bacteria 1121
208 Ga0207650_10048505 3300025925 Unclassified 3132
209 Ga0207659_10037359 3300025926 Unclassified 3371
210 Ga0207659_10359268 3300025926 Bacteria 1210
211 Ga0207687_10099413 3300025927 Bacteria 2138
212 Ga0207700_11455963 3300025928 Bacteria 608
213 Ga0207700_11524196 3300025928 Bacteria 593
214 Ga0207644_10019897 3300025931 Bacteria 4559
215 Ga0207644_10679328 3300025931 Bacteria 858
216 Ga0207690_10535707 3300025932 Bacteria 950
217 Ga0207690_10673744 3300025932 Bacteria 849
218 Ga0207706_10011046 3300025933 Bacteria 8230
219 Ga0207686_10159237 3300025934 Unclassified 1580
220 Ga0207709_10135076 3300025935 Bacteria 1687
221 Ga0207709_10285290 3300025935 Unclassified 1221
222 Ga0207670_10010451 3300025936 Bacteria 5350
223 Ga0207670_10051455 3300025936 Bacteria 2766
224 Ga0207669_10380396 3300025937 Bacteria 1100
225 Ga0207704_10016367 3300025938 Bacteria 3809
226 Ga0207665_10000995 3300025939 Bacteria 19125
227 Ga0207691_10039388 3300025940 Bacteria 4372
228 Ga0207689_10030286 3300025942 Bacteria 4510
229 Ga0207661_10149217 3300025944 Bacteria 2020
230 Ga0207679_10386005 3300025945 Bacteria 1229
231 Ga0207679_11251480 3300025945 Bacteria 681
232 Ga0207667_10583286 3300025949 Bacteria 1128
233 Ga0207651_10844129 3300025960 Unclassified 814
234 Ga0207712_10019032 3300025961 Bacteria 4480
235 Ga0207712_10064491 3300025961 Bacteria 2612
236 Ga0207712_10325412 3300025961 Unclassified 1270
237 Ga0207668_10455696 3300025972 Bacteria 1092
238 Ga0207640_10014971 3300025981 Bacteria 4477
239 Ga0207640_11394820 3300025981 Bacteria 628
240 Ga0207658_10118695 3300025986 Bacteria 2105
241 Ga0207658_10574201 3300025986 Unclassified 1011
242 Ga0207677_10209244 3300026023 Bacteria 1556
243 Ga0207677_11228090 3300026023 Unclassified 687
244 Ga0207703_10316269 3300026035 Bacteria 1428
245 Ga0207703_11158543 3300026035 Bacteria 743
246 Ga0207639_10105361 3300026041 Bacteria 2288
247 Ga0207639_11288176 3300026041 Bacteria 686
248 Ga0207678_10029226 3300026067 Bacteria 4809
249 Ga0207678_10070767 3300026067 Bacteria 2991
250 Ga0207708_10279508 3300026075 Bacteria 1352
251 Ga0207702_10493955 3300026078 Bacteria 1192
252 Ga0207641_10271293 3300026088 Bacteria 1592
253 Ga0207641_11152027 3300026088 Bacteria 774
254 Ga0207648_11012587 3300026089 Bacteria 778
255 Ga0207674_10460137 3300026116 Bacteria 1229
256 Ga0207675_100006331 3300026118 Bacteria 11226
257 Ga0207675_100282828 3300026118 Bacteria 1612
258 Ga0207675_100496561 3300026118 Unclassified 1214
259 Ga0207683_10050623 3300026121 Bacteria 3639
260 Ga0207698_10331667 3300026142 Bacteria 1429
261 Ga0209813_10000234 3300027866 Bacteria 16776
262 Ga0268266_10732977 3300028379 Bacteria 953
263 Ga0268265_10246867 3300028380 Bacteria 1579
264 Ga0268265_10585115 3300028380 Unclassified 1064
265 Ga0268264_10478044 3300028381 Bacteria 1211
266 Ga0307408_100381595 3300031548 Bacteria 1205
267 Ga0307413_10965803 3300031824 Bacteria 728
268 Ga0307410_10061751 3300031852 Bacteria 2565
269 Ga0307410_10351449 3300031852 Bacteria 1178
270 Ga0307406_10872973 3300031901 Bacteria 764
271 Ga0307409_100016525 3300031995 Bacteria 4885
272 Ga0307409_100537673 3300031995 Bacteria 1145
273 Ga0307409_100609791 3300031995 Unclassified 1080
274 Ga0307416_100194512 3300032002 Unclassified 1917
275 Ga0307416_100571334 3300032002 Unclassified 1207
276 Ga0307416_102026953 3300032002 Bacteria 678
277 Ga0307414_10396120 3300032004 Bacteria 1198
278 Ga0307411_11401400 3300032005 Bacteria 640
279 Ga0307415_100218915 3300032126 Bacteria 1525
280 Ga0307415_100918915 3300032126 Bacteria 808
281 Ga0373958_0191601 3300034819 Bacteria 531
282 Ga0373928_0103139 3300035084 Bacteria 746
283 Ga0373940_0019085 3300035088 Bacteria 1728
284 Ga0373951_0002134 3300035091 Bacteria 5048
285 Ga0373932_0008576 3300035112 Bacteria 2445
286 Ga0373939_0009288 3300035114 Bacteria 2435
287 Ga0373960_0061644 3300035121 Bacteria 1139
288 Ga0373955_0203404 3300035172 Unclassified 1179
289 Ga0373961_0240139 3300035241 Bacteria 652
290 Ga0373962_0067177 3300035242 Bacteria 1064
291 Ga0373931_0524891 3300035691 Bacteria 766
292 Ga0373925_1185554 3300037068 Bacteria 628
293 Ga0395899_0368109 3300037312 Bacteria 958
294 Ga0395900_0011373 3300037418 Bacteria 9107
295 Ga0395900_0040672 3300037418 Bacteria 4791
296 Ga0395900_0157389 3300037418 Bacteria 2320
297 Ga0395900_1677667 3300037418 Bacteria 546
298 Ga0395898_0031166 3300037466 Bacteria 5331
299 Ga0395898_0317813 3300037466 Bacteria 1485
300 Ga0395898_0390985 3300037466 Bacteria 1326
301 Ga0395898_0638193 3300037466 Bacteria 1007
302 Ga0395898_1842840 3300037466 Bacteria 526
303 Ga0395905_0217037 3300037471 Bacteria 1791
304 Ga0436364_0218440 3300037853 Bacteria 832
305 Ga0395901_0030475 3300038443 Bacteria 5557
306 Ga0395901_0163854 3300038443 Bacteria 2334
307 Ga0395901_0455555 3300038443 Bacteria 1308
308 Ga0395901_0665036 3300038443 Bacteria 1043
309 Ga0436365_0698165 3300039437 Bacteria 835
310 Ga0451853_4024474 3300041512 Bacteria 1209
311 Ga0466969_0190507 3300044656 Bacteria 937
312 Ga0466965_0230712 3300044683 Bacteria 989
313 Ga0466965_0406635 3300044683 Bacteria 753
314 Ga0466965_0659193 3300044683 Bacteria 598
315 Ga0466966_0143084 3300044684 Bacteria 1460
316 Ga0466966_0153634 3300044684 Bacteria 1403
317 Ga0466966_0178922 3300044684 Bacteria 1287
318 Ga0466961_0036158 3300044693 Bacteria 3170
319 Ga0466961_0045269 3300044693 Bacteria 2815
320 Ga0466961_0058621 3300044693 Bacteria 2449
321 Ga0466961_0072152 3300044693 Bacteria 2190
322 Ga0466961_0235886 3300044693 Bacteria 1125
323 Ga0466961_0471621 3300044693 Bacteria 759
324 Ga0466961_0946678 3300044693 Bacteria 512
325 Ga0466963_0140031 3300044694 Bacteria 1675
326 Ga0466963_0172695 3300044694 Bacteria 1507
327 Ga0466963_0334760 3300044694 Bacteria 1066
328 Ga0466963_1215639 3300044694 Bacteria 529
329 Ga0466964_0046098 3300044706 Bacteria 1776
330 Ga0466964_0443307 3300044706 Bacteria 687
331 Ga0466971_0030529 3300044719 Bacteria 2411
332 Ga0466971_0089897 3300044719 Bacteria 1406
333 Ga0466970_0022062 3300044765 Bacteria 3323
334 Ga0466970_0069505 3300044765 Bacteria 1893
335 Ga0466970_0103424 3300044765 Bacteria 1552
336 Ga0466957_0228369 3300044842 Bacteria 1231
337 Ga0466957_0317075 3300044842 Bacteria 1051
338 Ga0466957_1046280 3300044842 Bacteria 587
339 Ga0466960_0115927 3300044901 Bacteria 1397
340 Ga0466960_0326088 3300044901 Bacteria 871
341 Ga0466959_0039695 3300045049 Bacteria 3479
342 Ga0466959_0130022 3300045049 Bacteria 1785
343 Ga0466959_0159535 3300045049 Bacteria 1586
344 Ga0466959_0225261 3300045049 Bacteria 1299
345 Ga0466959_0671447 3300045049 Bacteria 695
346 Ga0466959_0753475 3300045049 Unclassified 652
347 Ga0466958_0167568 3300045836 Bacteria 1390
348 Ga0466958_0210727 3300045836 Bacteria 1238
349 Ga0466967_0173088 3300045976 Bacteria 2032
350 Ga0466967_0332165 3300045976 Bacteria 1468
351 Ga0495603_0012741 3300046455 Bacteria 5087
352 Ga0495582_0144304 3300046473 Bacteria 1350
353 Ga0495662_0047033 3300046476 Bacteria 2083
354 Ga0495664_0002026 3300046477 Bacteria 10827
355 Ga0495584_0254921 3300046491 Bacteria 892
356 Ga0495630_0450312 3300046517 Bacteria 986
357 Ga0495665_0198617 3300046531 Bacteria 1040
358 Ga0495586_0050532 3300046535 Bacteria 2250
359 Ga0495587_0008684 3300046536 Bacteria 6524
360 Ga0495645_0129421 3300046543 Bacteria 1770
361 Ga0495622_0487970 3300046557 Bacteria 527
362 Ga0495667_0002089 3300046559 Bacteria 13278
363 Ga0495657_0443579 3300046675 Bacteria 760
364 Ga0495647_0536086 3300046681 Bacteria 547
365 Ga0495613_0356425 3300046689 Bacteria 1004
366 Ga0495613_0804262 3300046689 Bacteria 613
367 Ga0495624_0208311 3300046690 Bacteria 1186
368 Ga0495676_0087984 3300047321 Bacteria 2332
369 Ga0495684_0023836 3300047471 Bacteria 4706
370 Ga0495593_0174614 3300047673 Bacteria 1082
371 Ga0496101_0023602 3300048904 Bacteria 4251
372 Ga0496101_0841185 3300048904 Bacteria 723
373 Ga0496102_0453847 3300048905 Bacteria 1202
374 Ga0496102_0485481 3300048905 Bacteria 1157
375 Ga0496103_0227690 3300048906 Bacteria 1199
376 Ga0496104_0045168 3300048907 Bacteria 4142
377 Ga0496105_0006707 3300048908 Bacteria 8861
378 Ga0496106_0036299 3300048909 Bacteria 3687
379 Ga0496106_0308132 3300048909 Bacteria 1270
380 Ga0496107_0105779 3300048910 Bacteria 2066
381 Ga0496107_0557778 3300048910 Bacteria 848
382 Ga0496107_1006452 3300048910 Bacteria 605
383 Ga0496108_0012215 3300048911 Bacteria 6986
384 Ga0496109_0005937 3300048912 Bacteria 10247
385 Ga0496109_0136183 3300048912 Bacteria 2295
386 Ga0496110_0031258 3300048913 Bacteria 4593
387 Ga0496110_0084030 3300048913 Bacteria 2841
388 Ga0496110_0324811 3300048913 Bacteria 1402
389 Ga0496111_0962056 3300048914 Bacteria 613
390 Ga0496112_0124557 3300048915 Bacteria 2548
391 Ga0496112_0773370 3300048915 Bacteria 886
392 Ga0496113_0053587 3300048916 Bacteria 3016
393 Ga0496115_0428172 3300048918 Bacteria 1071
394 nmdc:mga03683_176106_c1 3300050489 Unclassified 974
395 nmdc:mga03683_4965_c1 3300050489 Bacteria 4451
396 nmdc:mga03n38_7761_c1 3300050490 Bacteria 3808
397 nmdc:mga00v17_101_c1 3300050491 Bacteria 50798
398 nmdc:mga0yw44_145888_c1 3300050492 Unclassified 1541
399 nmdc:mga0yw44_6_c1 3300050492 Bacteria 272478
400 nmdc:mga0k408_746207_c1 3300050493 Bacteria 572
401 nmdc:mga0k408_823215_c1 3300050493 Bacteria 540
402 nmdc:mga06z11_1523_c1 3300050494 Bacteria 8594
403 nmdc:mga04h51_219_c1 3300050495 Bacteria 15308
404 nmdc:mga07m45_144693_c1 3300050496 Bacteria 1378
405 nmdc:mga0n895_28425_c1 3300050512 Bacteria 5318
406 nmdc:mga0n895_648360_c1 3300050512 Bacteria 1055
407 nmdc:mga0rr50_149343_c1 3300050513 Bacteria 1887
408 nmdc:mga0rr50_389803_c1 3300050513 Bacteria 1175
409 nmdc:mga0a205_12291_c1 3300050515 Bacteria 7919
410 nmdc:mga0a205_630490_c1 3300050515 Bacteria 924
411 nmdc:mga0sz30_2529_c1 3300050516 Bacteria 6516
412 Ga0500583_0018512 3300053092 Unclassified 2834
413 Ga0500593_155716 3300053117 Bacteria 880
414 Ga0500616_0135245 3300053153 Unclassified 1159
415 Ga0500613_000845 3300053738 Unclassified 1895
416 Ga0466962_0033134 3300061719 Bacteria 2471
417 Ga0466962_0261909 3300061719 Bacteria 851
418 8004023089 8004021418 Bacteria 4313954
419 Ga0466965_0119885
420 Ga0058861_10579025
421 Ga0058861_12032931
422 Ga0058862_12539098
423 Ga0065707_10103324
424 Ga0070658_10168667
425 Ga0070676_10281047
426 Ga0070683_100165855
427 Ga0070690_100055947
428 Ga0070690_100204418
429 Ga0068869_100239307
430 Ga0070666_10328582
431 Ga0070680_100626226
432 Ga0070682_100253349
433 Ga0070682_100359934
434 Ga0070682_101526357
435 Ga0068868_100004201
436 Ga0068868_100196717
437 Ga0070660_100019406
438 Ga0070660_100177044
439 Ga0070689_100004295
440 Ga0070689_100477105
441 Ga0070691_10377521
442 Ga0070687_100259714
443 Ga0070661_100261293
444 Ga0070661_100704629
445 Ga0070692_10029490
446 Ga0070692_10246462
447 Ga0070668_100010675
448 Ga0070669_100835484
449 Ga0070675_100043580
450 Ga0070675_100098902
451 Ga0070675_100121398
452 Ga0070671_100052988
453 Ga0070671_100153654
454 Ga0070673_100278361
455 Ga0070688_100003306
456 Ga0070688_100568229
457 Ga0070688_101074848
458 Ga0070659_100004783
459 Ga0070659_100242351
460 Ga0070659_100245544
461 Ga0070703_10061748
462 Ga0070709_10023305
463 Ga0070714_100017270
464 Ga0070714_100454476
465 Ga0070713_100381478
466 Ga0070713_100384248
467 Ga0070713_100834031
468 Ga0070710_10073671
469 Ga0070701_10587631
470 Ga0070711_100049479
471 Ga0070705_100041263
472 Ga0070700_100115490
473 Ga0070694_100133927
474 Ga0070663_100031467
475 Ga0070663_100155940
476 Ga0070678_100043697
477 Ga0070662_100214604
478 Ga0068867_100170167
479 Ga0070699_100245609
480 Ga0070679_100389662
481 Ga0070679_100635738
482 Ga0070684_100270204
483 Ga0070684_101094032
484 Ga0068853_100057179
485 Ga0070672_100223517
486 Ga0070672_100727518
487 Ga0070686_100004764
488 Ga0070695_100383178
489 Ga0070696_100122764
490 Ga0070693_100027511
491 Ga0070665_100331452
492 Ga0070704_100189916
493 Ga0070704_100663552
494 Ga0068855_100006713
495 Ga0070664_100982403
496 Ga0070664_102040924
497 Ga0068857_100430342
498 Ga0068854_100044646
499 Ga0068854_101380379
500 Ga0068856_100427612
501 Ga0070702_100139081
502 Ga0068852_100974004
503 Ga0068852_100984886
504 Ga0068859_100019914
505 Ga0068859_100135454
506 Ga0068864_100045297
507 Ga0068864_100174694
508 Ga0068864_101157208
509 Ga0068866_10671139
510 Ga0068861_100077864
511 Ga0068861_100346076
512 Ga0068861_101146827
513 Ga0068851_10538287
514 Ga0068863_100203172
515 Ga0068863_100269611
516 Ga0068858_100020503
517 Ga0068860_100408975
518 Ga0068862_100165308
519 Ga0068862_100450835
520 Ga0068862_100541723
521 Ga0081455_10000680
522 Ga0081455_10001930
523 Ga0081455_10016693
524 Ga0081538_10264068
525 Ga0081539_10014631
526 Ga0081539_10481488
527 Ga0070717_10499288
528 Ga0075365_10124092
529 Ga0075365_10742593
530 Ga0075368_10000128
531 Ga0075363_100004663
532 Ga0075364_10016984
533 Ga0070715_10007537
534 Ga0070715_10010737
535 Ga0070716_100021433
536 Ga0075362_10041761
537 Ga0075367_10029095
538 Ga0075369_10006153
539 Ga0075366_10256827
540 Ga0097621_100083506
541 Ga0075370_10007286
542 Ga0075370_10112680
543 Ga0068871_100078063
544 Ga0075428_100979924
545 Ga0075433_10008524
546 Ga0075434_100005251
547 Ga0075434_100063895
548 Ga0068865_100414254
549 Ga0068865_100972554
550 Ga0075436_100066067
551 Ga0097620_100019914
552 Ga0097620_100135452
553 Ga0075435_100076768
554 Ga0105251_10033204
555 Ga0105240_10789945
556 Ga0105240_11493509
557 Ga0111539_12877124
558 Ga0105245_10046448
559 Ga0105245_10050275
560 Ga0105245_10126147
561 Ga0105245_10794690
562 Ga0105245_12149062
563 Ga0105247_10255923
564 Ga0114129_11662494
565 Ga0105241_10710095
566 Ga0105248_11091724
567 Ga0105237_10124235
568 Ga0105238_10549306
569 Ga0105249_10069273
570 Ga0105249_10080652
571 Ga0105249_10211819
572 Ga0105239_10607979
573 Ga0105239_11509049
574 Ga0154012_103949
575 Ga0157373_10522076
576 Ga0157373_11337050
577 Ga0157370_11236350
578 Ga0157372_10129794
579 Ga0157375_12717699
580 Ga0163163_10214696
581 Ga0163163_11636901
582 Ga0157380_10148353
583 Ga0157380_11206745
584 Ga0157379_10237308
585 Ga0163161_10012425
586 Ga0197907_10427092
587 Ga0197907_10839235
588 Ga0206356_10937008
589 Ga0206356_11246495
590 Ga0206349_1450896
591 Ga0206349_1701448
592 Ga0206355_1562593
593 Ga0206351_10631673
594 Ga0206352_10212396
595 Ga0206352_10846361
596 Ga0206350_10056094
597 Ga0206350_10585588
598 Ga0206354_10339703
599 Ga0206354_10760788
600 Ga0206353_11320043
601 Ga0213875_10435288
602 Ga0224712_10215086
603 Ga0224712_10262755
604 Ga0224712_10284757
605 Ga0207692_10132951
606 Ga0207688_10005065
607 Ga0207688_10062784
608 Ga0207680_10008204
609 Ga0207647_10051256
610 Ga0207685_10011800
611 Ga0207699_10063608
612 Ga0207705_10229230
613 Ga0207654_11058608
614 Ga0207695_10265818
615 Ga0207695_11080200
616 Ga0207693_10045363
617 Ga0207663_10040599
618 Ga0207660_10565524
619 Ga0207662_10051501
620 Ga0207657_10019794
621 Ga0207649_10249639
622 Ga0207646_10152120
623 Ga0207681_10288911
624 Ga0207681_10678085
625 Ga0207694_10414704
626 Ga0207650_10048505
627 Ga0207659_10037359
628 Ga0207659_10359268
629 Ga0207687_10099413
630 Ga0207700_11455963
631 Ga0207700_11524196
632 Ga0207644_10019897
633 Ga0207644_10679328
634 Ga0207690_10535707
635 Ga0207690_10673744
636 Ga0207706_10011046
637 Ga0207686_10159237
638 Ga0207709_10135076
639 Ga0207709_10285290
640 Ga0207670_10010451
641 Ga0207670_10051455
642 Ga0207669_10380396
643 Ga0207704_10016367
644 Ga0207665_10000995
645 Ga0207691_10039388
646 Ga0207689_10030286
647 Ga0207661_10149217
648 Ga0207679_10386005
649 Ga0207679_11251480
650 Ga0207667_10583286
651 Ga0207651_10844129
652 Ga0207712_10019032
653 Ga0207712_10064491
654 Ga0207712_10325412
655 Ga0207668_10455696
656 Ga0207640_10014971
657 Ga0207640_11394820
658 Ga0207658_10118695
659 Ga0207658_10574201
660 Ga0207677_10209244
661 Ga0207677_11228090
662 Ga0207703_10316269
663 Ga0207703_11158543
664 Ga0207639_10105361
665 Ga0207639_11288176
666 Ga0207678_10029226
667 Ga0207678_10070767
668 Ga0207708_10279508
669 Ga0207702_10493955
670 Ga0207641_10271293
671 Ga0207641_11152027
672 Ga0207648_11012587
673 Ga0207674_10460137
674 Ga0207675_100006331
675 Ga0207675_100282828
676 Ga0207675_100496561
677 Ga0207683_10050623
678 Ga0207698_10331667
679 Ga0209813_10000234
680 Ga0268266_10732977
681 Ga0268265_10246867
682 Ga0268265_10585115
683 Ga0268264_10478044
684 Ga0307408_100381595
685 Ga0307413_10965803
686 Ga0307410_10061751
687 Ga0307410_10351449
688 Ga0307406_10872973
689 Ga0307409_100016525
690 Ga0307409_100537673
691 Ga0307409_100609791
692 Ga0307416_100194512
693 Ga0307416_100571334
694 Ga0307416_102026953
695 Ga0307414_10396120
696 Ga0307411_11401400
697 Ga0307415_100218915
698 Ga0307415_100918915
699 Ga0373958_0191601
700 Ga0373928_0103139
701 Ga0373940_0019085
702 Ga0373951_0002134
703 Ga0373932_0008576
704 Ga0373939_0009288
705 Ga0373960_0061644
706 Ga0373955_0203404
707 Ga0373961_0240139
708 Ga0373962_0067177
709 Ga0373931_0524891
710 Ga0373925_1185554
711 Ga0395899_0368109
712 Ga0395900_0011373
713 Ga0395900_0040672
714 Ga0395900_0157389
715 Ga0395900_1677667
716 Ga0395898_0031166
717 Ga0395898_0317813
718 Ga0395898_0390985
719 Ga0395898_0638193
720 Ga0395898_1842840
721 Ga0395905_0217037
722 Ga0436364_0218440
723 Ga0395901_0030475
724 Ga0395901_0163854
725 Ga0395901_0455555
726 Ga0395901_0665036
727 Ga0436365_0698165
728 Ga0451853_4024474
729 Ga0466969_0190507
730 Ga0466965_0230712
731 Ga0466965_0406635
732 Ga0466965_0659193
733 Ga0466966_0143084
734 Ga0466966_0153634
735 Ga0466966_0178922
736 Ga0466961_0036158
737 Ga0466961_0045269
738 Ga0466961_0058621
739 Ga0466961_0072152
740 Ga0466961_0235886
741 Ga0466961_0471621
742 Ga0466961_0946678
743 Ga0466963_0140031
744 Ga0466963_0172695
745 Ga0466963_0334760
746 Ga0466963_1215639
747 Ga0466964_0046098
748 Ga0466964_0443307
749 Ga0466971_0030529
750 Ga0466971_0089897
751 Ga0466970_0022062
752 Ga0466970_0069505
753 Ga0466970_0103424
754 Ga0466957_0228369
755 Ga0466957_0317075
756 Ga0466957_1046280
757 Ga0466960_0115927
758 Ga0466960_0326088
759 Ga0466959_0039695
760 Ga0466959_0130022
761 Ga0466959_0159535
762 Ga0466959_0225261
763 Ga0466959_0671447
764 Ga0466959_0753475
765 Ga0466958_0167568
766 Ga0466958_0210727
767 Ga0466967_0173088
768 Ga0466967_0332165
769 Ga0495603_0012741
770 Ga0495582_0144304
771 Ga0495662_0047033
772 Ga0495664_0002026
773 Ga0495584_0254921
774 Ga0495630_0450312
775 Ga0495665_0198617
776 Ga0495586_0050532
777 Ga0495587_0008684
778 Ga0495645_0129421
779 Ga0495622_0487970
780 Ga0495667_0002089
781 Ga0495657_0443579
782 Ga0495647_0536086
783 Ga0495613_0356425
784 Ga0495613_0804262
785 Ga0495624_0208311
786 Ga0495676_0087984
787 Ga0495684_0023836
788 Ga0495593_0174614
789 Ga0496101_0023602
790 Ga0496101_0841185
791 Ga0496102_0453847
792 Ga0496102_0485481
793 Ga0496103_0227690
794 Ga0496104_0045168
795 Ga0496105_0006707
796 Ga0496106_0036299
797 Ga0496106_0308132
798 Ga0496107_0105779
799 Ga0496107_0557778
800 Ga0496107_1006452
801 Ga0496108_0012215
802 Ga0496109_0005937
803 Ga0496109_0136183
804 Ga0496110_0031258
805 Ga0496110_0084030
806 Ga0496110_0324811
807 Ga0496111_0962056
808 Ga0496112_0124557
809 Ga0496112_0773370
810 Ga0496113_0053587
811 Ga0496115_0428172
812 nmdc:mga03683_176106_c1
813 nmdc:mga03683_4965_c1
814 nmdc:mga03n38_7761_c1
815 nmdc:mga00v17_101_c1
816 nmdc:mga0yw44_145888_c1
817 nmdc:mga0yw44_6_c1
818 nmdc:mga0k408_746207_c1
819 nmdc:mga0k408_823215_c1
820 nmdc:mga06z11_1523_c1
821 nmdc:mga04h51_219_c1
822 nmdc:mga07m45_144693_c1
823 nmdc:mga0n895_28425_c1
824 nmdc:mga0n895_648360_c1
825 nmdc:mga0rr50_149343_c1
826 nmdc:mga0rr50_389803_c1
827 nmdc:mga0a205_12291_c1
828 nmdc:mga0a205_630490_c1
829 nmdc:mga0sz30_2529_c1
830 Ga0500583_0018512
831 Ga0500593_155716
832 Ga0500616_0135245
833 Ga0500613_000845
834 Ga0466962_0033134
835 Ga0466962_0261909
836 8004023089

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

29

156

0.93

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

28

157

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8585 2 134
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8407 2 134
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8074 3 134
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8019 3 134
3l20-assembly1.cif.gz_A crystal structure of a hypothetical protein from staphylococcus aureus 0.7887 1 138
ID Description Score Start End Superfamily
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9195 81 134 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8768 9 134 3.10.180.10
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8741 77 134 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8566 9 134 3.10.180.10
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.835 77 134 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A3N5LER3-F1-model_v4 VOC family protein 0.9809 12 138
AF-A0A4R1KN71-F1-model_v4 deleted 0.9781 1 135
AF-A0JWK3-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.9763 1 138 GO:0008168
GO:0032259
AF-A0A0S9D7Q1-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.9753 1 135 GO:0008168
GO:0032259
AF-A0A3E0VF14-F1-model_v4 PhnB-like domain-containing protein 0.9749 3 136

Map