F439311

General Info

Members Datasets Scaffolds Average Seq Length
418 290 337 313

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10004242|Ga0182008_100042426
Length 328
Sequence MSEQELRQKEIQGVHALDVVTYGEAMAMFVAEETGDLAAVAHFTRRLAGAETNVAIGLARLGLKVGWLSRVGDDSFGRFIRASVQAEGVDCSRVAAVAGQSSGFLLKEKAENGADPLVEYFRKGSAASRLAPEHFDPAYFLSARHLHATGVAAALSETSLAFAGQAIDFMREHGRTVSFDPNLRPSLWPSQAVMVEQINRLAARADWVLPGLGEGKILTGHDLPHDVAGFYLQQGARLVVIKLGAEGAYYRTADGDSGMVAGERVANVVDTVGAGDGFAAGLVSALLEGLPLAQAVRRGNRVGAFAIQVAGDMEGLPTRAQLDALGQS

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
5 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
6 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
7 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
8 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
9 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
10 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
11 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
12 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
13 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
14 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
15 2643221683 Variovorax sp. Root473 Isolate Unclassified
16 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
17 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
18 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
19 2738541277 Variovorax sp. GV051 Isolate Unclassified
20 2738541307 Variovorax sp. GV008 Isolate Unclassified
21 2738543013 Variovorax sp. BT01 Isolate Unclassified
22 2738543019 Variovorax sp. GV040 Isolate Unclassified
23 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
24 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
25 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
26 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
27 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
28 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
29 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
30 2818991446 Variovorax sp. 1180 Isolate Unclassified
31 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
32 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
33 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
34 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
35 2842747753 Variovorax sp. R-72060 Isolate Unclassified
36 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
37 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
38 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
39 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
40 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
41 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
42 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
43 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
44 2885198086 Variovorax sp. 679 Isolate Unclassified
45 2885211737 Variovorax sp. 553 Isolate Unclassified
46 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
47 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
48 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
49 2899924645 Variovorax sp. 369 Isolate Unclassified
50 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
51 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
52 2904456579 Variovorax sp. 2002 Isolate Unclassified
53 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
54 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
55 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
56 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
57 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
58 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
59 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
60 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
61 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
62 2928037797 Variovorax sp. 1126 Isolate Unclassified
63 2928044640 Variovorax sp. 1128 Isolate Unclassified
64 2928051484 Variovorax sp. 1133 Isolate Unclassified
65 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
66 2928070936 Variovorax gossypii 1167 Isolate Unclassified
67 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
68 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
69 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
70 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
71 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
72 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
73 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
74 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
75 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
76 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
77 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
78 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
79 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
80 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
81 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
82 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
83 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
84 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
85 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
86 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
87 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
88 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
89 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
90 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
91 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
92 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
93 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
94 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
95 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
96 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
97 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
98 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
99 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
100 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
101 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
102 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
103 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
104 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
105 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
106 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
107 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
108 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
109 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
110 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
111 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
112 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
113 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
116 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
117 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
118 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
119 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
122 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
123 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
124 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
125 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
126 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
143 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
144 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
145 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
148 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
149 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
150 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
157 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
159 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
160 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
161 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
164 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
165 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
174 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
177 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
202 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
217 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
218 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
219 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
220 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
221 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
222 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
223 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
224 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
230 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
231 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
232 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
233 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
243 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
244 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
245 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
246 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
247 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
248 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
256 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
259 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
260 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
261 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
275 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
278 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
279 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
280 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
283 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
284 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
285 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
286 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
287 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
288 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
289 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
290 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.38
Metatranscriptomes 0.24
Isolates 19.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.27
Nodule 1.44
Rhizoplane 1.91
Rhizosphere 48.09
Stem 0
Stem Tuber 0
Unclassified 21.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000992 3300002704 Bacteria 3251
2 JGI25155J39150_1001002 3300002704 Bacteria 3181
3 JGI25156J39149_1001523 3300002705 Bacteria 9619
4 JGI25162J39368_1005901 3300002737 Bacteria 2249
5 JGI25154J39366_1000084 3300002738 Bacteria 88167
6 JGI25154J39366_1000193 3300002738 Bacteria 44811
7 JGI25154J39366_1005995 3300002738 Bacteria 1844
8 JGI25157J39369_1000225 3300002741 Bacteria 44469
9 JGI25159J45721_1004375 3300002987 Bacteria 4704
10 JGI25159J45721_1007985 3300002987 Bacteria 2961
11 Ga0006562J51391_1107226 3300003578 Bacteria 2198
12 Ga0055538_1000050 3300003751 Bacteria 130812
13 Ga0055538_1000123 3300003751 Bacteria 58939
14 Ga0055539_1000074 3300003752 Bacteria 130812
15 Ga0055539_1000167 3300003752 Bacteria 58939
16 Ga0055533_1000081 3300003756 Bacteria 130812
17 Ga0055533_1000171 3300003756 Bacteria 58939
18 Ga0055532_1000015 3300003758 Bacteria 340197
19 Ga0055532_1000159 3300003758 Bacteria 59066
20 Ga0055525_1000108 3300003759 Bacteria 130812
21 Ga0055525_1000232 3300003759 Bacteria 58939
22 Ga0055535_1000625 3300003761 Bacteria 28582
23 Ga0055535_1002356 3300003761 Bacteria 6810
24 Ga0055535_1006426 3300003761 Bacteria 2381
25 Ga0055542_1000087 3300003762 Bacteria 123666
26 Ga0055537_1011909 3300003773 Bacteria 1730
27 Ga0055534_1004358 3300003784 Bacteria 4127
28 Ga0055534_1006546 3300003784 Bacteria 2916
29 Ga0055530_10000492 3300003791 Bacteria 34175
30 Ga0055540_1010902 3300003792 Bacteria 2983
31 Ga0055531_10008348 3300003794 Bacteria 5482
32 Ga0055531_10011152 3300003794 Bacteria 4372
33 Ga0055541_1000052 3300003841 Bacteria 130812
34 Ga0055541_1000112 3300003841 Bacteria 58923
35 Ga0055543_1005251 3300004625 Bacteria 3340
36 Ga0065165_1013016 3300005262 Bacteria 3338
37 Ga0070670_100140753 3300005331 Bacteria 2086
38 Ga0068869_100084790 3300005334 Bacteria 2372
39 Ga0070661_100188748 3300005344 Bacteria 1571
40 Ga0070669_100243338 3300005353 Bacteria 1430
41 Ga0070663_100144734 3300005455 Bacteria 1818
42 Ga0070678_100042158 3300005456 Bacteria 3242
43 Ga0068867_100156378 3300005459 Bacteria 1795
44 Ga0070679_100283498 3300005530 Bacteria 1609
45 Ga0068853_100077332 3300005539 Bacteria 2907
46 Ga0068853_100103192 3300005539 Bacteria 2524
47 Ga0070672_100064738 3300005543 Bacteria 2889
48 Ga0068855_100002187 3300005563 Bacteria 24167
49 Ga0068855_100048173 3300005563 Bacteria 5031
50 Ga0068855_100104199 3300005563 Bacteria 3263
51 Ga0068855_100306817 3300005563 Bacteria 1757
52 Ga0068854_100114269 3300005578 Bacteria 2041
53 Ga0068856_100100688 3300005614 Bacteria 2882
54 Ga0068852_100255161 3300005616 Bacteria 1681
55 Ga0068861_100267288 3300005719 Bacteria 1467
56 Ga0075368_10026144 3300006042 Bacteria 2245
57 Ga0075363_100035585 3300006048 Bacteria 2607
58 Ga0075363_100101628 3300006048 Bacteria 1591
59 Ga0075364_10004926 3300006051 Bacteria 7735
60 Ga0075432_10018910 3300006058 Bacteria 2352
61 Ga0075362_10007752 3300006177 Bacteria 4078
62 Ga0075362_10154066 3300006177 Bacteria 1104
63 Ga0075367_10003297 3300006178 Bacteria 7655
64 Ga0075369_10006574 3300006186 Bacteria 4400
65 Ga0075366_10063320 3300006195 Bacteria 2198
66 Ga0075366_10065880 3300006195 Bacteria 2155
67 Ga0075370_10003054 3300006353 Bacteria 7889
68 Ga0075370_10025036 3300006353 Bacteria 3299
69 Ga0079104_1005908 3300006946 Bacteria 4758
70 Ga0105244_10058024 3300009036 Bacteria 1955
71 Ga0105240_10003884 3300009093 Bacteria 23078
72 Ga0105240_10009231 3300009093 Bacteria 13992
73 Ga0105240_10021393 3300009093 Bacteria 8604
74 Ga0105240_10064590 3300009093 Bacteria 4547
75 Ga0105240_10067205 3300009093 Bacteria 4443
76 Ga0105245_10117470 3300009098 Bacteria 2481
77 Ga0105243_10000502 3300009148 Bacteria 40065
78 Ga0105237_10011485 3300009545 Bacteria 9370
79 Ga0105238_10000101 3300009551 Bacteria 95764
80 Ga0105249_10098634 3300009553 Bacteria 2744
81 Ga0105239_10001549 3300010375 Bacteria 30378
82 Ga0105239_10024105 3300010375 Bacteria 6702
83 Ga0105246_10000997 3300011119 Bacteria 16273
84 Ga0157373_10006671 3300013100 Bacteria 8601
85 Ga0157371_10033557 3300013102 Bacteria 3687
86 Ga0157369_10141259 3300013105 Bacteria 2548
87 Ga0163162_10175683 3300013306 Bacteria 2267
88 Ga0157372_10159381 3300013307 Bacteria 2607
89 Ga0182008_10004242 3300014497 Bacteria 8405
90 Ga0182008_10004300 3300014497 Bacteria 8340
91 Ga0157376_10003622 3300014969 Bacteria 10661
92 Ga0182006_1000067 3300015261 Bacteria 147932
93 Ga0182006_1015258 3300015261 Bacteria 3295
94 Ga0182007_10000102 3300015262 Bacteria 60496
95 Ga0182007_10002463 3300015262 Bacteria 9190
96 Ga0182007_10074911 3300015262 Bacteria 1109
97 Ga0182005_1000002 3300015265 Bacteria 908499
98 Ga0182005_1036159 3300015265 Bacteria 1343
99 Ga0183362_10003 3300015683 Bacteria 977584
100 Ga0163161_10058316 3300017792 Bacteria 2806
101 Ga0163161_10209836 3300017792 Bacteria 1504
102 Ga0213872_10012553 3300021361 Bacteria 3984
103 Ga0209435_100021 3300025206 Bacteria 223961
104 Ga0209435_100220 3300025206 Bacteria 16210
105 Ga0209436_105629 3300025208 Bacteria 2848
106 Ga0209784_100002 3300025224 Bacteria 1753105
107 Ga0209784_100058 3300025224 Bacteria 167327
108 Ga0209566_100003 3300025225 Bacteria 1753105
109 Ga0209566_100045 3300025225 Bacteria 258557
110 Ga0209674_100004 3300025226 Bacteria 1753105
111 Ga0209674_100096 3300025226 Bacteria 167418
112 Ga0209672_101712 3300025228 Bacteria 7040
113 Ga0209147_100004 3300025229 Bacteria 1371850
114 Ga0209147_100056 3300025229 Bacteria 258557
115 Ga0209147_100652 3300025229 Bacteria 18097
116 Ga0209563_100006 3300025230 Bacteria 1753105
117 Ga0209563_100064 3300025230 Bacteria 258557
118 Ga0209437_100045 3300025233 Bacteria 429809
119 Ga0209258_100083 3300025242 Bacteria 246008
120 Ga0209258_100199 3300025242 Bacteria 123718
121 Ga0209258_100243 3300025242 Bacteria 100317
122 Ga0207425_1000576 3300025245 Bacteria 21542
123 Ga0209646_1000020 3300025246 Bacteria 462204
124 Ga0209646_1000074 3300025246 Bacteria 223961
125 Ga0209646_1000207 3300025246 Bacteria 67740
126 Ga0209026_1000058 3300025250 Bacteria 228656
127 Ga0209026_1002306 3300025250 Bacteria 7274
128 Ga0209677_100003 3300025253 Bacteria 1753105
129 Ga0209677_100053 3300025253 Bacteria 167537
130 Ga0209148_1000179 3300025254 Bacteria 126083
131 Ga0209759_1000046 3300025256 Bacteria 230149
132 Ga0209129_1000071 3300025258 Bacteria 210729
133 Ga0209129_1011457 3300025258 Bacteria 2115
134 Ga0209565_1000225 3300025263 Bacteria 63291
135 Ga0209565_1001961 3300025263 Bacteria 8060
136 Ga0209455_1003571 3300025272 Bacteria 5427
137 Ga0209673_1000178 3300025273 Bacteria 128628
138 Ga0209673_1000546 3300025273 Bacteria 61140
139 Ga0209673_1004640 3300025273 Bacteria 7271
140 Ga0209673_1035558 3300025273 Bacteria 1489
141 Ga0209130_1000773 3300025284 Bacteria 27625
142 Ga0209130_1000889 3300025284 Bacteria 24355
143 Ga0209675_1000726 3300025291 Bacteria 22391
144 Ga0209675_1004179 3300025291 Bacteria 6532
145 Ga0209676_1000005 3300025292 Bacteria 1076001
146 Ga0209676_1000757 3300025292 Bacteria 43636
147 Ga0209025_1001637 3300025294 Bacteria 27722
148 Ga0209564_1000239 3300025295 Bacteria 119761
149 Ga0209564_1009161 3300025295 Bacteria 4758
150 Ga0209758_1000027 3300025297 Bacteria 549650
151 Ga0209758_1022905 3300025297 Bacteria 2843
152 Ga0209050_1000007 3300025298 Bacteria 1187891
153 Ga0209050_1029465 3300025298 Bacteria 1755
154 Ga0209256_1000081 3300025299 Bacteria 222908
155 Ga0209256_1008476 3300025299 Bacteria 4758
156 Ga0207426_1000027 3300025302 Bacteria 513176
157 Ga0207426_1000176 3300025302 Bacteria 159819
158 Ga0209051_1000009 3300025303 Bacteria 706778
159 Ga0209051_1000375 3300025303 Bacteria 63742
160 Ga0209051_1000553 3300025303 Bacteria 45537
161 Ga0209051_1000583 3300025303 Bacteria 43428
162 Ga0209051_1016376 3300025303 Bacteria 3360
163 Ga0209051_1019302 3300025303 Bacteria 2980
164 Ga0209257_1000011 3300025304 Bacteria 1112630
165 Ga0209257_1000866 3300025304 Bacteria 43105
166 Ga0209257_1011542 3300025304 Bacteria 4236
167 Ga0207680_10087292 3300025903 Bacteria 1975
168 Ga0207705_10057260 3300025909 Bacteria 2811
169 Ga0207695_10001181 3300025913 Bacteria 45072
170 Ga0207695_10002021 3300025913 Bacteria 31203
171 Ga0207695_10049252 3300025913 Bacteria 4443
172 Ga0207695_10117068 3300025913 Bacteria 2638
173 Ga0207671_10001984 3300025914 Bacteria 22567
174 Ga0207671_10019517 3300025914 Bacteria 5183
175 Ga0207694_10000869 3300025924 Bacteria 26882
176 Ga0207694_10095837 3300025924 Bacteria 2346
177 Ga0207694_10099378 3300025924 Bacteria 2305
178 Ga0207687_10019571 3300025927 Bacteria 4486
179 Ga0207709_10000336 3300025935 Bacteria 49240
180 Ga0207709_10082918 3300025935 Bacteria 2072
181 Ga0207691_10155439 3300025940 Bacteria 2009
182 Ga0207689_10051568 3300025942 Bacteria 3392
183 Ga0207667_10002267 3300025949 Bacteria 24174
184 Ga0207667_10059280 3300025949 Bacteria 4010
185 Ga0207667_10183691 3300025949 Bacteria 2147
186 Ga0207639_10029551 3300026041 Bacteria 4014
187 Ga0207639_10059235 3300026041 Bacteria 2949
188 Ga0207702_10119027 3300026078 Bacteria 2361
189 Ga0207648_10051117 3300026089 Bacteria 3612
190 Ga0207648_10101497 3300026089 Bacteria 2521
191 Ga0207674_10180840 3300026116 Bacteria 2060
192 Ga0207683_10059452 3300026121 Bacteria 3357
193 Ga0209281_1016950 3300027111 Bacteria 1487
194 Ga0268266_10569372 3300028379 Bacteria 1087
195 Ga0307515_10000652 3300028794 Bacteria 80185
196 Ga0307512_10118807 3300030522 Bacteria 1708
197 Ga0265327_10008172 3300031251 Bacteria 7854
198 Ga0307513_10000004 3300031456 Bacteria 558931
199 Ga0307408_100021748 3300031548 Bacteria 4345
200 Ga0307408_100139630 3300031548 Bacteria 1900
201 Ga0307508_10000030 3300031616 Bacteria 165616
202 Ga0307514_10026028 3300031649 Bacteria 4730
203 Ga0307516_10004726 3300031730 Bacteria 16651
204 Ga0307405_10017870 3300031731 Bacteria 3901
205 Ga0307414_10069557 3300032004 Bacteria 2531
206 Ga0307411_10041359 3300032005 Bacteria 2932
207 Ga0307411_10086937 3300032005 Bacteria 2170
208 Ga0307507_10172321 3300033179 Bacteria 1569
209 Ga0373931_0029428 3300035691 Bacteria 2820
210 Ga0373925_0011039 3300037068 Bacteria 6560
211 Ga0395899_0070739 3300037312 Bacteria 2554
212 Ga0395900_0007000 3300037418 Bacteria 11682
213 Ga0395900_0019524 3300037418 Bacteria 6909
214 Ga0395898_0005430 3300037466 Bacteria 13766
215 Ga0395898_0181784 3300037466 Bacteria 2010
216 Ga0395905_0004475 3300037471 Bacteria 14498
217 Ga0395905_0006951 3300037471 Bacteria 11308
218 Ga0395905_0014460 3300037471 Bacteria 7534
219 Ga0395905_0306400 3300037471 Bacteria 1476
220 Ga0395901_0053458 3300038443 Bacteria 4196
221 Ga0395901_0120085 3300038443 Bacteria 2762
222 Ga0395901_0147918 3300038443 Bacteria 2468
223 Ga0436361_0042902 3300039447 Bacteria 14654
224 Ga0436361_0273730 3300039447 Bacteria 1916
225 Ga0436361_0299790 3300039447 Bacteria 12907
226 Ga0439436_0007017 3300041404 Bacteria 3466
227 Ga0439432_018560 3300042006 Bacteria 2323
228 Ga0450923_006502 3300042125 Bacteria 1942
229 Ga0450894_003981 3300042131 Bacteria 1930
230 Ga0439446_0017972 3300042156 Bacteria 1977
231 Ga0450908_003694 3300042184 Bacteria 2968
232 Ga0439434_0030297 3300042435 Bacteria 1642
233 Ga0450893_0002138 3300042532 Bacteria 3082
234 Ga0453683_0000971 3300044673 Bacteria 27149
235 Ga0451576_0006552 3300045051 Bacteria 14247
236 Ga0495627_012854 3300046453 Bacteria 2957
237 Ga0495629_0013369 3300046459 Bacteria 5922
238 Ga0495629_0102856 3300046459 Bacteria 1993
239 Ga0495582_0089240 3300046473 Bacteria 1718
240 Ga0495583_0000049 3300046506 Bacteria 216069
241 Ga0495631_0000709 3300046518 Bacteria 21508
242 Ga0495631_0067284 3300046518 Bacteria 1550
243 Ga0495632_0003624 3300046519 Bacteria 10853
244 Ga0495663_0047161 3300046525 Bacteria 1326
245 Ga0495642_0025928 3300046528 Bacteria 2326
246 Ga0495621_0005785 3300046539 Bacteria 3574
247 Ga0495597_0002614 3300046542 Bacteria 11205
248 Ga0495633_0003034 3300046558 Bacteria 11444
249 Ga0495656_0000108 3300046615 Bacteria 33050
250 Ga0495656_0043626 3300046615 Bacteria 1884
251 Ga0495625_0000637 3300046660 Bacteria 50416
252 Ga0495625_0004446 3300046660 Bacteria 13252
253 Ga0495649_0007041 3300046694 Bacteria 6922
254 Ga0495660_0022627 3300046810 Bacteria 3587
255 Ga0495660_0063489 3300046810 Bacteria 1977
256 Ga0495674_0069927 3300047319 Bacteria 3034
257 Ga0495683_0138206 3300047323 Bacteria 1144
258 Ga0495687_000473 3300047443 Bacteria 48762
259 Ga0495687_009713 3300047443 Bacteria 5348
260 Ga0495677_0062486 3300047445 Bacteria 1382
261 Ga0495685_048746 3300047447 Bacteria 1440
262 Ga0495673_0058350 3300047469 Bacteria 1664
263 Ga0495686_0001297 3300047472 Bacteria 28173
264 Ga0495626_0041345 3300048091 Bacteria 2172
265 Ga0496101_0068910 3300048904 Bacteria 2587
266 Ga0496111_0016596 3300048914 Bacteria 5077
267 Ga0496114_0155430 3300048917 Bacteria 1986
268 Ga0496116_0007448 3300048919 Bacteria 9707
269 Ga0496116_0062310 3300048919 Bacteria 2408
270 Ga0496117_0000001 3300048920 Bacteria 2526244
271 Ga0496118_0000002 3300048921 Bacteria 1690764
272 Ga0496118_0006756 3300048921 Bacteria 12482
273 Ga0496118_0027335 3300048921 Bacteria 4831
274 Ga0496118_0090325 3300048921 Bacteria 2111
275 Ga0496119_0100762 3300048922 Bacteria 1622
276 Ga0496119_0202770 3300048922 Bacteria 1025
277 Ga0496120_0036806 3300048923 Bacteria 2908
278 Ga0496120_0046030 3300048923 Bacteria 2523
279 Ga0496121_0009959 3300048924 Bacteria 10817
280 Ga0496121_0010284 3300048924 Bacteria 10584
281 Ga0496121_0014132 3300048924 Bacteria 8505
282 Ga0496121_0020305 3300048924 Bacteria 6586
283 Ga0496121_0040981 3300048924 Bacteria 4054
284 Ga0496121_0166963 3300048924 Bacteria 1603
285 Ga0496122_0000491 3300048925 Bacteria 82131
286 Ga0496122_0004577 3300048925 Bacteria 17041
287 Ga0496122_0054236 3300048925 Bacteria 3013
288 Ga0496122_0160030 3300048925 Bacteria 1375
289 Ga0496123_0000488 3300048926 Bacteria 69002
290 Ga0496123_0007649 3300048926 Bacteria 10110
291 Ga0496124_0192610 3300048927 Bacteria 1558
292 Ga0496125_0000540 3300048928 Bacteria 65108
293 Ga0496125_0003821 3300048928 Bacteria 17895
294 Ga0496125_0008025 3300048928 Bacteria 11148
295 Ga0496125_0076537 3300048928 Bacteria 2583
296 Ga0496125_0079125 3300048928 Bacteria 2523
297 Ga0496126_0029131 3300048929 Bacteria 5248
298 Ga0496126_0176632 3300048929 Bacteria 1816
299 Ga0496126_0317799 3300048929 Bacteria 1281
300 Ga0495682_0002960 3300049460 Bacteria 7760
301 Ga0501031_0013513 3300049568 Bacteria 5321
302 Ga0501033_0001825 3300049570 Bacteria 18567
303 Ga0501034_0000745 3300049571 Bacteria 49151
304 Ga0501034_0034047 3300049571 Bacteria 5165
305 Ga0501034_0365231 3300049571 Bacteria 1370
306 Ga0501036_0000327 3300049572 Bacteria 33144
307 Ga0501037_0002561 3300049573 Bacteria 13135
308 Ga0501037_0061851 3300049573 Bacteria 2730
309 Ga0501037_0121396 3300049573 Bacteria 1879
310 Ga0501043_0000828 3300049579 Bacteria 27461
311 Ga0501043_0184645 3300049579 Bacteria 1624
312 Ga0501046_0008109 3300049580 Bacteria 9178
313 Ga0501046_0121339 3300049580 Bacteria 1988
314 Ga0501047_0014841 3300049581 Bacteria 7416
315 Ga0501035_0000973 3300049822 Bacteria 30267
316 Ga0501035_0022492 3300049822 Bacteria 5790
317 Ga0501035_0182804 3300049822 Bacteria 1806
318 Ga0501044_0002872 3300049823 Bacteria 19620
319 Ga0501044_0075535 3300049823 Bacteria 3421
320 nmdc:mga03683_16360_c1 3300050489 Bacteria 2785
321 nmdc:mga03683_65840_c1 3300050489 Bacteria 1539
322 nmdc:mga03n38_46419_c1 3300050490 Bacteria 1918
323 nmdc:mga00v17_15532_c1 3300050491 Bacteria 4274
324 nmdc:mga0k408_35270_c1 3300050493 Bacteria 2869
325 nmdc:mga0k408_48945_c1 3300050493 Bacteria 2447
326 nmdc:mga06z11_6776_c1 3300050494 Bacteria 4680
327 nmdc:mga06z11_87364_c1 3300050494 Bacteria 1686
328 nmdc:mga07m45_4327_c1 3300050496 Bacteria 6948
329 nmdc:mga0sz30_4112_c2 3300050516 Bacteria 4853
330 Ga0495619_0168293 3300053085 Bacteria 1515
331 Ga0500651_0019376 3300053093 Bacteria 4227
332 Ga0500594_0010005 3300053118 Bacteria 2193
333 Ga0500607_028004 3300053121 Bacteria 3122
334 Ga0500618_002208 3300053125 Bacteria 7622
335 Ga0500618_005463 3300053125 Bacteria 3857
336 Ga0500559_0005640 3300053136 Bacteria 5732
337 Ga0500616_0046887 3300053153 Bacteria 2296

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0176632 Ga0496126_0176632_1011_1802 258
2 3300017792 Ga0163161_10209836 Ga0163161_102098362 276
3 3300011119 Ga0105246_10000997 Ga0105246_100009974 277
4 3300013100 Ga0157373_10006671 Ga0157373_100066711 277
5 3300015262 Ga0182007_10002463 Ga0182007_100024637 277
6 3300048921 Ga0496118_0027335 Ga0496118_0027335_162_1103 277
7 3300002738 JGI25154J39366_1005995 JGI25154J39366_10059952 279
8 3300003751 Ga0055538_1000123 Ga0055538_100012323 279
9 3300003752 Ga0055539_1000167 Ga0055539_100016723 279
10 3300003756 Ga0055533_1000171 Ga0055533_100017123 279
11 3300003758 Ga0055532_1000159 Ga0055532_100015923 279
12 3300003759 Ga0055525_1000232 Ga0055525_100023223 279
13 3300003761 Ga0055535_1002356 Ga0055535_10023565 279
14 3300003841 Ga0055541_1000112 Ga0055541_100011223 279
15 3300025224 Ga0209784_100058 Ga0209784_10005870 279
16 3300025225 Ga0209566_100045 Ga0209566_10004570 279
17 3300025226 Ga0209674_100096 Ga0209674_10009670 279
18 3300025229 Ga0209147_100056 Ga0209147_10005670 279
19 3300025230 Ga0209563_100064 Ga0209563_10006470 279
20 3300025242 Ga0209258_100243 Ga0209258_10024370 279
21 3300025246 Ga0209646_1000207 Ga0209646_100020727 279
22 3300025253 Ga0209677_100053 Ga0209677_10005370 279
23 3300017792 Ga0163161_10058316 Ga0163161_100583161 282
24 3300005353 Ga0070669_100243338 Ga0070669_1002433382 283
25 3300047447 Ga0495685_048746 Ga0495685_048746_554_1417 284
26 3300048925 Ga0496122_0160030 Ga0496122_0160030_159_1109 286
27 3300005578 Ga0068854_100114269 Ga0068854_1001142692 288
28 3300005614 Ga0068856_100100688 Ga0068856_1001006882 288
29 3300009093 Ga0105240_10064590 Ga0105240_100645902 288
30 3300009551 Ga0105238_10000101 Ga0105238_1000010151 288
31 3300010375 Ga0105239_10024105 Ga0105239_100241053 288
32 3300015261 Ga0182006_1015258 Ga0182006_10152582 288
33 3300025913 Ga0207695_10001181 Ga0207695_1000118123 288
34 3300025914 Ga0207671_10019517 Ga0207671_100195172 288
35 3300025924 Ga0207694_10000869 Ga0207694_1000086920 288
36 3300025949 Ga0207667_10183691 Ga0207667_101836911 288
37 3300026078 Ga0207702_10119027 Ga0207702_101190273 288
38 3300035691 Ga0373931_0029428 Ga0373931_0029428_1453_2388 291
39 3300005539 Ga0068853_100077332 Ga0068853_1000773322 293
40 3300009093 Ga0105240_10009231 Ga0105240_1000923112 293
41 3300009545 Ga0105237_10011485 Ga0105237_100114855 293
42 3300010375 Ga0105239_10001549 Ga0105239_1000154928 293
43 3300025913 Ga0207695_10117068 Ga0207695_101170683 293
44 3300025914 Ga0207671_10001984 Ga0207671_100019846 293
45 3300025924 Ga0207694_10099378 Ga0207694_100993782 293
46 3300026041 Ga0207639_10059235 Ga0207639_100592352 293
47 3300046459 Ga0495629_0013369 Ga0495629_0013369_3036_4001 301
48 3300047319 Ga0495674_0069927 Ga0495674_0069927_290_1255 301
49 3300050489 nmdc:mga03683_16360_c1 nmdc:mga03683_16360_c1_1581_2504 303
50 3300053125 Ga0500618_005463 Ga0500618_005463_1402_2361 305
51 iso_pu_bacteria 2881927736 2881929421 307
52 iso_pu_bacteria 2887375801 2887380279 307
53 3300053085 Ga0495619_0168293 Ga0495619_0168293_140_1075 308
54 iso_pu_bacteria 2842747753 2842748268 308
55 iso_pu_bacteria 2885192300 2885196202 308
56 3300005331 Ga0070670_100140753 Ga0070670_1001407532 309
57 3300005334 Ga0068869_100084790 Ga0068869_1000847902 309
58 3300009098 Ga0105245_10117470 Ga0105245_101174702 309
59 3300013306 Ga0163162_10175683 Ga0163162_101756834 309
60 3300014969 Ga0157376_10003622 Ga0157376_1000362211 309
61 3300025927 Ga0207687_10019571 Ga0207687_100195714 309
62 3300025942 Ga0207689_10051568 Ga0207689_100515683 309
63 3300031456 Ga0307513_10000004 Ga0307513_10000004282 309
64 3300031730 Ga0307516_10004726 Ga0307516_1000472613 309
65 3300049571 Ga0501034_0000745 Ga0501034_0000745_1372_2316 309
66 3300049573 Ga0501037_0121396 Ga0501037_0121396_880_1824 309
67 3300049579 Ga0501043_0184645 Ga0501043_0184645_170_1114 309
68 3300049822 Ga0501035_0022492 Ga0501035_0022492_2450_3394 309
69 3300049823 Ga0501044_0075535 Ga0501044_0075535_1977_2921 309
70 iso_pu_bacteria 2548877040 2550899543 309
71 iso_pu_bacteria 2571042143 2571532017 309
72 iso_pu_bacteria 2576861424 2578338103 309
73 iso_pu_bacteria 2599185214 2599623984 309
74 iso_pu_bacteria 2599185226 2599671995 309
75 iso_pu_bacteria 2599185227 2599681923 309
76 iso_pu_bacteria 2599185229 2599693936 309
77 iso_pu_bacteria 2600255286 2601639214 309
78 iso_pu_bacteria 2600255292 2601668072 309
79 iso_pu_bacteria 2643221683 2644469220 309
80 iso_pu_bacteria 2721755693 2723606567 309
81 iso_pu_bacteria 2728368933 2728530891 309
82 iso_pu_bacteria 2728369359 2730137160 309
83 iso_pu_bacteria 2738541277 2738722102 309
84 iso_pu_bacteria 2738541307 2738881190 309
85 iso_pu_bacteria 2738543019 2739282466 309
86 iso_pu_bacteria 2751185905 2753808875 309
87 iso_pu_bacteria 2802428803 2802437764 309
88 iso_pu_bacteria 2818991446 2819596431 309
89 iso_pu_bacteria 2831265667 2831270234 309
90 iso_pu_bacteria 2838054893 2838059959 309
91 iso_pu_bacteria 2857547612 2857549886 309
92 iso_pu_bacteria 2881636855 2881641032 309
93 iso_pu_bacteria 2885198086 2885199566 309
94 iso_pu_bacteria 2885211737 2885213161 309
95 iso_pu_bacteria 2889276214 2889277117 309
96 iso_pu_bacteria 2899924645 2899931141 309
97 iso_pu_bacteria 2904449895 2904454811 309
98 iso_pu_bacteria 2904456579 2904462616 309
99 iso_pu_bacteria 2904541872 2904546794 309
100 iso_pu_bacteria 2904595352 2904596189 309
101 iso_pu_bacteria 2928037797 2928038081 309
102 iso_pu_bacteria 2928044640 2928046313 309
103 iso_pu_bacteria 2928051484 2928054008 309
104 iso_pu_bacteria 2928064002 2928065761 309
105 iso_pu_bacteria 2928070936 2928077913 309
106 iso_pu_bacteria 2928130867 2928134858 309
107 iso_pu_bacteria 2929160207 2929164267 309
108 iso_pu_bacteria 2938649242 2938650307 309
109 iso_pu_bacteria 2968558590 2968561675 309
110 iso_pu_bacteria 2971403814 2971407354 309
111 iso_pu_bacteria 2971511577 2971512714 309
112 iso_pu_bacteria 2980176882 2980177575 309
113 iso_pu_bacteria 2988225383 2988228947 309
114 iso_pu_bacteria 2996632988 2996636673 309
115 iso_pu_bacteria 2996706504 2996708962 309
116 iso_pu_bacteria 648028048 648172545 309
117 iso_pu_bacteria 8054465665 8054470325 309
118 3300005543 Ga0070672_100064738 Ga0070672_1000647383 310
119 3300006177 Ga0075362_10154066 Ga0075362_101540661 310
120 3300006195 Ga0075366_10065880 Ga0075366_100658802 310
121 3300006353 Ga0075370_10003054 Ga0075370_100030547 310
122 3300014497 Ga0182008_10004300 Ga0182008_100043006 310
123 3300015262 Ga0182007_10074911 Ga0182007_100749112 310
124 3300015265 Ga0182005_1036159 Ga0182005_10361592 310
125 3300015683 Ga0183362_10003 Ga0183362_1000349 310
126 3300025903 Ga0207680_10087292 Ga0207680_100872922 310
127 3300025909 Ga0207705_10057260 Ga0207705_100572602 310
128 3300025940 Ga0207691_10155439 Ga0207691_101554392 310
129 3300031548 Ga0307408_100139630 Ga0307408_1001396302 310
130 3300031731 Ga0307405_10017870 Ga0307405_100178702 310
131 3300032005 Ga0307411_10086937 Ga0307411_100869372 310
132 3300041404 Ga0439436_0007017 Ga0439436_0007017_448_1398 310
133 3300042006 Ga0439432_018560 Ga0439432_018560_225_1175 310
134 3300042131 Ga0450894_003981 Ga0450894_003981_82_1032 310
135 3300042156 Ga0439446_0017972 Ga0439446_0017972_477_1427 310
136 3300042184 Ga0450908_003694 Ga0450908_003694_1123_2073 310
137 3300042435 Ga0439434_0030297 Ga0439434_0030297_28_978 310
138 3300042532 Ga0450893_0002138 Ga0450893_0002138_1988_2938 310
139 3300046539 Ga0495621_0005785 Ga0495621_0005785_624_1574 310
140 3300046615 Ga0495656_0000108 Ga0495656_0000108_17082_18032 310
141 3300047472 Ga0495686_0001297 Ga0495686_0001297_1421_2368 310
142 3300048917 Ga0496114_0155430 Ga0496114_0155430_296_1246 310
143 3300050489 nmdc:mga03683_65840_c1 nmdc:mga03683_65840_c1_525_1475 310
144 3300053093 Ga0500651_0019376 Ga0500651_0019376_2989_3939 310
145 iso_pu_bacteria 2521172590 2521557465 310
146 iso_pu_bacteria 2548876994 2550692280 310
147 iso_pu_bacteria 2551306416 2553006409 310
148 iso_pu_bacteria 2738543013 2739252607 310
149 iso_pu_bacteria 2818991445 2819592277 310
150 iso_pu_bacteria 2818991449 2819618434 310
151 iso_pu_bacteria 2884811622 2884816343 310
152 iso_pu_bacteria 2884836552 2884840304 310
153 iso_pu_bacteria 2884852848 2884856929 310
154 iso_pu_bacteria 2896154374 2896157514 310
155 iso_pu_bacteria 2904439833 2904441828 310
156 iso_pu_bacteria 2904530477 2904531250 310
157 iso_pu_bacteria 2904584206 2904587096 310
158 iso_pu_bacteria 2904589729 2904592870 310
159 iso_pu_bacteria 2904601388 2904604362 310
160 iso_pu_bacteria 2919046199 2919050046 310
161 iso_pu_bacteria 2919079590 2919082168 310
162 iso_pu_bacteria 2923510766 2923516144 310
163 3300002987 JGI25159J45721_1004375 JGI25159J45721_10043753 311
164 3300002987 JGI25159J45721_1007985 JGI25159J45721_10079853 311
165 3300003578 Ga0006562J51391_1107226 Ga0006562J51391_11072262 311
166 3300003761 Ga0055535_1000625 Ga0055535_10006253 311
167 3300003762 Ga0055542_1000087 Ga0055542_100008773 311
168 3300003773 Ga0055537_1011909 Ga0055537_10119092 311
169 3300003784 Ga0055534_1004358 Ga0055534_10043582 311
170 3300003784 Ga0055534_1006546 Ga0055534_10065462 311
171 3300003791 Ga0055530_10000492 Ga0055530_100004929 311
172 3300003792 Ga0055540_1010902 Ga0055540_10109022 311
173 3300003794 Ga0055531_10008348 Ga0055531_100083485 311
174 3300003794 Ga0055531_10011152 Ga0055531_100111525 311
175 3300004625 Ga0055543_1005251 Ga0055543_10052513 311
176 3300005262 Ga0065165_1013016 Ga0065165_10130163 311
177 3300005455 Ga0070663_100144734 Ga0070663_1001447341 311
178 3300005530 Ga0070679_100283498 Ga0070679_1002834982 311
179 3300005563 Ga0068855_100104199 Ga0068855_1001041992 311
180 3300005563 Ga0068855_100306817 Ga0068855_1003068172 311
181 3300005616 Ga0068852_100255161 Ga0068852_1002551612 311
182 3300006048 Ga0075363_100035585 Ga0075363_1000355852 311
183 3300006048 Ga0075363_100101628 Ga0075363_1001016282 311
184 3300006051 Ga0075364_10004926 Ga0075364_100049262 311
185 3300006058 Ga0075432_10018910 Ga0075432_100189102 311
186 3300009036 Ga0105244_10058024 Ga0105244_100580242 311
187 3300009093 Ga0105240_10021393 Ga0105240_100213932 311
188 3300009148 Ga0105243_10000502 Ga0105243_100005023 311
189 3300013102 Ga0157371_10033557 Ga0157371_100335573 311
190 3300013105 Ga0157369_10141259 Ga0157369_101412593 311
191 3300013307 Ga0157372_10159381 Ga0157372_101593812 311
192 3300025208 Ga0209436_105629 Ga0209436_1056292 311
193 3300025228 Ga0209672_101712 Ga0209672_1017122 311
194 3300025229 Ga0209147_100652 Ga0209147_1006526 311
195 3300025242 Ga0209258_100199 Ga0209258_10019934 311
196 3300025245 Ga0207425_1000576 Ga0207425_100057612 311
197 3300025254 Ga0209148_1000179 Ga0209148_100017934 311
198 3300025258 Ga0209129_1000071 Ga0209129_1000071102 311
199 3300025258 Ga0209129_1011457 Ga0209129_10114572 311
200 3300025263 Ga0209565_1000225 Ga0209565_100022523 311
201 3300025263 Ga0209565_1001961 Ga0209565_10019613 311
202 3300025273 Ga0209673_1000178 Ga0209673_100017891 311
203 3300025273 Ga0209673_1000546 Ga0209673_100054623 311
204 3300025273 Ga0209673_1004640 Ga0209673_100464011 311
205 3300025273 Ga0209673_1035558 Ga0209673_10355582 311
206 3300025284 Ga0209130_1000773 Ga0209130_10007732 311
207 3300025284 Ga0209130_1000889 Ga0209130_10008893 311
208 3300025291 Ga0209675_1000726 Ga0209675_100072614 311
209 3300025291 Ga0209675_1004179 Ga0209675_10041797 311
210 3300025292 Ga0209676_1000005 Ga0209676_100000581 311
211 3300025292 Ga0209676_1000757 Ga0209676_100075730 311
212 3300025294 Ga0209025_1001637 Ga0209025_100163716 311
213 3300025295 Ga0209564_1000239 Ga0209564_100023925 311
214 3300025295 Ga0209564_1009161 Ga0209564_10091613 311
215 3300025297 Ga0209758_1000027 Ga0209758_1000027407 311
216 3300025297 Ga0209758_1022905 Ga0209758_10229053 311
217 3300025298 Ga0209050_1000007 Ga0209050_10000071017 311
218 3300025298 Ga0209050_1029465 Ga0209050_10294652 311
219 3300025299 Ga0209256_1000081 Ga0209256_1000081102 311
220 3300025299 Ga0209256_1008476 Ga0209256_10084763 311
221 3300025302 Ga0207426_1000027 Ga0207426_1000027372 311
222 3300025302 Ga0207426_1000176 Ga0207426_1000176109 311
223 3300025303 Ga0209051_1000009 Ga0209051_100000981 311
224 3300025303 Ga0209051_1000375 Ga0209051_100037544 311
225 3300025303 Ga0209051_1000553 Ga0209051_100055314 311
226 3300025303 Ga0209051_1000583 Ga0209051_100058324 311
227 3300025303 Ga0209051_1016376 Ga0209051_10163763 311
228 3300025303 Ga0209051_1019302 Ga0209051_10193022 311
229 3300025304 Ga0209257_1000011 Ga0209257_100001155 311
230 3300025304 Ga0209257_1000866 Ga0209257_100086624 311
231 3300025304 Ga0209257_1011542 Ga0209257_10115422 311
232 3300025924 Ga0207694_10095837 Ga0207694_100958371 311
233 3300025935 Ga0207709_10000336 Ga0207709_1000033640 311
234 3300026041 Ga0207639_10029551 Ga0207639_100295512 311
235 3300026089 Ga0207648_10101497 Ga0207648_101014972 311
236 3300028379 Ga0268266_10569372 Ga0268266_105693722 311
237 3300031548 Ga0307408_100021748 Ga0307408_1000217483 311
238 3300032004 Ga0307414_10069557 Ga0307414_100695573 311
239 3300032005 Ga0307411_10041359 Ga0307411_100413592 311
240 3300037418 Ga0395900_0007000 Ga0395900_0007000_1448_2398 311
241 3300037466 Ga0395898_0005430 Ga0395898_0005430_5142_6092 311
242 3300037471 Ga0395905_0004475 Ga0395905_0004475_1191_2141 311
243 3300037471 Ga0395905_0306400 Ga0395905_0306400_241_1191 311
244 3300038443 Ga0395901_0053458 Ga0395901_0053458_219_1169 311
245 3300038443 Ga0395901_0147918 Ga0395901_0147918_1001_1951 311
246 3300044673 Ga0453683_0000971 Ga0453683_0000971_15240_16190 311
247 3300045051 Ga0451576_0006552 Ga0451576_0006552_11809_12759 311
248 3300046453 Ga0495627_012854 Ga0495627_012854_1031_1984 311
249 3300046459 Ga0495629_0102856 Ga0495629_0102856_49_1002 311
250 3300046473 Ga0495582_0089240 Ga0495582_0089240_166_1119 311
251 3300046518 Ga0495631_0000709 Ga0495631_0000709_18505_19458 311
252 3300046525 Ga0495663_0047161 Ga0495663_0047161_143_1093 311
253 3300046528 Ga0495642_0025928 Ga0495642_0025928_932_1882 311
254 3300046558 Ga0495633_0003034 Ga0495633_0003034_6789_7736 311
255 3300046615 Ga0495656_0043626 Ga0495656_0043626_548_1498 311
256 3300046660 Ga0495625_0000637 Ga0495625_0000637_25691_26644 311
257 3300047445 Ga0495677_0062486 Ga0495677_0062486_196_1146 311
258 3300048904 Ga0496101_0068910 Ga0496101_0068910_875_1828 311
259 3300048924 Ga0496121_0040981 Ga0496121_0040981_1549_2502 311
260 3300048928 Ga0496125_0076537 Ga0496125_0076537_344_1297 311
261 3300049460 Ga0495682_0002960 Ga0495682_0002960_1132_2079 311
262 3300050490 nmdc:mga03n38_46419_c1 nmdc:mga03n38_46419_c1_75_1028 311
263 3300050491 nmdc:mga00v17_15532_c1 nmdc:mga00v17_15532_c1_2339_3292 311
264 3300053121 Ga0500607_028004 Ga0500607_028004_1142_2095 311
265 3300053153 Ga0500616_0046887 Ga0500616_0046887_927_1880 311
266 iso_pu_bacteria 2511231003 2511249846 311
267 3300005344 Ga0070661_100188748 Ga0070661_1001887482 312
268 3300005459 Ga0068867_100156378 Ga0068867_1001563781 312
269 3300005539 Ga0068853_100103192 Ga0068853_1001031923 312
270 3300005719 Ga0068861_100267288 Ga0068861_1002672882 312
271 3300006042 Ga0075368_10026144 Ga0075368_100261442 312
272 3300006177 Ga0075362_10007752 Ga0075362_100077523 312
273 3300006178 Ga0075367_10003297 Ga0075367_100032974 312
274 3300006186 Ga0075369_10006574 Ga0075369_100065743 312
275 3300006195 Ga0075366_10063320 Ga0075366_100633202 312
276 3300006353 Ga0075370_10025036 Ga0075370_100250364 312
277 3300009553 Ga0105249_10098634 Ga0105249_100986341 312
278 3300025935 Ga0207709_10082918 Ga0207709_100829183 312
279 3300026089 Ga0207648_10051117 Ga0207648_100511174 312
280 3300026116 Ga0207674_10180840 Ga0207674_101808402 312
281 3300028794 Ga0307515_10000652 Ga0307515_1000065219 312
282 3300030522 Ga0307512_10118807 Ga0307512_101188072 312
283 3300031251 Ga0265327_10008172 Ga0265327_100081725 312
284 3300031616 Ga0307508_10000030 Ga0307508_10000030127 312
285 3300031649 Ga0307514_10026028 Ga0307514_100260283 312
286 3300033179 Ga0307507_10172321 Ga0307507_101723212 312
287 3300037466 Ga0395898_0181784 Ga0395898_0181784_634_1593 312
288 3300037471 Ga0395905_0014460 Ga0395905_0014460_374_1333 312
289 3300038443 Ga0395901_0120085 Ga0395901_0120085_800_1756 312
290 3300039447 Ga0436361_0042902 Ga0436361_0042902_1898_2869 312
291 3300042125 Ga0450923_006502 Ga0450923_006502_405_1343 312
292 3300046518 Ga0495631_0067284 Ga0495631_0067284_526_1491 312
293 3300046519 Ga0495632_0003624 Ga0495632_0003624_8742_9707 312
294 3300046542 Ga0495597_0002614 Ga0495597_0002614_7249_8214 312
295 3300046694 Ga0495649_0007041 Ga0495649_0007041_1997_2962 312
296 3300046810 Ga0495660_0022627 Ga0495660_0022627_1933_2898 312
297 3300047323 Ga0495683_0138206 Ga0495683_0138206_29_994 312
298 3300047443 Ga0495687_000473 Ga0495687_000473_20385_21350 312
299 3300047443 Ga0495687_009713 Ga0495687_009713_488_1453 312
300 3300047469 Ga0495673_0058350 Ga0495673_0058350_556_1521 312
301 3300048091 Ga0495626_0041345 Ga0495626_0041345_833_1798 312
302 3300049568 Ga0501031_0013513 Ga0501031_0013513_933_1877 312
303 3300049570 Ga0501033_0001825 Ga0501033_0001825_7161_8105 312
304 3300049571 Ga0501034_0034047 Ga0501034_0034047_1603_2547 312
305 3300049571 Ga0501034_0365231 Ga0501034_0365231_415_1359 312
306 3300049572 Ga0501036_0000327 Ga0501036_0000327_31488_32432 312
307 3300049573 Ga0501037_0002561 Ga0501037_0002561_6947_7891 312
308 3300049579 Ga0501043_0000828 Ga0501043_0000828_14348_15292 312
309 3300049580 Ga0501046_0008109 Ga0501046_0008109_1284_2228 312
310 3300049581 Ga0501047_0014841 Ga0501047_0014841_3392_4336 312
311 3300049822 Ga0501035_0000973 Ga0501035_0000973_1472_2416 312
312 3300049823 Ga0501044_0002872 Ga0501044_0002872_18523_19467 312
313 3300050493 nmdc:mga0k408_35270_c1 nmdc:mga0k408_35270_c1_1262_2302 312
314 3300050493 nmdc:mga0k408_48945_c1 nmdc:mga0k408_48945_c1_629_1594 312
315 3300050494 nmdc:mga06z11_6776_c1 nmdc:mga06z11_6776_c1_65_1105 312
316 3300050494 nmdc:mga06z11_87364_c1 nmdc:mga06z11_87364_c1_433_1398 312
317 3300050496 nmdc:mga07m45_4327_c1 nmdc:mga07m45_4327_c1_3918_4958 312
318 3300050516 nmdc:mga0sz30_4112_c2 nmdc:mga0sz30_4112_c2_1925_2965 312
319 3300053118 Ga0500594_0010005 Ga0500594_0010005_988_1950 312
320 3300053136 Ga0500559_0005640 Ga0500559_0005640_2734_3696 312
321 iso_pu_bacteria 2765235838 2765570545 312
322 iso_pu_bacteria 2808606386 2808983501 312
323 iso_pu_bacteria 2808606415 2809128725 312
324 iso_pu_bacteria 2808606419 2809148346 312
325 iso_pu_bacteria 2839094727 2839098027 312
326 iso_pu_bacteria 2852618963 2852620232 312
327 3300003751 Ga0055538_1000050 Ga0055538_100005093 313
328 3300003752 Ga0055539_1000074 Ga0055539_100007493 313
329 3300003756 Ga0055533_1000081 Ga0055533_100008193 313
330 3300003759 Ga0055525_1000108 Ga0055525_100010832 313
331 3300003841 Ga0055541_1000052 Ga0055541_100005293 313
332 3300005563 Ga0068855_100002187 Ga0068855_10000218723 313
333 3300025224 Ga0209784_100002 Ga0209784_1000021446 313
334 3300025225 Ga0209566_100003 Ga0209566_1000031446 313
335 3300025226 Ga0209674_100004 Ga0209674_1000041446 313
336 3300025230 Ga0209563_100006 Ga0209563_1000061446 313
337 3300025253 Ga0209677_100003 Ga0209677_1000031446 313
338 3300025949 Ga0207667_10002267 Ga0207667_100022672 313
339 3300037312 Ga0395899_0070739 Ga0395899_0070739_1245_2207 313
340 3300037418 Ga0395900_0019524 Ga0395900_0019524_2873_3835 313
341 3300039447 Ga0436361_0273730 Ga0436361_0273730_339_1280 313
342 3300046810 Ga0495660_0063489 Ga0495660_0063489_736_1689 313
343 3300048919 Ga0496116_0062310 Ga0496116_0062310_1310_2266 313
344 3300048921 Ga0496118_0006756 Ga0496118_0006756_6311_7267 313
345 3300048922 Ga0496119_0100762 Ga0496119_0100762_142_1098 313
346 3300048922 Ga0496119_0202770 Ga0496119_0202770_40_996 313
347 3300048923 Ga0496120_0036806 Ga0496120_0036806_366_1322 313
348 3300048923 Ga0496120_0046030 Ga0496120_0046030_1202_2158 313
349 3300048924 Ga0496121_0010284 Ga0496121_0010284_6550_7506 313
350 3300048924 Ga0496121_0166963 Ga0496121_0166963_516_1472 313
351 3300048925 Ga0496122_0054236 Ga0496122_0054236_522_1478 313
352 3300048928 Ga0496125_0000540 Ga0496125_0000540_9597_10553 313
353 3300048929 Ga0496126_0029131 Ga0496126_0029131_3768_4724 313
354 3300049573 Ga0501037_0061851 Ga0501037_0061851_731_1711 313
355 3300049580 Ga0501046_0121339 Ga0501046_0121339_55_1035 313
356 3300049822 Ga0501035_0182804 Ga0501035_0182804_743_1723 313
357 3300053125 Ga0500618_002208 Ga0500618_002208_4227_5180 313
358 iso_pu_bacteria 2511231026 2511386229 313
359 iso_pu_bacteria 8057160832 8057163746 313
360 3300002704 JGI25155J39150_1001002 JGI25155J39150_10010023 314
361 3300002705 JGI25156J39149_1001523 JGI25156J39149_10015235 314
362 3300002737 JGI25162J39368_1005901 JGI25162J39368_10059012 314
363 3300002738 JGI25154J39366_1000084 JGI25154J39366_100008478 314
364 3300002741 JGI25157J39369_1000225 JGI25157J39369_10002255 314
365 3300003758 Ga0055532_1000015 Ga0055532_1000015215 314
366 3300003761 Ga0055535_1006426 Ga0055535_10064262 314
367 3300005563 Ga0068855_100048173 Ga0068855_1000481734 314
368 3300006946 Ga0079104_1005908 Ga0079104_10059082 314
369 3300009093 Ga0105240_10003884 Ga0105240_1000388423 314
370 3300021361 Ga0213872_10012553 Ga0213872_100125534 314
371 3300025206 Ga0209435_100021 Ga0209435_10002167 314
372 3300025229 Ga0209147_100004 Ga0209147_100004779 314
373 3300025233 Ga0209437_100045 Ga0209437_100045134 314
374 3300025242 Ga0209258_100083 Ga0209258_100083130 314
375 3300025246 Ga0209646_1000074 Ga0209646_100007467 314
376 3300025250 Ga0209026_1000058 Ga0209026_1000058136 314
377 3300025256 Ga0209759_1000046 Ga0209759_1000046135 314
378 3300025272 Ga0209455_1003571 Ga0209455_10035715 314
379 3300025913 Ga0207695_10002021 Ga0207695_100020219 314
380 3300025949 Ga0207667_10059280 Ga0207667_100592802 314
381 3300027111 Ga0209281_1016950 Ga0209281_10169502 314
382 3300039447 Ga0436361_0299790 Ga0436361_0299790_6774_7724 314
383 3300046660 Ga0495625_0004446 Ga0495625_0004446_3659_4603 314
384 3300048919 Ga0496116_0007448 Ga0496116_0007448_1475_2419 314
385 3300048921 Ga0496118_0090325 Ga0496118_0090325_302_1246 314
386 3300048925 Ga0496122_0000491 Ga0496122_0000491_18711_19655 314
387 3300048926 Ga0496123_0000488 Ga0496123_0000488_10799_11743 314
388 3300048928 Ga0496125_0003821 Ga0496125_0003821_3373_4317 314
389 3300048928 Ga0496125_0079125 Ga0496125_0079125_730_1674 314
390 3300002704 JGI25155J39150_1000992 JGI25155J39150_10009923 315
391 3300002738 JGI25154J39366_1000193 JGI25154J39366_100019337 315
392 3300005456 Ga0070678_100042158 Ga0070678_1000421582 315
393 3300009093 Ga0105240_10067205 Ga0105240_100672054 315
394 3300014497 Ga0182008_10004242 Ga0182008_100042426 315
395 3300015261 Ga0182006_1000067 Ga0182006_100006721 315
396 3300015262 Ga0182007_10000102 Ga0182007_1000010230 315
397 3300015265 Ga0182005_1000002 Ga0182005_1000002113 315
398 3300025206 Ga0209435_100220 Ga0209435_1002202 315
399 3300025246 Ga0209646_1000020 Ga0209646_1000020398 315
400 3300025250 Ga0209026_1002306 Ga0209026_10023063 315
401 3300025913 Ga0207695_10049252 Ga0207695_100492524 315
402 3300026121 Ga0207683_10059452 Ga0207683_100594523 315
403 3300037068 Ga0373925_0011039 Ga0373925_0011039_5176_6171 315
404 3300037471 Ga0395905_0006951 Ga0395905_0006951_6300_7277 315
405 3300046506 Ga0495583_0000049 Ga0495583_0000049_103059_104033 315
406 3300048914 Ga0496111_0016596 Ga0496111_0016596_175_1161 315
407 3300048920 Ga0496117_0000001 Ga0496117_0000001_988135_989121 315
408 3300048921 Ga0496118_0000002 Ga0496118_0000002_988135_989121 315
409 3300048924 Ga0496121_0009959 Ga0496121_0009959_3235_4209 315
410 3300048924 Ga0496121_0014132 Ga0496121_0014132_3387_4373 315
411 3300048924 Ga0496121_0020305 Ga0496121_0020305_4339_5286 315
412 3300048925 Ga0496122_0004577 Ga0496122_0004577_11986_12972 315
413 3300048926 Ga0496123_0007649 Ga0496123_0007649_7466_8452 315
414 3300048927 Ga0496124_0192610 Ga0496124_0192610_334_1320 315
415 3300048928 Ga0496125_0008025 Ga0496125_0008025_399_1385 315
416 3300048929 Ga0496126_0317799 Ga0496126_0317799_128_1075 315
417 iso_pu_bacteria 2932410948 2932411775 315
418 iso_pu_bacteria 2932416698 2932418658 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

16

319

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4du5-assembly1.cif.gz_A crystal structure of pfkb protein from polaromonas sp. js666 0.9863 6 312
4du5-assembly2.cif.gz_C crystal structure of pfkb protein from polaromonas sp. js666 0.9861 6 312
4du5-assembly1.cif.gz_D crystal structure of pfkb protein from polaromonas sp. js666 0.9801 6 313
4du5-assembly1.cif.gz_A crystal structure of pfkb protein from polaromonas sp. js666 0.9764 6 312
4du5-assembly2.cif.gz_C crystal structure of pfkb protein from polaromonas sp. js666 0.9762 6 312
ID Description Score Start End Superfamily
4du5C00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.984 6 312 3.40.1190.20
4du5C00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9737 6 312 3.40.1190.20
1v1aA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9402 6 311 3.40.1190.20
3iq0B00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.932 6 314 3.40.1190.20
2varB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9316 6 312 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A6L3X5H5-F1-model_v4 Sugar kinase 0.9933 6 124 GO:0006796
GO:0016301
AF-A0A4R6QK55-F1-model_v4 2-dehydro-3-deoxygluconokinase 0.9905 6 315 GO:0016301
AF-A0A1B3X6E5-F1-model_v4 2-dehydro-3-deoxygluconokinase 0.9851 8 312 GO:0016301
AF-A0A2A8MDZ6-F1-model_v4 deleted 0.9849 184 312
AF-A0A4Q2WJP4-F1-model_v4 deleted 0.979 6 173

Feature Viewer

pLDDT pTM Quality
93.74 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map