F439179

General Info

Members Datasets Scaffolds Average Seq Length
417 209 834 283

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0006015|Ga0500641_0006015_527_1498
Length 323
Sequence MTRDIDLLTSPILTHLRDRWWDAAFTEFVRDTLRPEPGEQVLEVGCGGGIAELMLRLLEPGGVRHYGIDIDLARIRLARGAARDHNLPLGHAAADIRALPFAEATFDATFEIGVLQHLPEATRAIAELARVTQPYGRVLLVEPDNSTRYWFSSLASGRHAFDLSTQYFAALAHDTHTEHSAPVSEAGLSVAGLHPHPRAGLGPHLPALCRAHGIEAIGVHVFPVTSTRLGAPVPTVWNARKRVIRAAVNAAPTEETRAIGSELIDAVDRYAEEGSAAGPAFVEIQNTMLFAIVGQRRGEPHRERGSSQAAVPASTPMGKAERV

Samples

Sample ID Description Type Environment
1 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
135 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
136 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
137 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
138 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
139 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
140 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
202 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.92
Nodule 0
Rhizoplane 5.52
Rhizosphere 92.57
Stem 0
Stem Tuber 0
Unclassified 18.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500641_0006015 3300053096 Bacteria 4294
2 Ga0065712_10067822 3300005290 Bacteria 28686
3 Ga0065712_10068497 3300005290 Bacteria 10234
4 Ga0065712_10161427 3300005290 Bacteria 1300
5 Ga0065715_10000735 3300005293 Bacteria 10090
6 Ga0065715_10027137 3300005293 Bacteria 1356
7 Ga0065707_10141982 3300005295 Bacteria 1760
8 Ga0065707_10171124 3300005295 Unclassified 1471
9 Ga0070683_100000767 3300005329 Bacteria 23601
10 Ga0070683_100231404 3300005329 Bacteria 1757
11 Ga0070670_100004468 3300005331 Bacteria 11713
12 Ga0070670_100009066 3300005331 Bacteria 8501
13 Ga0068869_100033601 3300005334 Bacteria 3621
14 Ga0070666_10043583 3300005335 Unclassified 3005
15 Ga0070680_100506876 3300005336 Bacteria 1033
16 Ga0070682_100137008 3300005337 Bacteria 1664
17 Ga0070689_100084160 3300005340 Bacteria 2500
18 Ga0070687_100067444 3300005343 Unclassified 1910
19 Ga0070661_100115626 3300005344 Bacteria 2006
20 Ga0070668_100083484 3300005347 Bacteria 2508
21 Ga0070668_100471917 3300005347 Bacteria 1082
22 Ga0070669_100000166 3300005353 Bacteria 58014
23 Ga0070669_100075970 3300005353 Unclassified 2493
24 Ga0070675_100004987 3300005354 Bacteria 10135
25 Ga0070675_100101643 3300005354 Bacteria 2422
26 Ga0070675_100102684 3300005354 Bacteria 2409
27 Ga0070675_100106424 3300005354 Bacteria 2368
28 Ga0070675_100153196 3300005354 Bacteria 1977
29 Ga0070675_100220641 3300005354 Bacteria 1651
30 Ga0070675_100296841 3300005354 Unclassified 1423
31 Ga0070674_100004110 3300005356 Bacteria 8268
32 Ga0070674_100015644 3300005356 Bacteria 4742
33 Ga0070674_100116332 3300005356 Bacteria 1973
34 Ga0070673_100012507 3300005364 Bacteria 5829
35 Ga0070673_100100883 3300005364 Bacteria 2377
36 Ga0070673_100206671 3300005364 Bacteria 1693
37 Ga0070688_100167499 3300005365 Unclassified 1514
38 Ga0070688_100328792 3300005365 Bacteria 1113
39 Ga0070667_100200203 3300005367 Bacteria 1772
40 Ga0070667_100594752 3300005367 Bacteria 1019
41 Ga0070701_10010888 3300005438 Bacteria 4040
42 Ga0070705_100326605 3300005440 Bacteria 1110
43 Ga0070700_100035745 3300005441 Bacteria 3008
44 Ga0070694_100051020 3300005444 Bacteria 2791
45 Ga0070694_100073271 3300005444 Bacteria 2365
46 Ga0070694_100137092 3300005444 Bacteria 1774
47 Ga0070663_100196995 3300005455 Bacteria 1570
48 Ga0070663_100341541 3300005455 Bacteria 1210
49 Ga0070678_100050728 3300005456 Bacteria 3004
50 Ga0070678_100133929 3300005456 Bacteria 1973
51 Ga0070678_100239669 3300005456 Bacteria 1516
52 Ga0068867_100007110 3300005459 Bacteria 7911
53 Ga0070707_100202874 3300005468 Unclassified 1933
54 Ga0070707_100490455 3300005468 Unclassified 1190
55 Ga0070699_100064197 3300005518 Bacteria 3185
56 Ga0070684_100004962 3300005535 Bacteria 10158
57 Ga0070697_100053825 3300005536 Bacteria 3271
58 Ga0070697_100254805 3300005536 Bacteria 1501
59 Ga0070672_100075187 3300005543 Bacteria 2696
60 Ga0070672_100150621 3300005543 Bacteria 1924
61 Ga0070672_100239056 3300005543 Unclassified 1527
62 Ga0070686_100042146 3300005544 Bacteria 2857
63 Ga0070686_100079560 3300005544 Bacteria 2167
64 Ga0070686_100221031 3300005544 Unclassified 1369
65 Ga0070686_100251404 3300005544 Bacteria 1291
66 Ga0070695_100003169 3300005545 Bacteria 9596
67 Ga0070696_100010323 3300005546 Bacteria 6257
68 Ga0070665_100007148 3300005548 Bacteria 11352
69 Ga0070665_100251039 3300005548 Bacteria 1770
70 Ga0070704_100046417 3300005549 Bacteria 3029
71 Ga0070704_100124234 3300005549 Unclassified 1988
72 Ga0070664_100000815 3300005564 Bacteria 23992
73 Ga0070664_100171608 3300005564 Bacteria 1924
74 Ga0070664_100380517 3300005564 Unclassified 1288
75 Ga0068857_100035159 3300005577 Unclassified 4435
76 Ga0068854_100282059 3300005578 Bacteria 1338
77 Ga0068859_100050140 3300005617 Bacteria 4193
78 Ga0068859_100106775 3300005617 Unclassified 2859
79 Ga0068864_100004837 3300005618 Bacteria 11037
80 Ga0068864_100008459 3300005618 Bacteria 8492
81 Ga0068864_100069981 3300005618 Bacteria 3052
82 Ga0068861_100060653 3300005719 Bacteria 2900
83 Ga0068870_10021807 3300005840 Bacteria 3139
84 Ga0068870_10044636 3300005840 Unclassified 2317
85 Ga0068863_100139571 3300005841 Bacteria 2316
86 Ga0068863_100309584 3300005841 Unclassified 1533
87 Ga0068858_100010084 3300005842 Bacteria 8969
88 Ga0068858_100014369 3300005842 Bacteria 7465
89 Ga0068862_100030081 3300005844 Unclassified 4576
90 Ga0068862_100232617 3300005844 Unclassified 1673
91 Ga0068862_100263574 3300005844 Unclassified 1574
92 Ga0075368_10015057 3300006042 Unclassified 2863
93 Ga0075367_10018138 3300006178 Bacteria 3877
94 Ga0075428_100000058 3300006844 Bacteria 89652
95 Ga0075428_100003359 3300006844 Bacteria 17508
96 Ga0075428_100011895 3300006844 Bacteria 9678
97 Ga0075428_100057380 3300006844 Bacteria 4262
98 Ga0075428_100401467 3300006844 Bacteria 1469
99 Ga0075430_100004782 3300006846 Bacteria 11393
100 Ga0075430_100027859 3300006846 Bacteria 4798
101 Ga0075430_100082962 3300006846 Bacteria 2686
102 Ga0075430_100245767 3300006846 Bacteria 1483
103 Ga0075430_100270232 3300006846 Bacteria 1407
104 Ga0075430_100323739 3300006846 Bacteria 1274
105 Ga0075431_100000575 3300006847 Bacteria 31085
106 Ga0075431_100005566 3300006847 Bacteria 12437
107 Ga0075431_100011056 3300006847 Bacteria 9084
108 Ga0075431_100029644 3300006847 Bacteria 5634
109 Ga0075431_100051771 3300006847 Bacteria 4233
110 Ga0075431_100332869 3300006847 Unclassified 1529
111 Ga0075433_10028773 3300006852 Bacteria 4727
112 Ga0075433_10102697 3300006852 Bacteria 2532
113 Ga0075433_10153298 3300006852 Bacteria 2050
114 Ga0075433_10463181 3300006852 Bacteria 1117
115 Ga0075434_100092294 3300006871 Bacteria 3030
116 Ga0075429_100030702 3300006880 Bacteria 4668
117 Ga0075429_100147442 3300006880 Bacteria 2060
118 Ga0075429_100266838 3300006880 Unclassified 1499
119 Ga0075429_100324196 3300006880 Unclassified 1348
120 Ga0075429_100412895 3300006880 Archaea 1182
121 Ga0068865_100006363 3300006881 Bacteria 7197
122 Ga0068865_100372336 3300006881 Bacteria 1163
123 Ga0075436_100018576 3300006914 Bacteria 4759
124 Ga0075436_100094805 3300006914 Bacteria 2075
125 Ga0075436_100149575 3300006914 Bacteria 1643
126 Ga0097620_100050139 3300006931 Bacteria 4193
127 Ga0097620_100106776 3300006931 Unclassified 2859
128 Ga0075435_100092845 3300007076 Bacteria 2493
129 Ga0075435_100274897 3300007076 Bacteria 1437
130 Ga0099794_10167696 3300007265 Unclassified 1119
131 Ga0111539_10001659 3300009094 Bacteria 29730
132 Ga0111539_10010444 3300009094 Bacteria 11688
133 Ga0111539_10149038 3300009094 Bacteria 2739
134 Ga0111539_10317390 3300009094 Bacteria 1813
135 Ga0105245_10075710 3300009098 Unclassified 3065
136 Ga0105245_10694544 3300009098 Bacteria 1050
137 Ga0105247_10076082 3300009101 Bacteria 2107
138 Ga0114129_10000574 3300009147 Bacteria 45251
139 Ga0114129_10002431 3300009147 Bacteria 25841
140 Ga0114129_10016156 3300009147 Bacteria 10621
141 Ga0114129_10024870 3300009147 Bacteria 8491
142 Ga0114129_10035360 3300009147 Bacteria 7057
143 Ga0114129_10039278 3300009147 Bacteria 6673
144 Ga0114129_10501587 3300009147 Unclassified 1585
145 Ga0114129_10507888 3300009147 Bacteria 1573
146 Ga0105243_10494190 3300009148 Unclassified 1158
147 Ga0105242_10007676 3300009176 Bacteria 8301
148 Ga0105248_10001544 3300009177 Bacteria 25631
149 Ga0105248_10064364 3300009177 Bacteria 4117
150 Ga0105238_10014720 3300009551 Bacteria 7910
151 Ga0105249_10000230 3300009553 Bacteria 63452
152 Ga0105249_10015751 3300009553 Bacteria 6697
153 Ga0105246_10206070 3300011119 Unclassified 1532
154 Ga0157374_10042507 3300013296 Unclassified 4192
155 Ga0163162_10941857 3300013306 Bacteria 975
156 Ga0157375_10120448 3300013308 Bacteria 2733
157 Ga0163163_10012986 3300014325 Bacteria 7608
158 Ga0163163_10070475 3300014325 Bacteria 3482
159 Ga0163163_10079825 3300014325 Bacteria 3270
160 Ga0157380_10046804 3300014326 Bacteria 3399
161 Ga0157380_10245338 3300014326 Bacteria 1617
162 Ga0157380_10267981 3300014326 Bacteria 1555
163 Ga0157377_10089178 3300014745 Bacteria 1818
164 Ga0163161_10192516 3300017792 Bacteria 1568
165 Ga0207697_10001789 3300025315 Bacteria 11503
166 Ga0207682_10006804 3300025893 Bacteria 4587
167 Ga0207710_10026978 3300025900 Bacteria 2484
168 Ga0207688_10012956 3300025901 Bacteria 4533
169 Ga0207688_10170515 3300025901 Bacteria 1294
170 Ga0207645_10130650 3300025907 Bacteria 1634
171 Ga0207643_10052306 3300025908 Bacteria 2319
172 Ga0207660_10069099 3300025917 Bacteria 2564
173 Ga0207662_10017757 3300025918 Bacteria 4028
174 Ga0207649_10005573 3300025920 Bacteria 6809
175 Ga0207646_10170567 3300025922 Unclassified 1965
176 Ga0207681_10029437 3300025923 Bacteria 3567
177 Ga0207681_10064047 3300025923 Unclassified 2537
178 Ga0207681_10068674 3300025923 Bacteria 2462
179 Ga0207650_10006479 3300025925 Bacteria 7976
180 Ga0207650_10070904 3300025925 Unclassified 2620
181 Ga0207659_10009073 3300025926 Bacteria 6206
182 Ga0207659_10024429 3300025926 Bacteria 4049
183 Ga0207659_10024871 3300025926 Bacteria 4019
184 Ga0207659_10080005 3300025926 Bacteria 2413
185 Ga0207659_10182441 3300025926 Bacteria 1664
186 Ga0207659_10217664 3300025926 Bacteria 1534
187 Ga0207687_10116918 3300025927 Bacteria 1988
188 Ga0207644_10119850 3300025931 Unclassified 2002
189 Ga0207706_10222966 3300025933 Bacteria 1650
190 Ga0207709_10381362 3300025935 Bacteria 1073
191 Ga0207670_10284930 3300025936 Bacteria 1289
192 Ga0207669_10071184 3300025937 Bacteria 2183
193 Ga0207704_10062574 3300025938 Bacteria 2315
194 Ga0207691_10031735 3300025940 Bacteria 4929
195 Ga0207691_10074037 3300025940 Unclassified 3072
196 Ga0207711_10098395 3300025941 Bacteria 2585
197 Ga0207711_10165917 3300025941 Bacteria 2002
198 Ga0207689_10005059 3300025942 Bacteria 11883
199 Ga0207661_10000567 3300025944 Bacteria 23624
200 Ga0207679_10006752 3300025945 Bacteria 7271
201 Ga0207679_10176358 3300025945 Unclassified 1765
202 Ga0207679_10380954 3300025945 Unclassified 1237
203 Ga0207651_10003088 3300025960 Bacteria 8094
204 Ga0207712_10037150 3300025961 Unclassified 3322
205 Ga0207668_10064437 3300025972 Bacteria 2590
206 Ga0207640_10046320 3300025981 Bacteria 2797
207 Ga0207640_10160186 3300025981 Bacteria 1664
208 Ga0207658_10057572 3300025986 Bacteria 2889
209 Ga0207658_10651560 3300025986 Unclassified 949
210 Ga0207703_10018422 3300026035 Bacteria 5453
211 Ga0207678_10092756 3300026067 Bacteria 2581
212 Ga0207678_10204471 3300026067 Bacteria 1689
213 Ga0207708_10015634 3300026075 Bacteria 5692
214 Ga0207641_10136961 3300026088 Bacteria 2205
215 Ga0207648_10043301 3300026089 Bacteria 3952
216 Ga0207676_10016732 3300026095 Bacteria 5309
217 Ga0207676_10082364 3300026095 Unclassified 2617
218 Ga0207674_10241712 3300026116 Bacteria 1752
219 Ga0207675_100025620 3300026118 Bacteria 5489
220 Ga0207675_100091207 3300026118 Bacteria 2865
221 Ga0207675_100762114 3300026118 Bacteria 979
222 Ga0207683_10015078 3300026121 Bacteria 6578
223 Ga0207683_10264884 3300026121 Bacteria 1569
224 Ga0209983_1017771 3300027665 Unclassified 1474
225 Ga0209974_10017594 3300027876 Bacteria 2370
226 Ga0207428_10053706 3300027907 Bacteria 3212
227 Ga0207428_10065736 3300027907 Unclassified 2860
228 Ga0268265_10048786 3300028380 Bacteria 3181
229 Ga0268265_10255185 3300028380 Bacteria 1556
230 Ga0268264_10061586 3300028381 Bacteria 3148
231 Ga0307408_100004647 3300031548 Bacteria 9281
232 Ga0307413_10042222 3300031824 Bacteria 2678
233 Ga0307413_10064007 3300031824 Bacteria 2283
234 Ga0307410_10005377 3300031852 Bacteria 6771
235 Ga0307406_10257525 3300031901 Bacteria 1318
236 Ga0307407_10144556 3300031903 Unclassified 1538
237 Ga0307412_10019250 3300031911 Bacteria 4128
238 Ga0307412_10142076 3300031911 Bacteria 1760
239 Ga0307412_10393135 3300031911 Bacteria 1126
240 Ga0307409_100588697 3300031995 Bacteria 1098
241 Ga0307416_100021177 3300032002 Bacteria 4661
242 Ga0307414_10157011 3300032004 Bacteria 1802
243 Ga0307411_10051352 3300032005 Bacteria 2689
244 Ga0307415_100098835 3300032126 Bacteria 2134
245 Ga0373947_0030160 3300035725 Bacteria 3186
246 Ga0439431_0037501 3300041997 Bacteria 1224
247 Ga0450923_011679 3300042125 Unclassified 1584
248 Ga0450894_000401 3300042131 Bacteria 7413
249 Ga0439446_0000727 3300042156 Bacteria 6880
250 Ga0439444_0031103 3300042437 Unclassified 1003
251 Ga0439464_0019142 3300042439 Bacteria 1868
252 Ga0450918_006728 3300042531 Unclassified 2046
253 Ga0451576_0124317 3300045051 Bacteria 2688
254 Ga0495603_0257914 3300046455 Bacteria 1004
255 Ga0495629_0125129 3300046459 Bacteria 1791
256 Ga0495598_0044805 3300046537 Unclassified 1308
257 Ga0495621_0090708 3300046539 Bacteria 1151
258 Ga0495656_0008191 3300046615 Bacteria 3723
259 Ga0495588_0088937 3300046674 Bacteria 1617
260 Ga0495669_0186131 3300046684 Unclassified 990
261 Ga0495670_0183298 3300046691 Bacteria 1106
262 Ga0495672_0019297 3300047320 Bacteria 4501
263 Ga0496100_0117383 3300048903 Archaea 1858
264 Ga0496100_0122733 3300048903 Bacteria 1820
265 Ga0496101_0191182 3300048904 Bacteria 1580
266 Ga0496102_0102660 3300048905 Bacteria 2658
267 Ga0496103_0061368 3300048906 Bacteria 2338
268 Ga0496104_0000157 3300048907 Bacteria 61755
269 Ga0496105_0036722 3300048908 Bacteria 4037
270 Ga0496106_0124411 3300048909 Bacteria 2018
271 Ga0496106_0414992 3300048909 Unclassified 1082
272 Ga0496108_0003499 3300048911 Bacteria 12586
273 Ga0496108_0037942 3300048911 Bacteria 4014
274 Ga0496109_0001109 3300048912 Bacteria 22334
275 Ga0496109_0060121 3300048912 Bacteria 3472
276 Ga0496110_0000063 3300048913 Bacteria 53033
277 Ga0496110_0012922 3300048913 Bacteria 6885
278 Ga0496111_0004348 3300048914 Bacteria 8942
279 Ga0496112_0000245 3300048915 Bacteria 34580
280 Ga0496112_0001819 3300048915 Bacteria 16770
281 Ga0496113_0009126 3300048916 Bacteria 6498
282 Ga0496113_0118073 3300048916 Bacteria 2071
283 Ga0496113_0198971 3300048916 Bacteria 1592
284 Ga0496114_0246971 3300048917 Unclassified 1570
285 Ga0496114_0526647 3300048917 Unclassified 1045
286 Ga0501299_022565 3300049522 Bacteria 1163
287 Ga0501031_0228462 3300049568 Archaea 1211
288 Ga0501033_0051665 3300049570 Bacteria 3047
289 Ga0501036_0040985 3300049572 Bacteria 3919
290 Ga0501036_0051255 3300049572 Bacteria 3494
291 Ga0501036_0165958 3300049572 Bacteria 1861
292 Ga0501036_0509383 3300049572 Unclassified 1001
293 Ga0501038_0044639 3300049574 Bacteria 3849
294 Ga0501038_0183605 3300049574 Archaea 1687
295 Ga0501039_0005151 3300049575 Bacteria 9906
296 Ga0501039_0116914 3300049575 Bacteria 2088
297 Ga0501040_0009429 3300049576 Bacteria 6364
298 Ga0501040_0011713 3300049576 Bacteria 5737
299 Ga0501040_0077490 3300049576 Unclassified 2300
300 Ga0501040_0166786 3300049576 Archaea 1558
301 Ga0501041_0004387 3300049577 Bacteria 8163
302 Ga0501041_0077996 3300049577 Unclassified 2038
303 Ga0501041_0268940 3300049577 Unclassified 1072
304 Ga0501042_0018695 3300049578 Unclassified 4802
305 Ga0501042_0039371 3300049578 Bacteria 3358
306 Ga0501042_0064097 3300049578 Unclassified 2626
307 Ga0501043_0140686 3300049579 Bacteria 1890
308 Ga0501046_0009280 3300049580 Bacteria 8518
309 Ga0501046_0094844 3300049580 Bacteria 2293
310 Ga0501048_0022022 3300049582 Bacteria 4665
311 Ga0501048_0078032 3300049582 Bacteria 2337
312 Ga0501048_0159820 3300049582 Bacteria 1594
313 Ga0501068_0087161 3300049584 Bacteria 1922
314 Ga0501071_0005305 3300049587 Bacteria 8268
315 Ga0501071_0024036 3300049587 Unclassified 4260
316 Ga0501071_0024622 3300049587 Unclassified 4210
317 Ga0501072_0016986 3300049588 Bacteria 5593
318 Ga0501072_0024800 3300049588 Unclassified 4668
319 Ga0501072_0049533 3300049588 Bacteria 3307
320 Ga0501072_0054156 3300049588 Unclassified 3160
321 Ga0501072_0247103 3300049588 Bacteria 1421
322 Ga0501073_0130468 3300049589 Bacteria 1742
323 Ga0501074_0110827 3300049590 Bacteria 1964
324 Ga0501074_0243049 3300049590 Archaea 1280
325 Ga0501075_0002005 3300049591 Bacteria 13459
326 Ga0501075_0021828 3300049591 Unclassified 4671
327 Ga0501075_0024553 3300049591 Unclassified 4422
328 Ga0501075_0102005 3300049591 Bacteria 2179
329 Ga0501075_0224636 3300049591 Bacteria 1432
330 Ga0501076_0002524 3300049592 Bacteria 12598
331 Ga0501076_0327603 3300049592 Bacteria 1256
332 Ga0501076_0433472 3300049592 Bacteria 1082
333 Ga0501077_0109437 3300049593 Unclassified 1751
334 Ga0501077_0172675 3300049593 Bacteria 1373
335 Ga0501077_0174145 3300049593 Unclassified 1367
336 Ga0501079_0008541 3300049741 Bacteria 7769
337 Ga0501079_0049276 3300049741 Unclassified 3251
338 Ga0501079_0194245 3300049741 Unclassified 1584
339 Ga0501079_0322454 3300049741 Bacteria 1209
340 Ga0501079_0355499 3300049741 Bacteria 1148
341 Ga0501080_0080770 3300049742 Bacteria 3022
342 Ga0501080_0242696 3300049742 Bacteria 1644
343 Ga0501080_0274065 3300049742 Bacteria 1535
344 Ga0501081_0025132 3300049743 Unclassified 4004
345 Ga0501045_0028545 3300049824 Bacteria 4026
346 Ga0501045_0059258 3300049824 Bacteria 2804
347 Ga0501045_0171118 3300049824 Unclassified 1618
348 Ga0501045_0585704 3300049824 Archaea 826
349 nmdc:mga06z11_29725_c1 3300050494 Bacteria 2635
350 nmdc:mga04h51_137798_c1 3300050495 Bacteria 923
351 nmdc:mga07m45_215667_c1 3300050496 Bacteria 1116
352 nmdc:mga05p37_22397_c1 3300050507 Bacteria 7663
353 nmdc:mga05p37_30932_c1 3300050507 Bacteria 6536
354 nmdc:mga05p37_397548_c1 3300050507 Unclassified 1610
355 nmdc:mga05p37_5528_c1 3300050507 Bacteria 14843
356 nmdc:mga05p37_562640_c1 3300050507 Bacteria 1295
357 nmdc:mga05p37_569_c2 3300050507 Bacteria 24307
358 nmdc:mga09592_325932_c1 3300050508 Bacteria 1330
359 nmdc:mga09592_612648_c1 3300050508 Unclassified 932
360 nmdc:mga09592_619793_c1 3300050508 Bacteria 926
361 nmdc:mga09592_68791_c1 3300050508 Unclassified 3003
362 nmdc:mga09592_80041_c1 3300050508 Bacteria 2782
363 nmdc:mga0qj67_20350_c1 3300050509 Bacteria 5078
364 nmdc:mga0qj67_246621_c1 3300050509 Unclassified 1449
365 nmdc:mga0qj67_33629_c1 3300050509 Unclassified 4001
366 nmdc:mga0qj67_349243_c1 3300050509 Bacteria 1196
367 nmdc:mga0qj67_73092_c1 3300050509 Bacteria 2739
368 nmdc:mga06r32_22778_c1 3300050510 Bacteria 5793
369 nmdc:mga06r32_31301_c1 3300050510 Unclassified 4996
370 nmdc:mga06r32_3980_c1 3300050510 Bacteria 13238
371 nmdc:mga06r32_51492_c1 3300050510 Bacteria 3941
372 nmdc:mga06r32_70184_c1 3300050510 Bacteria 3387
373 nmdc:mga06r32_77048_c1 3300050510 Bacteria 3238
374 nmdc:mga06r32_91991_c1 3300050510 Bacteria 2965
375 nmdc:mga08y16_152501_c1 3300050511 Bacteria 2402
376 nmdc:mga08y16_16284_c1 3300050511 Bacteria 7817
377 nmdc:mga08y16_283557_c1 3300050511 Bacteria 1708
378 nmdc:mga08y16_4308_c1 3300050511 Bacteria 14860
379 nmdc:mga08y16_7279_c1 3300050511 Bacteria 11615
380 nmdc:mga0n895_111055_c1 3300050512 Bacteria 2757
381 nmdc:mga0n895_139334_c1 3300050512 Bacteria 2454
382 nmdc:mga0n895_329162_c1 3300050512 Bacteria 1548
383 nmdc:mga0rr50_22440_c1 3300050513 Bacteria 4332
384 nmdc:mga0rr50_51408_c1 3300050513 Bacteria 3057
385 nmdc:mga0rr50_96635_c1 3300050513 Bacteria 2312
386 nmdc:mga08x19_200633_c1 3300050514 Bacteria 1367
387 nmdc:mga08x19_37467_c1 3300050514 Bacteria 3078
388 nmdc:mga0a205_220366_c1 3300050515 Bacteria 1783
389 nmdc:mga0a205_264247_c1 3300050515 Bacteria 1598
390 nmdc:mga0a205_4916_c3 3300050515 Bacteria 7465
391 nmdc:mga0a205_561738_c1 3300050515 Unclassified 996
392 nmdc:mga0a205_66435_c1 3300050515 Bacteria 3485
393 Ga0500555_000060 3300053103 Bacteria 55800
394 Ga0500645_000804 3300053730 Bacteria 18829
395 Ga0501084_0045772 3300054114 Bacteria 3662
396 Ga0501084_0100492 3300054114 Bacteria 2429
397 Ga0501084_0102216 3300054114 Bacteria 2407
398 Ga0501084_0364684 3300054114 Unclassified 1221
399 Ga0590071_000184 3300059421 Bacteria 18178
400 Ga0590071_000473 3300059421 Bacteria 11715
401 Ga0590071_005869 3300059421 Bacteria 2944
402 Ga0590074_000189 3300059423 Bacteria 7784
403 Ga0590074_002352 3300059423 Bacteria 3103
404 Ga0590074_012770 3300059423 Bacteria 1414
405 Ga0590075_000037 3300059424 Bacteria 35204
406 Ga0590075_001920 3300059424 Bacteria 5035
407 Ga0590075_003071 3300059424 Bacteria 3961
408 Ga0590075_041765 3300059424 Bacteria 1172
409 Ga0590077_000011 3300059426 Bacteria 41505
410 Ga0590077_000704 3300059426 Bacteria 8838
411 Ga0590077_009640 3300059426 Bacteria 1984
412 Ga0501082_0041301 3300060353 Bacteria 3976
413 Ga0530510_0015218 3300061734 Bacteria 5432
414 Ga0530510_0126245 3300061734 Unclassified 1881
415 Ga0530510_0188065 3300061734 Bacteria 1532
416 Ga0530510_0216251 3300061734 Bacteria 1424
417 Ga0530510_0267358 3300061734 Bacteria 1276
418 Ga0500641_0006015
419 Ga0065712_10067822
420 Ga0065712_10068497
421 Ga0065712_10161427
422 Ga0065715_10000735
423 Ga0065715_10027137
424 Ga0065707_10141982
425 Ga0065707_10171124
426 Ga0070683_100000767
427 Ga0070683_100231404
428 Ga0070670_100004468
429 Ga0070670_100009066
430 Ga0068869_100033601
431 Ga0070666_10043583
432 Ga0070680_100506876
433 Ga0070682_100137008
434 Ga0070689_100084160
435 Ga0070687_100067444
436 Ga0070661_100115626
437 Ga0070668_100083484
438 Ga0070668_100471917
439 Ga0070669_100000166
440 Ga0070669_100075970
441 Ga0070675_100004987
442 Ga0070675_100101643
443 Ga0070675_100102684
444 Ga0070675_100106424
445 Ga0070675_100153196
446 Ga0070675_100220641
447 Ga0070675_100296841
448 Ga0070674_100004110
449 Ga0070674_100015644
450 Ga0070674_100116332
451 Ga0070673_100012507
452 Ga0070673_100100883
453 Ga0070673_100206671
454 Ga0070688_100167499
455 Ga0070688_100328792
456 Ga0070667_100200203
457 Ga0070667_100594752
458 Ga0070701_10010888
459 Ga0070705_100326605
460 Ga0070700_100035745
461 Ga0070694_100051020
462 Ga0070694_100073271
463 Ga0070694_100137092
464 Ga0070663_100196995
465 Ga0070663_100341541
466 Ga0070678_100050728
467 Ga0070678_100133929
468 Ga0070678_100239669
469 Ga0068867_100007110
470 Ga0070707_100202874
471 Ga0070707_100490455
472 Ga0070699_100064197
473 Ga0070684_100004962
474 Ga0070697_100053825
475 Ga0070697_100254805
476 Ga0070672_100075187
477 Ga0070672_100150621
478 Ga0070672_100239056
479 Ga0070686_100042146
480 Ga0070686_100079560
481 Ga0070686_100221031
482 Ga0070686_100251404
483 Ga0070695_100003169
484 Ga0070696_100010323
485 Ga0070665_100007148
486 Ga0070665_100251039
487 Ga0070704_100046417
488 Ga0070704_100124234
489 Ga0070664_100000815
490 Ga0070664_100171608
491 Ga0070664_100380517
492 Ga0068857_100035159
493 Ga0068854_100282059
494 Ga0068859_100050140
495 Ga0068859_100106775
496 Ga0068864_100004837
497 Ga0068864_100008459
498 Ga0068864_100069981
499 Ga0068861_100060653
500 Ga0068870_10021807
501 Ga0068870_10044636
502 Ga0068863_100139571
503 Ga0068863_100309584
504 Ga0068858_100010084
505 Ga0068858_100014369
506 Ga0068862_100030081
507 Ga0068862_100232617
508 Ga0068862_100263574
509 Ga0075368_10015057
510 Ga0075367_10018138
511 Ga0075428_100000058
512 Ga0075428_100003359
513 Ga0075428_100011895
514 Ga0075428_100057380
515 Ga0075428_100401467
516 Ga0075430_100004782
517 Ga0075430_100027859
518 Ga0075430_100082962
519 Ga0075430_100245767
520 Ga0075430_100270232
521 Ga0075430_100323739
522 Ga0075431_100000575
523 Ga0075431_100005566
524 Ga0075431_100011056
525 Ga0075431_100029644
526 Ga0075431_100051771
527 Ga0075431_100332869
528 Ga0075433_10028773
529 Ga0075433_10102697
530 Ga0075433_10153298
531 Ga0075433_10463181
532 Ga0075434_100092294
533 Ga0075429_100030702
534 Ga0075429_100147442
535 Ga0075429_100266838
536 Ga0075429_100324196
537 Ga0075429_100412895
538 Ga0068865_100006363
539 Ga0068865_100372336
540 Ga0075436_100018576
541 Ga0075436_100094805
542 Ga0075436_100149575
543 Ga0097620_100050139
544 Ga0097620_100106776
545 Ga0075435_100092845
546 Ga0075435_100274897
547 Ga0099794_10167696
548 Ga0111539_10001659
549 Ga0111539_10010444
550 Ga0111539_10149038
551 Ga0111539_10317390
552 Ga0105245_10075710
553 Ga0105245_10694544
554 Ga0105247_10076082
555 Ga0114129_10000574
556 Ga0114129_10002431
557 Ga0114129_10016156
558 Ga0114129_10024870
559 Ga0114129_10035360
560 Ga0114129_10039278
561 Ga0114129_10501587
562 Ga0114129_10507888
563 Ga0105243_10494190
564 Ga0105242_10007676
565 Ga0105248_10001544
566 Ga0105248_10064364
567 Ga0105238_10014720
568 Ga0105249_10000230
569 Ga0105249_10015751
570 Ga0105246_10206070
571 Ga0157374_10042507
572 Ga0163162_10941857
573 Ga0157375_10120448
574 Ga0163163_10012986
575 Ga0163163_10070475
576 Ga0163163_10079825
577 Ga0157380_10046804
578 Ga0157380_10245338
579 Ga0157380_10267981
580 Ga0157377_10089178
581 Ga0163161_10192516
582 Ga0207697_10001789
583 Ga0207682_10006804
584 Ga0207710_10026978
585 Ga0207688_10012956
586 Ga0207688_10170515
587 Ga0207645_10130650
588 Ga0207643_10052306
589 Ga0207660_10069099
590 Ga0207662_10017757
591 Ga0207649_10005573
592 Ga0207646_10170567
593 Ga0207681_10029437
594 Ga0207681_10064047
595 Ga0207681_10068674
596 Ga0207650_10006479
597 Ga0207650_10070904
598 Ga0207659_10009073
599 Ga0207659_10024429
600 Ga0207659_10024871
601 Ga0207659_10080005
602 Ga0207659_10182441
603 Ga0207659_10217664
604 Ga0207687_10116918
605 Ga0207644_10119850
606 Ga0207706_10222966
607 Ga0207709_10381362
608 Ga0207670_10284930
609 Ga0207669_10071184
610 Ga0207704_10062574
611 Ga0207691_10031735
612 Ga0207691_10074037
613 Ga0207711_10098395
614 Ga0207711_10165917
615 Ga0207689_10005059
616 Ga0207661_10000567
617 Ga0207679_10006752
618 Ga0207679_10176358
619 Ga0207679_10380954
620 Ga0207651_10003088
621 Ga0207712_10037150
622 Ga0207668_10064437
623 Ga0207640_10046320
624 Ga0207640_10160186
625 Ga0207658_10057572
626 Ga0207658_10651560
627 Ga0207703_10018422
628 Ga0207678_10092756
629 Ga0207678_10204471
630 Ga0207708_10015634
631 Ga0207641_10136961
632 Ga0207648_10043301
633 Ga0207676_10016732
634 Ga0207676_10082364
635 Ga0207674_10241712
636 Ga0207675_100025620
637 Ga0207675_100091207
638 Ga0207675_100762114
639 Ga0207683_10015078
640 Ga0207683_10264884
641 Ga0209983_1017771
642 Ga0209974_10017594
643 Ga0207428_10053706
644 Ga0207428_10065736
645 Ga0268265_10048786
646 Ga0268265_10255185
647 Ga0268264_10061586
648 Ga0307408_100004647
649 Ga0307413_10042222
650 Ga0307413_10064007
651 Ga0307410_10005377
652 Ga0307406_10257525
653 Ga0307407_10144556
654 Ga0307412_10019250
655 Ga0307412_10142076
656 Ga0307412_10393135
657 Ga0307409_100588697
658 Ga0307416_100021177
659 Ga0307414_10157011
660 Ga0307411_10051352
661 Ga0307415_100098835
662 Ga0373947_0030160
663 Ga0439431_0037501
664 Ga0450923_011679
665 Ga0450894_000401
666 Ga0439446_0000727
667 Ga0439444_0031103
668 Ga0439464_0019142
669 Ga0450918_006728
670 Ga0451576_0124317
671 Ga0495603_0257914
672 Ga0495629_0125129
673 Ga0495598_0044805
674 Ga0495621_0090708
675 Ga0495656_0008191
676 Ga0495588_0088937
677 Ga0495669_0186131
678 Ga0495670_0183298
679 Ga0495672_0019297
680 Ga0496100_0117383
681 Ga0496100_0122733
682 Ga0496101_0191182
683 Ga0496102_0102660
684 Ga0496103_0061368
685 Ga0496104_0000157
686 Ga0496105_0036722
687 Ga0496106_0124411
688 Ga0496106_0414992
689 Ga0496108_0003499
690 Ga0496108_0037942
691 Ga0496109_0001109
692 Ga0496109_0060121
693 Ga0496110_0000063
694 Ga0496110_0012922
695 Ga0496111_0004348
696 Ga0496112_0000245
697 Ga0496112_0001819
698 Ga0496113_0009126
699 Ga0496113_0118073
700 Ga0496113_0198971
701 Ga0496114_0246971
702 Ga0496114_0526647
703 Ga0501299_022565
704 Ga0501031_0228462
705 Ga0501033_0051665
706 Ga0501036_0040985
707 Ga0501036_0051255
708 Ga0501036_0165958
709 Ga0501036_0509383
710 Ga0501038_0044639
711 Ga0501038_0183605
712 Ga0501039_0005151
713 Ga0501039_0116914
714 Ga0501040_0009429
715 Ga0501040_0011713
716 Ga0501040_0077490
717 Ga0501040_0166786
718 Ga0501041_0004387
719 Ga0501041_0077996
720 Ga0501041_0268940
721 Ga0501042_0018695
722 Ga0501042_0039371
723 Ga0501042_0064097
724 Ga0501043_0140686
725 Ga0501046_0009280
726 Ga0501046_0094844
727 Ga0501048_0022022
728 Ga0501048_0078032
729 Ga0501048_0159820
730 Ga0501068_0087161
731 Ga0501071_0005305
732 Ga0501071_0024036
733 Ga0501071_0024622
734 Ga0501072_0016986
735 Ga0501072_0024800
736 Ga0501072_0049533
737 Ga0501072_0054156
738 Ga0501072_0247103
739 Ga0501073_0130468
740 Ga0501074_0110827
741 Ga0501074_0243049
742 Ga0501075_0002005
743 Ga0501075_0021828
744 Ga0501075_0024553
745 Ga0501075_0102005
746 Ga0501075_0224636
747 Ga0501076_0002524
748 Ga0501076_0327603
749 Ga0501076_0433472
750 Ga0501077_0109437
751 Ga0501077_0172675
752 Ga0501077_0174145
753 Ga0501079_0008541
754 Ga0501079_0049276
755 Ga0501079_0194245
756 Ga0501079_0322454
757 Ga0501079_0355499
758 Ga0501080_0080770
759 Ga0501080_0242696
760 Ga0501080_0274065
761 Ga0501081_0025132
762 Ga0501045_0028545
763 Ga0501045_0059258
764 Ga0501045_0171118
765 Ga0501045_0585704
766 nmdc:mga06z11_29725_c1
767 nmdc:mga04h51_137798_c1
768 nmdc:mga07m45_215667_c1
769 nmdc:mga05p37_22397_c1
770 nmdc:mga05p37_30932_c1
771 nmdc:mga05p37_397548_c1
772 nmdc:mga05p37_5528_c1
773 nmdc:mga05p37_562640_c1
774 nmdc:mga05p37_569_c2
775 nmdc:mga09592_325932_c1
776 nmdc:mga09592_612648_c1
777 nmdc:mga09592_619793_c1
778 nmdc:mga09592_68791_c1
779 nmdc:mga09592_80041_c1
780 nmdc:mga0qj67_20350_c1
781 nmdc:mga0qj67_246621_c1
782 nmdc:mga0qj67_33629_c1
783 nmdc:mga0qj67_349243_c1
784 nmdc:mga0qj67_73092_c1
785 nmdc:mga06r32_22778_c1
786 nmdc:mga06r32_31301_c1
787 nmdc:mga06r32_3980_c1
788 nmdc:mga06r32_51492_c1
789 nmdc:mga06r32_70184_c1
790 nmdc:mga06r32_77048_c1
791 nmdc:mga06r32_91991_c1
792 nmdc:mga08y16_152501_c1
793 nmdc:mga08y16_16284_c1
794 nmdc:mga08y16_283557_c1
795 nmdc:mga08y16_4308_c1
796 nmdc:mga08y16_7279_c1
797 nmdc:mga0n895_111055_c1
798 nmdc:mga0n895_139334_c1
799 nmdc:mga0n895_329162_c1
800 nmdc:mga0rr50_22440_c1
801 nmdc:mga0rr50_51408_c1
802 nmdc:mga0rr50_96635_c1
803 nmdc:mga08x19_200633_c1
804 nmdc:mga08x19_37467_c1
805 nmdc:mga0a205_220366_c1
806 nmdc:mga0a205_264247_c1
807 nmdc:mga0a205_4916_c3
808 nmdc:mga0a205_561738_c1
809 nmdc:mga0a205_66435_c1
810 Ga0500555_000060
811 Ga0500645_000804
812 Ga0501084_0045772
813 Ga0501084_0100492
814 Ga0501084_0102216
815 Ga0501084_0364684
816 Ga0590071_000184
817 Ga0590071_000473
818 Ga0590071_005869
819 Ga0590074_000189
820 Ga0590074_002352
821 Ga0590074_012770
822 Ga0590075_000037
823 Ga0590075_001920
824 Ga0590075_003071
825 Ga0590075_041765
826 Ga0590077_000011
827 Ga0590077_000704
828 Ga0590077_009640
829 Ga0501082_0041301
830 Ga0530510_0015218
831 Ga0530510_0126245
832 Ga0530510_0188065
833 Ga0530510_0216251
834 Ga0530510_0267358

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

42

140

0.93

PF13847

Methyltransf_31

Methyltransferase domain

35

180

0.89

PF13649

Methyltransf_25

Methyltransferase domain

41

136

0.88

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

4

167

0.8

PF08242

Methyltransf_12

Methyltransferase domain

42

138

0.76

PF13489

Methyltransf_23

Methyltransferase domain

13

190

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wwq-assembly2.cif.gz_B crystal structure of human nsun6 0.8399 26 141
2xva-assembly3.cif.gz_C crystal structure of the tellurite detoxification protein tehb from e. coli in complex with sinefungin 0.837 24 141
5wws-assembly2.cif.gz_B crystal structure of human nsun6/trna/sam 0.8362 22 141
5wwt-assembly2.cif.gz_B crystal structure of human nsun6/trna 0.8354 22 141
5wws-assembly1.cif.gz_A crystal structure of human nsun6/trna/sam 0.8344 22 141
ID Description Score Start End Superfamily
af_I1L8V0_149_258_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9379 98 141 3.40.50.150
af_Q553T0_166_421_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.933 24 140 3.40.50.150
af_Q9TYP1_15_268_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9238 24 140 3.40.50.150
af_A0A0P0Y1E1_35_188_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9191 24 140 3.40.50.150
af_A0A1D6HVT5_39_298_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9127 24 140 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7K3ZJI3-F1-model_v4 Class I SAM-dependent methyltransferase 0.9371 40 144 GO:0008757
GO:0032259
AF-A0A7V1JKX9-F1-model_v4 Class I SAM-dependent methyltransferase 0.9367 24 140 GO:0008168
GO:0032259
AF-A0A1F8RDI3-F1-model_v4 Methyltransferase domain-containing protein 0.9267 32 144 GO:0008168
GO:0032259
AF-X0WAV2-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9246 30 140 GO:0008757
AF-A0A3A0DMZ2-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9119 24 143 GO:0008757

Map