F439118

General Info

Members Datasets Scaffolds Average Seq Length
417 273 834 87

Family's Representative Sequence

Representative Sequence 3300041494|Ga0451837_0378763|Ga0451837_0378763_382_693
Length 103
Sequence MEEWLPRTMRTSLGRHDHHDDQRGTGFTPRQREVVALIAAGCSNDEVGERLGISPRTAKAHSDTLRSKLGVSRRRQIPVAFRVLTGEDPLSASLGALHRPPGV

Samples

Sample ID Description Type Environment
1 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
2 3300001228 Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_joined Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
110 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
126 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
144 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
145 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
146 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
147 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
148 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
149 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
150 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
153 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
154 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
155 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
158 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
159 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
160 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
161 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
162 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
163 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
268 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
270 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0
Rhizoplane 8.63
Rhizosphere 87.77
Stem 0
Stem Tuber 0
Unclassified 33.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451837_0378763 3300041494 Unclassified 827
2 SwM_106392 3300001228 Unclassified 512
3 Ga0070683_100066496 3300005329 Bacteria 3358
4 Ga0070683_100698316 3300005329 Unclassified 972
5 Ga0070683_101235752 3300005329 Unclassified 718
6 Ga0070683_101742908 3300005329 Bacteria 599
7 Ga0070680_100107124 3300005336 Bacteria 2325
8 Ga0070682_100175238 3300005337 Bacteria 1493
9 Ga0070682_100822188 3300005337 Unclassified 757
10 Ga0068868_100049762 3300005338 Bacteria 3289
11 Ga0068868_100387310 3300005338 Bacteria 1204
12 Ga0068868_100865390 3300005338 Bacteria 819
13 Ga0070689_101372964 3300005340 Bacteria 638
14 Ga0070689_101857156 3300005340 Bacteria 550
15 Ga0070691_10411948 3300005341 Bacteria 764
16 Ga0070687_101083332 3300005343 Bacteria 585
17 Ga0070668_100861519 3300005347 Bacteria 808
18 Ga0070675_100138836 3300005354 Bacteria 2076
19 Ga0070671_100028916 3300005355 Bacteria 4568
20 Ga0070673_100449411 3300005364 Unclassified 1159
21 Ga0070673_100505373 3300005364 Bacteria 1094
22 Ga0070688_101381530 3300005365 Unclassified 570
23 Ga0070667_101293342 3300005367 Bacteria 683
24 Ga0070701_10513702 3300005438 Bacteria 780
25 Ga0070700_101433381 3300005441 Unclassified 585
26 Ga0070694_100937595 3300005444 Unclassified 716
27 Ga0070708_100550793 3300005445 Bacteria 1088
28 Ga0070708_100711436 3300005445 Bacteria 945
29 Ga0070708_101217971 3300005445 Bacteria 704
30 Ga0070708_101257591 3300005445 Unclassified 692
31 Ga0070663_100335549 3300005455 Bacteria 1220
32 Ga0070663_101779994 3300005455 Unclassified 552
33 Ga0070678_100010738 3300005456 Bacteria 5610
34 Ga0070678_101606290 3300005456 Bacteria 610
35 Ga0070678_102199128 3300005456 Bacteria 523
36 Ga0070681_10031952 3300005458 Bacteria 5285
37 Ga0068867_100318364 3300005459 Bacteria 1288
38 Ga0068867_102237369 3300005459 Unclassified 519
39 Ga0070706_100867918 3300005467 Unclassified 834
40 Ga0070707_101334510 3300005468 Archaea 684
41 Ga0070707_101655805 3300005468 Unclassified 607
42 Ga0070698_100847926 3300005471 Bacteria 859
43 Ga0070699_101405241 3300005518 Unclassified 640
44 Ga0070679_100062112 3300005530 Bacteria 3724
45 Ga0070684_100008589 3300005535 Bacteria 7999
46 Ga0070684_100789156 3300005535 Bacteria 887
47 Ga0070684_100966896 3300005535 Bacteria 799
48 Ga0070697_100423147 3300005536 Bacteria 1157
49 Ga0070672_100380179 3300005543 Bacteria 1208
50 Ga0070686_101492615 3300005544 Bacteria 569
51 Ga0070696_100294510 3300005546 Unclassified 1241
52 Ga0070693_100005152 3300005547 Bacteria 6248
53 Ga0070693_101320731 3300005547 Unclassified 558
54 Ga0070665_100860312 3300005548 Bacteria 920
55 Ga0070704_101693634 3300005549 Bacteria 584
56 Ga0070704_101761638 3300005549 Unclassified 573
57 Ga0070664_100205477 3300005564 Bacteria 1759
58 Ga0068854_101001648 3300005578 Unclassified 740
59 Ga0068856_100074812 3300005614 Bacteria 3354
60 Ga0070702_100903053 3300005615 Unclassified 692
61 Ga0068859_100854193 3300005617 Bacteria 996
62 Ga0068866_11051422 3300005718 Unclassified 581
63 Ga0068861_102413400 3300005719 Unclassified 529
64 Ga0068861_102576368 3300005719 Unclassified 512
65 Ga0068870_10284851 3300005840 Bacteria 1037
66 Ga0068860_101000193 3300005843 Bacteria 854
67 Ga0081455_10051152 3300005937 Unclassified 3545
68 Ga0081455_10343514 3300005937 Unclassified 1055
69 Ga0081538_10109301 3300005981 Unclassified 1362
70 Ga0075365_10008532 3300006038 Bacteria 5827
71 Ga0075365_10869854 3300006038 Bacteria 636
72 Ga0075432_10448543 3300006058 Unclassified 566
73 Ga0070712_100254984 3300006175 Bacteria 1403
74 Ga0075362_10576638 3300006177 Bacteria 580
75 Ga0075367_10438801 3300006178 Bacteria 827
76 Ga0097621_101098119 3300006237 Unclassified 747
77 Ga0068871_100795030 3300006358 Unclassified 872
78 Ga0075428_101082157 3300006844 Bacteria 847
79 Ga0075428_102247289 3300006844 Unclassified 562
80 Ga0075430_101431367 3300006846 Unclassified 568
81 Ga0075431_101006501 3300006847 Bacteria 800
82 Ga0075433_10504675 3300006852 Bacteria 1065
83 Ga0075434_100191347 3300006871 Unclassified 2067
84 Ga0075434_100313927 3300006871 Bacteria 1588
85 Ga0075429_100843692 3300006880 Unclassified 802
86 Ga0068865_100325007 3300006881 Bacteria 1239
87 Ga0068865_101179786 3300006881 Bacteria 677
88 Ga0068865_101421204 3300006881 Unclassified 620
89 Ga0068865_101481955 3300006881 Bacteria 607
90 Ga0075436_100794887 3300006914 Bacteria 704
91 Ga0097620_100854232 3300006931 Bacteria 996
92 Ga0111539_10676710 3300009094 Unclassified 1201
93 Ga0111539_10748886 3300009094 Bacteria 1137
94 Ga0111539_11026486 3300009094 Unclassified 959
95 Ga0105245_10013367 3300009098 Bacteria 7155
96 Ga0105245_10087374 3300009098 Bacteria 2862
97 Ga0105245_10209192 3300009098 Bacteria 1877
98 Ga0105245_10328588 3300009098 Bacteria 1508
99 Ga0105245_10984607 3300009098 Unclassified 887
100 Ga0105245_11123531 3300009098 Unclassified 832
101 Ga0105245_11318826 3300009098 Unclassified 771
102 Ga0105247_10969425 3300009101 Bacteria 662
103 Ga0105247_11516332 3300009101 Unclassified 547
104 Ga0114129_10309846 3300009147 Bacteria 2102
105 Ga0114129_10378859 3300009147 Bacteria 1869
106 Ga0114129_11798943 3300009147 Bacteria 745
107 Ga0114129_12299529 3300009147 Unclassified 647
108 Ga0105243_10256836 3300009148 Bacteria 1563
109 Ga0105243_11602135 3300009148 Unclassified 678
110 Ga0105243_12522927 3300009148 Unclassified 553
111 Ga0105241_10313308 3300009174 Bacteria 1350
112 Ga0105241_12000400 3300009174 Unclassified 570
113 Ga0105242_10075324 3300009176 Bacteria 2809
114 Ga0105242_10367164 3300009176 Unclassified 1334
115 Ga0105242_11109685 3300009176 Bacteria 805
116 Ga0105242_11894115 3300009176 Bacteria 637
117 Ga0105248_10538842 3300009177 Bacteria 1316
118 Ga0105248_11125786 3300009177 Unclassified 887
119 Ga0105248_11635564 3300009177 Unclassified 730
120 Ga0105248_12374136 3300009177 Unclassified 604
121 Ga0105237_10948510 3300009545 Bacteria 867
122 Ga0105237_11122500 3300009545 Bacteria 793
123 Ga0105238_10648037 3300009551 Bacteria 1066
124 Ga0105238_11482099 3300009551 Unclassified 707
125 Ga0105249_11578228 3300009553 Unclassified 729
126 Ga0105239_10809312 3300010375 Unclassified 1074
127 Ga0105239_10955112 3300010375 Bacteria 985
128 Ga0105239_11893486 3300010375 Bacteria 692
129 Ga0105239_12071890 3300010375 Unclassified 661
130 Ga0105246_10372125 3300011119 Unclassified 1178
131 Ga0105246_10857688 3300011119 Unclassified 811
132 Ga0105246_10897972 3300011119 Unclassified 794
133 Ga0157339_1040795 3300012505 Bacteria 581
134 Ga0157371_11475358 3300013102 Bacteria 530
135 Ga0157369_10622902 3300013105 Bacteria 1113
136 Ga0157374_10073955 3300013296 Unclassified 3217
137 Ga0157374_10468026 3300013296 Bacteria 1263
138 Ga0157374_11036554 3300013296 Bacteria 840
139 Ga0157378_10692444 3300013297 Bacteria 1038
140 Ga0157378_10759052 3300013297 Unclassified 993
141 Ga0157378_11184075 3300013297 Bacteria 803
142 Ga0157378_12082746 3300013297 Unclassified 618
143 Ga0163162_10440576 3300013306 Bacteria 1435
144 Ga0163162_11032934 3300013306 Bacteria 930
145 Ga0157372_11944953 3300013307 Bacteria 676
146 Ga0157375_10333469 3300013308 Bacteria 1682
147 Ga0157375_10335928 3300013308 Bacteria 1676
148 Ga0157375_11311794 3300013308 Unclassified 851
149 Ga0157375_11802634 3300013308 Bacteria 725
150 Ga0163163_10654510 3300014325 Bacteria 1114
151 Ga0163163_10731598 3300014325 Bacteria 1053
152 Ga0157380_10191832 3300014326 Unclassified 1805
153 Ga0157380_11224765 3300014326 Unclassified 795
154 Ga0157380_11282591 3300014326 Unclassified 779
155 Ga0157377_10032665 3300014745 Bacteria 2836
156 Ga0157379_11133072 3300014968 Bacteria 750
157 Ga0157379_11718805 3300014968 Unclassified 615
158 Ga0157376_10495429 3300014969 Bacteria 1200
159 Ga0157376_10943048 3300014969 Unclassified 883
160 Ga0163161_10547377 3300017792 Unclassified 948
161 Ga0207693_10413701 3300025915 Bacteria 1054
162 Ga0207693_10681436 3300025915 Unclassified 797
163 Ga0207662_10455574 3300025918 Bacteria 875
164 Ga0207646_10027599 3300025922 Bacteria 5175
165 Ga0207694_11812073 3300025924 Unclassified 513
166 Ga0207687_10312558 3300025927 Bacteria 1269
167 Ga0207687_10387662 3300025927 Unclassified 1146
168 Ga0207644_10050639 3300025931 Bacteria 2978
169 Ga0207686_10191923 3300025934 Bacteria 1457
170 Ga0207686_10634287 3300025934 Unclassified 844
171 Ga0207669_10556362 3300025937 Unclassified 926
172 Ga0207669_10707121 3300025937 Bacteria 829
173 Ga0207669_11242795 3300025937 Bacteria 632
174 Ga0207704_11401681 3300025938 Unclassified 599
175 Ga0207711_10460562 3300025941 Unclassified 1184
176 Ga0207661_10313987 3300025944 Bacteria 1408
177 Ga0207668_10876185 3300025972 Unclassified 798
178 Ga0207658_11428267 3300025986 Bacteria 633
179 Ga0207677_10604775 3300026023 Bacteria 962
180 Ga0207677_11069021 3300026023 Bacteria 734
181 Ga0207678_10259066 3300026067 Bacteria 1491
182 Ga0207641_11003126 3300026088 Unclassified 832
183 Ga0207675_100762360 3300026118 Bacteria 979
184 Ga0207683_10213306 3300026121 Unclassified 1757
185 Ga0207683_10601385 3300026121 Bacteria 1018
186 Ga0207683_10772869 3300026121 Unclassified 891
187 Ga0265319_1093121 3300028563 Bacteria 950
188 Ga0265336_10010914 3300028666 Bacteria 3099
189 Ga0265338_10001888 3300028800 Bacteria 32794
190 Ga0265338_10005921 3300028800 Bacteria 15748
191 Ga0265324_10235046 3300029957 Bacteria 622
192 Ga0265320_10117677 3300031240 Bacteria 1214
193 Ga0265316_10183156 3300031344 Unclassified 1559
194 Ga0307405_10320465 3300031731 Bacteria 1184
195 Ga0307405_10554835 3300031731 Bacteria 930
196 Ga0307413_10071255 3300031824 Bacteria 2189
197 Ga0307410_10014741 3300031852 Bacteria 4612
198 Ga0307406_11134456 3300031901 Bacteria 676
199 Ga0307412_10459695 3300031911 Bacteria 1051
200 Ga0307409_101738628 3300031995 Bacteria 652
201 Ga0307409_102545493 3300031995 Unclassified 540
202 Ga0307416_100088182 3300032002 Bacteria 2652
203 Ga0307416_100954360 3300032002 Bacteria 959
204 Ga0307416_101229158 3300032002 Unclassified 855
205 Ga0307414_10492378 3300032004 Bacteria 1083
206 Ga0307411_10047992 3300032005 Bacteria 2764
207 Ga0307415_100048990 3300032126 Bacteria 2853
208 Ga0373926_0251305 3300035083 Bacteria 685
209 Ga0373923_0137929 3300035111 Bacteria 1101
210 Ga0373945_0164948 3300035116 Unclassified 905
211 Ga0373943_0014122 3300035170 Bacteria 3611
212 Ga0373946_0005083 3300035171 Bacteria 4739
213 Ga0373955_0346897 3300035172 Bacteria 899
214 Ga0373955_0442870 3300035172 Bacteria 791
215 Ga0373942_0075721 3300035207 Bacteria 991
216 Ga0373931_0455000 3300035691 Bacteria 819
217 Ga0373935_0074116 3300035692 Bacteria 2200
218 Ga0373947_0053779 3300035725 Bacteria 2428
219 Ga0373937_0348458 3300036401 Unclassified 1403
220 Ga0373925_0001934 3300037068 Bacteria 17137
221 Ga0395899_0442695 3300037312 Bacteria 852
222 Ga0395900_0201242 3300037418 Bacteria 2015
223 Ga0395898_1119266 3300037466 Unclassified 720
224 Ga0395905_0015684 3300037471 Bacteria 7198
225 Ga0395901_0015836 3300038443 Bacteria 7685
226 Ga0395901_1263032 3300038443 Unclassified 702
227 Ga0436363_0542256 3300039450 Unclassified 538
228 Ga0451787_484957 3300041441 Unclassified 777
229 Ga0451789_0020639 3300041443 Bacteria 881
230 Ga0451791_1913835 3300041451 Unclassified 713
231 Ga0451793_1797009 3300041452 Unclassified 864
232 Ga0451798_0452533 3300041458 Unclassified 611
233 Ga0451800_0446011 3300041459 Bacteria 918
234 Ga0451802_0201996 3300041460 Bacteria 1321
235 Ga0451802_2022526 3300041460 Unclassified 578
236 Ga0451804_0062325 3300041463 Bacteria 1083
237 Ga0451807_0603681 3300041486 Unclassified 1030
238 Ga0451807_0848510 3300041486 Unclassified 544
239 Ga0451833_0494414 3300041491 Unclassified 778
240 Ga0451847_0511259 3300041503 Unclassified 520
241 Ga0451849_0807503 3300041505 Bacteria 606
242 Ga0451843_1267290 3300041509 Unclassified 698
243 Ga0451853_1859676 3300041512 Bacteria 1618
244 Ga0451853_2865593 3300041512 Bacteria 1078
245 Ga0439442_005479 3300042002 Bacteria 2537
246 Ga0439449_0118586 3300042007 Bacteria 982
247 Ga0439451_005626 3300042009 Bacteria 2561
248 Ga0439454_087699 3300042011 Bacteria 571
249 Ga0439457_079203 3300042014 Bacteria 754
250 Ga0439446_0023726 3300042156 Bacteria 1746
251 Ga0439434_0262255 3300042435 Unclassified 592
252 Ga0466957_0700857 3300044842 Unclassified 715
253 Ga0466967_0139390 3300045976 Bacteria 2258
254 Ga0495592_0025041 3300046454 Bacteria 4532
255 Ga0495603_0432510 3300046455 Unclassified 754
256 Ga0495629_0399208 3300046459 Unclassified 934
257 Ga0495629_0927114 3300046459 Bacteria 570
258 Ga0495641_0394335 3300046461 Unclassified 628
259 Ga0495651_0221897 3300046462 Bacteria 1307
260 Ga0495653_0021966 3300046463 Bacteria 5164
261 Ga0495653_0822241 3300046463 Bacteria 557
262 Ga0495580_0040927 3300046472 Bacteria 3307
263 Ga0495582_0008225 3300046473 Bacteria 5755
264 Ga0495639_0000468 3300046475 Bacteria 19246
265 Ga0495662_0002584 3300046476 Bacteria 9142
266 Ga0495662_0236697 3300046476 Bacteria 900
267 Ga0495664_0047347 3300046477 Bacteria 2551
268 Ga0495664_0169964 3300046477 Bacteria 1322
269 Ga0495594_0106424 3300046499 Unclassified 1580
270 Ga0495594_0369720 3300046499 Unclassified 816
271 Ga0495596_0166929 3300046500 Unclassified 856
272 Ga0495608_0147543 3300046511 Unclassified 1500
273 Ga0495618_0017681 3300046514 Bacteria 4375
274 Ga0495618_0368708 3300046514 Bacteria 882
275 Ga0495628_0562176 3300046516 Bacteria 818
276 Ga0495630_0002565 3300046517 Bacteria 12595
277 Ga0495631_0323157 3300046518 Bacteria 657
278 Ga0495666_0002677 3300046526 Bacteria 8882
279 Ga0495652_0030873 3300046529 Bacteria 4695
280 Ga0495652_0268909 3300046529 Unclassified 1254
281 Ga0495665_0067806 3300046531 Bacteria 1881
282 Ga0495640_0092477 3300046533 Bacteria 1994
283 Ga0495640_0169220 3300046533 Bacteria 1396
284 Ga0495640_0615194 3300046533 Bacteria 655
285 Ga0495586_0007503 3300046535 Bacteria 5821
286 Ga0495587_0824300 3300046536 Bacteria 506
287 Ga0495598_0216339 3300046537 Unclassified 698
288 Ga0495645_0345434 3300046543 Bacteria 960
289 Ga0495634_0058851 3300046642 Bacteria 2560
290 Ga0495634_0303019 3300046642 Bacteria 965
291 Ga0495634_0439675 3300046642 Bacteria 771
292 Ga0495635_0044324 3300046663 Bacteria 3069
293 Ga0495657_0044629 3300046675 Unclassified 3014
294 Ga0495599_0604020 3300046678 Bacteria 639
295 Ga0495647_0000690 3300046681 Bacteria 10075
296 Ga0495658_0158231 3300046683 Bacteria 1395
297 Ga0495658_0683043 3300046683 Bacteria 658
298 Ga0495669_0634250 3300046684 Bacteria 520
299 Ga0495624_0010940 3300046690 Bacteria 6253
300 Ga0495624_0758956 3300046690 Bacteria 574
301 Ga0495670_0406359 3300046691 Unclassified 736
302 Ga0495589_0261068 3300046794 Unclassified 808
303 Ga0495600_0313638 3300046809 Unclassified 987
304 Ga0495581_0190794 3300047315 Bacteria 1198
305 Ga0495674_0030113 3300047319 Unclassified 4938
306 Ga0495674_0096496 3300047319 Bacteria 2520
307 Ga0495674_0549396 3300047319 Bacteria 919
308 Ga0495676_0022107 3300047321 Bacteria 5541
309 Ga0495676_0684533 3300047321 Unclassified 664
310 Ga0495680_0429901 3300047322 Unclassified 907
311 Ga0495677_0329550 3300047445 Bacteria 602
312 Ga0495681_0375645 3300047470 Bacteria 536
313 Ga0495684_0098942 3300047471 Unclassified 2205
314 Ga0495684_0121645 3300047471 Bacteria 1965
315 Ga0495684_0217353 3300047471 Bacteria 1403
316 Ga0495593_0010453 3300047673 Bacteria 5359
317 Ga0495593_0561749 3300047673 Unclassified 573
318 Ga0495602_0430702 3300048088 Bacteria 935
319 Ga0495614_0012138 3300048089 Bacteria 3783
320 Ga0496101_0495243 3300048904 Bacteria 965
321 Ga0496101_0566946 3300048904 Unclassified 898
322 Ga0496101_0678068 3300048904 Unclassified 814
323 Ga0496102_0599447 3300048905 Bacteria 1025
324 Ga0496102_0890064 3300048905 Bacteria 812
325 Ga0496103_0191026 3300048906 Bacteria 1317
326 Ga0496104_0136044 3300048907 Bacteria 2361
327 Ga0496104_0908173 3300048907 Bacteria 786
328 Ga0496104_1842614 3300048907 Unclassified 507
329 Ga0496105_0752964 3300048908 Unclassified 744
330 Ga0496107_0081816 3300048910 Bacteria 2355
331 Ga0496107_0170708 3300048910 Bacteria 1614
332 Ga0496108_0248778 3300048911 Bacteria 1546
333 Ga0496108_1320495 3300048911 Unclassified 606
334 Ga0496108_1593083 3300048911 Unclassified 541
335 Ga0496109_0075498 3300048912 Bacteria 3099
336 Ga0496109_0601463 3300048912 Bacteria 1036
337 Ga0496110_0055933 3300048913 Bacteria 3472
338 Ga0496110_0468534 3300048913 Unclassified 1148
339 Ga0496111_0530024 3300048914 Bacteria 866
340 Ga0496112_0139228 3300048915 Bacteria 2396
341 Ga0496114_0229745 3300048917 Bacteria 1630
342 Ga0496114_0252136 3300048917 Unclassified 1553
343 Ga0496114_0255649 3300048917 Bacteria 1542
344 Ga0496114_0362005 3300048917 Bacteria 1283
345 Ga0501032_0015230 3300049569 Bacteria 5429
346 Ga0501033_0003943 3300049570 Bacteria 12033
347 Ga0501034_0027555 3300049571 Bacteria 5779
348 Ga0501036_0018523 3300049572 Bacteria 5835
349 Ga0501037_0009974 3300049573 Bacteria 6966
350 Ga0501038_0015354 3300049574 Bacteria 6962
351 Ga0501038_0786603 3300049574 Bacteria 708
352 Ga0501039_0012123 3300049575 Bacteria 6571
353 Ga0501039_0463618 3300049575 Unclassified 995
354 Ga0501040_0117719 3300049576 Bacteria 1862
355 Ga0501041_0052532 3300049577 Unclassified 2484
356 Ga0501042_0005882 3300049578 Bacteria 7929
357 Ga0501043_0003946 3300049579 Bacteria 12166
358 Ga0501046_0015024 3300049580 Bacteria 6513
359 Ga0501046_0901388 3300049580 Bacteria 617
360 Ga0501046_1122164 3300049580 Bacteria 543
361 Ga0501047_0275432 3300049581 Unclassified 1528
362 Ga0501048_0005712 3300049582 Bacteria 9456
363 Ga0501048_1346082 3300049582 Bacteria 513
364 Ga0501067_0707417 3300049583 Bacteria 566
365 Ga0501068_0004980 3300049584 Bacteria 7235
366 Ga0501069_0004260 3300049585 Bacteria 7389
367 Ga0501070_0023384 3300049586 Bacteria 5177
368 Ga0501071_0011827 3300049587 Bacteria 5890
369 Ga0501071_0844349 3300049587 Bacteria 706
370 Ga0501072_0114447 3300049588 Unclassified 2147
371 Ga0501073_0012632 3300049589 Bacteria 6161
372 Ga0501074_0021815 3300049590 Bacteria 4648
373 Ga0501074_0224615 3300049590 Bacteria 1337
374 Ga0501075_0229205 3300049591 Bacteria 1416
375 Ga0501075_0237681 3300049591 Bacteria 1389
376 Ga0501075_0269417 3300049591 Bacteria 1298
377 Ga0501076_0247892 3300049592 Unclassified 1457
378 Ga0501076_0295041 3300049592 Bacteria 1328
379 Ga0501076_0756324 3300049592 Unclassified 802
380 Ga0501076_1557761 3300049592 Bacteria 542
381 Ga0501077_0059245 3300049593 Unclassified 2431
382 Ga0501077_1100902 3300049593 Unclassified 511
383 Ga0501202_048703 3300049652 Bacteria 934
384 Ga0501079_0073440 3300049741 Bacteria 2643
385 Ga0501079_0553402 3300049741 Bacteria 905
386 Ga0501080_0058837 3300049742 Bacteria 3576
387 Ga0501080_1330934 3300049742 Unclassified 614
388 Ga0501081_0061260 3300049743 Bacteria 2608
389 Ga0501083_0045763 3300049744 Bacteria 2959
390 Ga0501083_0722781 3300049744 Bacteria 648
391 Ga0501035_0017685 3300049822 Bacteria 6576
392 Ga0501044_0103733 3300049823 Unclassified 2858
393 Ga0501045_0070880 3300049824 Bacteria 2564
394 Ga0501045_0714376 3300049824 Bacteria 739
395 Ga0501045_0827563 3300049824 Bacteria 681
396 nmdc:mga03683_502675_c1 3300050489 Bacteria 587
397 nmdc:mga0yw44_260578_c1 3300050492 Unclassified 1155
398 nmdc:mga05p37_144358_c1 3300050507 Bacteria 2915
399 nmdc:mga05p37_1766298_c1 3300050507 Bacteria 599
400 nmdc:mga09592_276707_c1 3300050508 Unclassified 1456
401 nmdc:mga0qj67_54098_c1 3300050509 Unclassified 3178
402 nmdc:mga06r32_944768_c1 3300050510 Bacteria 817
403 nmdc:mga08y16_1442202_c1 3300050511 Unclassified 650
404 nmdc:mga08x19_690801_c1 3300050514 Bacteria 724
405 Ga0495601_0010198 3300053077 Bacteria 5584
406 Ga0495601_0112439 3300053077 Unclassified 1764
407 Ga0495612_0006800 3300053078 Bacteria 4684
408 Ga0495612_0041216 3300053078 Bacteria 1883
409 Ga0495595_0022405 3300053084 Bacteria 2774
410 Ga0495619_0145174 3300053085 Bacteria 1635
411 Ga0495619_0311857 3300053085 Bacteria 1089
412 Ga0500657_218540 3300053728 Bacteria 608
413 Ga0501084_0030171 3300054114 Bacteria 4534
414 Ga0501082_0022577 3300060353 Bacteria 5419
415 Ga0501082_1674938 3300060353 Unclassified 555
416 Ga0530510_0017616 3300061734 Bacteria 5061
417 Ga0530510_0305945 3300061734 Bacteria 1190
418 Ga0451837_0378763
419 SwM_106392
420 Ga0070683_100066496
421 Ga0070683_100698316
422 Ga0070683_101235752
423 Ga0070683_101742908
424 Ga0070680_100107124
425 Ga0070682_100175238
426 Ga0070682_100822188
427 Ga0068868_100049762
428 Ga0068868_100387310
429 Ga0068868_100865390
430 Ga0070689_101372964
431 Ga0070689_101857156
432 Ga0070691_10411948
433 Ga0070687_101083332
434 Ga0070668_100861519
435 Ga0070675_100138836
436 Ga0070671_100028916
437 Ga0070673_100449411
438 Ga0070673_100505373
439 Ga0070688_101381530
440 Ga0070667_101293342
441 Ga0070701_10513702
442 Ga0070700_101433381
443 Ga0070694_100937595
444 Ga0070708_100550793
445 Ga0070708_100711436
446 Ga0070708_101217971
447 Ga0070708_101257591
448 Ga0070663_100335549
449 Ga0070663_101779994
450 Ga0070678_100010738
451 Ga0070678_101606290
452 Ga0070678_102199128
453 Ga0070681_10031952
454 Ga0068867_100318364
455 Ga0068867_102237369
456 Ga0070706_100867918
457 Ga0070707_101334510
458 Ga0070707_101655805
459 Ga0070698_100847926
460 Ga0070699_101405241
461 Ga0070679_100062112
462 Ga0070684_100008589
463 Ga0070684_100789156
464 Ga0070684_100966896
465 Ga0070697_100423147
466 Ga0070672_100380179
467 Ga0070686_101492615
468 Ga0070696_100294510
469 Ga0070693_100005152
470 Ga0070693_101320731
471 Ga0070665_100860312
472 Ga0070704_101693634
473 Ga0070704_101761638
474 Ga0070664_100205477
475 Ga0068854_101001648
476 Ga0068856_100074812
477 Ga0070702_100903053
478 Ga0068859_100854193
479 Ga0068866_11051422
480 Ga0068861_102413400
481 Ga0068861_102576368
482 Ga0068870_10284851
483 Ga0068860_101000193
484 Ga0081455_10051152
485 Ga0081455_10343514
486 Ga0081538_10109301
487 Ga0075365_10008532
488 Ga0075365_10869854
489 Ga0075432_10448543
490 Ga0070712_100254984
491 Ga0075362_10576638
492 Ga0075367_10438801
493 Ga0097621_101098119
494 Ga0068871_100795030
495 Ga0075428_101082157
496 Ga0075428_102247289
497 Ga0075430_101431367
498 Ga0075431_101006501
499 Ga0075433_10504675
500 Ga0075434_100191347
501 Ga0075434_100313927
502 Ga0075429_100843692
503 Ga0068865_100325007
504 Ga0068865_101179786
505 Ga0068865_101421204
506 Ga0068865_101481955
507 Ga0075436_100794887
508 Ga0097620_100854232
509 Ga0111539_10676710
510 Ga0111539_10748886
511 Ga0111539_11026486
512 Ga0105245_10013367
513 Ga0105245_10087374
514 Ga0105245_10209192
515 Ga0105245_10328588
516 Ga0105245_10984607
517 Ga0105245_11123531
518 Ga0105245_11318826
519 Ga0105247_10969425
520 Ga0105247_11516332
521 Ga0114129_10309846
522 Ga0114129_10378859
523 Ga0114129_11798943
524 Ga0114129_12299529
525 Ga0105243_10256836
526 Ga0105243_11602135
527 Ga0105243_12522927
528 Ga0105241_10313308
529 Ga0105241_12000400
530 Ga0105242_10075324
531 Ga0105242_10367164
532 Ga0105242_11109685
533 Ga0105242_11894115
534 Ga0105248_10538842
535 Ga0105248_11125786
536 Ga0105248_11635564
537 Ga0105248_12374136
538 Ga0105237_10948510
539 Ga0105237_11122500
540 Ga0105238_10648037
541 Ga0105238_11482099
542 Ga0105249_11578228
543 Ga0105239_10809312
544 Ga0105239_10955112
545 Ga0105239_11893486
546 Ga0105239_12071890
547 Ga0105246_10372125
548 Ga0105246_10857688
549 Ga0105246_10897972
550 Ga0157339_1040795
551 Ga0157371_11475358
552 Ga0157369_10622902
553 Ga0157374_10073955
554 Ga0157374_10468026
555 Ga0157374_11036554
556 Ga0157378_10692444
557 Ga0157378_10759052
558 Ga0157378_11184075
559 Ga0157378_12082746
560 Ga0163162_10440576
561 Ga0163162_11032934
562 Ga0157372_11944953
563 Ga0157375_10333469
564 Ga0157375_10335928
565 Ga0157375_11311794
566 Ga0157375_11802634
567 Ga0163163_10654510
568 Ga0163163_10731598
569 Ga0157380_10191832
570 Ga0157380_11224765
571 Ga0157380_11282591
572 Ga0157377_10032665
573 Ga0157379_11133072
574 Ga0157379_11718805
575 Ga0157376_10495429
576 Ga0157376_10943048
577 Ga0163161_10547377
578 Ga0207693_10413701
579 Ga0207693_10681436
580 Ga0207662_10455574
581 Ga0207646_10027599
582 Ga0207694_11812073
583 Ga0207687_10312558
584 Ga0207687_10387662
585 Ga0207644_10050639
586 Ga0207686_10191923
587 Ga0207686_10634287
588 Ga0207669_10556362
589 Ga0207669_10707121
590 Ga0207669_11242795
591 Ga0207704_11401681
592 Ga0207711_10460562
593 Ga0207661_10313987
594 Ga0207668_10876185
595 Ga0207658_11428267
596 Ga0207677_10604775
597 Ga0207677_11069021
598 Ga0207678_10259066
599 Ga0207641_11003126
600 Ga0207675_100762360
601 Ga0207683_10213306
602 Ga0207683_10601385
603 Ga0207683_10772869
604 Ga0265319_1093121
605 Ga0265336_10010914
606 Ga0265338_10001888
607 Ga0265338_10005921
608 Ga0265324_10235046
609 Ga0265320_10117677
610 Ga0265316_10183156
611 Ga0307405_10320465
612 Ga0307405_10554835
613 Ga0307413_10071255
614 Ga0307410_10014741
615 Ga0307406_11134456
616 Ga0307412_10459695
617 Ga0307409_101738628
618 Ga0307409_102545493
619 Ga0307416_100088182
620 Ga0307416_100954360
621 Ga0307416_101229158
622 Ga0307414_10492378
623 Ga0307411_10047992
624 Ga0307415_100048990
625 Ga0373926_0251305
626 Ga0373923_0137929
627 Ga0373945_0164948
628 Ga0373943_0014122
629 Ga0373946_0005083
630 Ga0373955_0346897
631 Ga0373955_0442870
632 Ga0373942_0075721
633 Ga0373931_0455000
634 Ga0373935_0074116
635 Ga0373947_0053779
636 Ga0373937_0348458
637 Ga0373925_0001934
638 Ga0395899_0442695
639 Ga0395900_0201242
640 Ga0395898_1119266
641 Ga0395905_0015684
642 Ga0395901_0015836
643 Ga0395901_1263032
644 Ga0436363_0542256
645 Ga0451787_484957
646 Ga0451789_0020639
647 Ga0451791_1913835
648 Ga0451793_1797009
649 Ga0451798_0452533
650 Ga0451800_0446011
651 Ga0451802_0201996
652 Ga0451802_2022526
653 Ga0451804_0062325
654 Ga0451807_0603681
655 Ga0451807_0848510
656 Ga0451833_0494414
657 Ga0451847_0511259
658 Ga0451849_0807503
659 Ga0451843_1267290
660 Ga0451853_1859676
661 Ga0451853_2865593
662 Ga0439442_005479
663 Ga0439449_0118586
664 Ga0439451_005626
665 Ga0439454_087699
666 Ga0439457_079203
667 Ga0439446_0023726
668 Ga0439434_0262255
669 Ga0466957_0700857
670 Ga0466967_0139390
671 Ga0495592_0025041
672 Ga0495603_0432510
673 Ga0495629_0399208
674 Ga0495629_0927114
675 Ga0495641_0394335
676 Ga0495651_0221897
677 Ga0495653_0021966
678 Ga0495653_0822241
679 Ga0495580_0040927
680 Ga0495582_0008225
681 Ga0495639_0000468
682 Ga0495662_0002584
683 Ga0495662_0236697
684 Ga0495664_0047347
685 Ga0495664_0169964
686 Ga0495594_0106424
687 Ga0495594_0369720
688 Ga0495596_0166929
689 Ga0495608_0147543
690 Ga0495618_0017681
691 Ga0495618_0368708
692 Ga0495628_0562176
693 Ga0495630_0002565
694 Ga0495631_0323157
695 Ga0495666_0002677
696 Ga0495652_0030873
697 Ga0495652_0268909
698 Ga0495665_0067806
699 Ga0495640_0092477
700 Ga0495640_0169220
701 Ga0495640_0615194
702 Ga0495586_0007503
703 Ga0495587_0824300
704 Ga0495598_0216339
705 Ga0495645_0345434
706 Ga0495634_0058851
707 Ga0495634_0303019
708 Ga0495634_0439675
709 Ga0495635_0044324
710 Ga0495657_0044629
711 Ga0495599_0604020
712 Ga0495647_0000690
713 Ga0495658_0158231
714 Ga0495658_0683043
715 Ga0495669_0634250
716 Ga0495624_0010940
717 Ga0495624_0758956
718 Ga0495670_0406359
719 Ga0495589_0261068
720 Ga0495600_0313638
721 Ga0495581_0190794
722 Ga0495674_0030113
723 Ga0495674_0096496
724 Ga0495674_0549396
725 Ga0495676_0022107
726 Ga0495676_0684533
727 Ga0495680_0429901
728 Ga0495677_0329550
729 Ga0495681_0375645
730 Ga0495684_0098942
731 Ga0495684_0121645
732 Ga0495684_0217353
733 Ga0495593_0010453
734 Ga0495593_0561749
735 Ga0495602_0430702
736 Ga0495614_0012138
737 Ga0496101_0495243
738 Ga0496101_0566946
739 Ga0496101_0678068
740 Ga0496102_0599447
741 Ga0496102_0890064
742 Ga0496103_0191026
743 Ga0496104_0136044
744 Ga0496104_0908173
745 Ga0496104_1842614
746 Ga0496105_0752964
747 Ga0496107_0081816
748 Ga0496107_0170708
749 Ga0496108_0248778
750 Ga0496108_1320495
751 Ga0496108_1593083
752 Ga0496109_0075498
753 Ga0496109_0601463
754 Ga0496110_0055933
755 Ga0496110_0468534
756 Ga0496111_0530024
757 Ga0496112_0139228
758 Ga0496114_0229745
759 Ga0496114_0252136
760 Ga0496114_0255649
761 Ga0496114_0362005
762 Ga0501032_0015230
763 Ga0501033_0003943
764 Ga0501034_0027555
765 Ga0501036_0018523
766 Ga0501037_0009974
767 Ga0501038_0015354
768 Ga0501038_0786603
769 Ga0501039_0012123
770 Ga0501039_0463618
771 Ga0501040_0117719
772 Ga0501041_0052532
773 Ga0501042_0005882
774 Ga0501043_0003946
775 Ga0501046_0015024
776 Ga0501046_0901388
777 Ga0501046_1122164
778 Ga0501047_0275432
779 Ga0501048_0005712
780 Ga0501048_1346082
781 Ga0501067_0707417
782 Ga0501068_0004980
783 Ga0501069_0004260
784 Ga0501070_0023384
785 Ga0501071_0011827
786 Ga0501071_0844349
787 Ga0501072_0114447
788 Ga0501073_0012632
789 Ga0501074_0021815
790 Ga0501074_0224615
791 Ga0501075_0229205
792 Ga0501075_0237681
793 Ga0501075_0269417
794 Ga0501076_0247892
795 Ga0501076_0295041
796 Ga0501076_0756324
797 Ga0501076_1557761
798 Ga0501077_0059245
799 Ga0501077_1100902
800 Ga0501202_048703
801 Ga0501079_0073440
802 Ga0501079_0553402
803 Ga0501080_0058837
804 Ga0501080_1330934
805 Ga0501081_0061260
806 Ga0501083_0045763
807 Ga0501083_0722781
808 Ga0501035_0017685
809 Ga0501044_0103733
810 Ga0501045_0070880
811 Ga0501045_0714376
812 Ga0501045_0827563
813 nmdc:mga03683_502675_c1
814 nmdc:mga0yw44_260578_c1
815 nmdc:mga05p37_144358_c1
816 nmdc:mga05p37_1766298_c1
817 nmdc:mga09592_276707_c1
818 nmdc:mga0qj67_54098_c1
819 nmdc:mga06r32_944768_c1
820 nmdc:mga08y16_1442202_c1
821 nmdc:mga08x19_690801_c1
822 Ga0495601_0010198
823 Ga0495601_0112439
824 Ga0495612_0006800
825 Ga0495612_0041216
826 Ga0495595_0022405
827 Ga0495619_0145174
828 Ga0495619_0311857
829 Ga0500657_218540
830 Ga0501084_0030171
831 Ga0501082_0022577
832 Ga0501082_1674938
833 Ga0530510_0017616
834 Ga0530510_0305945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

25

81

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3clo-assembly1.cif.gz_B crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution 0.9559 13 69
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9514 13 67
4zms-assembly1.cif.gz_B structure of the full-length response regulator spr1814 in complex with a phosphate analogue and b3c 0.9503 13 68
3clo-assembly2.cif.gz_C-2 crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution 0.9476 13 69
8hno-assembly1.cif.gz_B archaeal transcription factor wild type 0.9422 13 55
ID Description Score Start End Superfamily
3la2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9703 28 53 1.10.10.10
3cloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9594 13 68 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9514 13 67 1.10.10.10
3cloC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9501 13 68 1.10.10.10
3qp5D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9216 13 65 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A852YZ95-F1-model_v4 DNA-binding CsgD family transcriptional regulator 0.9737 13 69 GO:0003677
GO:0006355
AF-A0A075V3H4-F1-model_v4 HTH luxR-type domain-containing protein 0.9719 13 69 GO:0003677
GO:0006355
AF-A0A429ETN9-F1-model_v4 HTH luxR-type domain-containing protein 0.9712 13 69 GO:0003677
GO:0006355
AF-A0A193C0N3-F1-model_v4 HTH luxR-type domain-containing protein 0.9665 13 69 GO:0003677
GO:0006355
AF-A0A354SCS5-F1-model_v4 HTH luxR-type domain-containing protein 0.9621 11 67 GO:0003677
GO:0006355

Map