F439091

General Info

Members Datasets Scaffolds Average Seq Length
417 247 834 380

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10001855|Ga0307515_1000185540
Length 445
Sequence MASSFRFPLCIAVRQSTFFLRRTVNYIYIRRNFSDLITTPIFALTPTEELLKESVTRFAKDEILPKVREMDETEKMDKGIVLQLFEQGLMGIEIPERYGGSEMNFGACIVAIEELARVDPSVSATCTSCXAESYYGQVSVLVDVHNTLVNTIFKTYGSEALKAKYLPRLASSHVGSFCLSEPASGSDAFALKTKATKSQSGRFYLISGQKMWITNAAEADIFIVFANVAPELGYKGISCFVLEKGMPGFVVGEKEKKLGIKASSTCVLTFEDVEVPAENLIGKEGEGYKYAISILNEGRIGIAAQMTGLALGAWETAVNYVWNDRKQFGQYVGDFQAMQFQIAQARTDIEAARALLYNAVRTKEVGSVRAGEGFIREAAMAKLFASQVAERVASQAVEWQGGMGFVRDGLSEKFWRDSKIGAIYEGTSNIQLQTIAKLLQTEYKK

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
101 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
148 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
177 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
184 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
185 3300044660 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E1 Metagenome Unclassified
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
240 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
241 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 1.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 3.12
Rhizosphere 93.76
Stem 0
Stem Tuber 0
Unclassified 1.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10001855 3300028794 Eukaryota 47079
2 LJQas_1000298 3300000549 Bacteria 8853
3 JGI24751J29686_10002504 3300002459 Bacteria 3696
4 JGI25406J46586_10002238 3300003203 Bacteria 9128
5 Ga0065704_10085443 3300005289 Bacteria 3221
6 Ga0065712_10082799 3300005290 Bacteria 2884
7 Ga0065715_10010957 3300005293 Bacteria 3813
8 Ga0070658_10096102 3300005327 Bacteria 2446
9 Ga0070676_10005446 3300005328 Bacteria 6781
10 Ga0070676_10045700 3300005328 Bacteria 2551
11 Ga0070683_100420286 3300005329 Bacteria 1275
12 Ga0070690_100019529 3300005330 Unclassified 4115
13 Ga0070690_100079153 3300005330 Bacteria 2149
14 Ga0070670_100036190 3300005331 Bacteria 4248
15 Ga0070670_100043154 3300005331 Bacteria 3877
16 Ga0070666_10038084 3300005335 Bacteria 3199
17 Ga0070666_10095493 3300005335 Bacteria 2046
18 Ga0070666_10106395 3300005335 Bacteria 1938
19 Ga0070680_100181775 3300005336 Bacteria 1771
20 Ga0070680_100256273 3300005336 Bacteria 1480
21 Ga0070682_100051511 3300005337 Bacteria 2573
22 Ga0068868_100013407 3300005338 Bacteria 6011
23 Ga0068868_100097361 3300005338 Bacteria 2378
24 Ga0068868_100105818 3300005338 Bacteria 2282
25 Ga0070660_100063833 3300005339 Bacteria 2863
26 Ga0070660_100070790 3300005339 Bacteria 2722
27 Ga0070691_10001359 3300005341 Bacteria 10450
28 Ga0070687_100053344 3300005343 Bacteria 2102
29 Ga0070661_100011610 3300005344 Bacteria 6140
30 Ga0070661_100070004 3300005344 Bacteria 2580
31 Ga0070668_100205163 3300005347 Bacteria 1619
32 Ga0070669_100015118 3300005353 Bacteria 5498
33 Ga0070675_100025869 3300005354 Bacteria 4706
34 Ga0070675_100136096 3300005354 Unclassified 2097
35 Ga0070674_100174942 3300005356 Bacteria 1639
36 Ga0070659_100038976 3300005366 Unclassified 3708
37 Ga0070667_100003497 3300005367 Bacteria 13388
38 Ga0070709_10014768 3300005434 Bacteria 4425
39 Ga0070714_100014045 3300005435 Bacteria 6425
40 Ga0070714_100030985 3300005435 Bacteria 4457
41 Ga0070713_100080035 3300005436 Bacteria 2785
42 Ga0070701_10004051 3300005438 Bacteria 5877
43 Ga0070711_100094084 3300005439 Bacteria 2165
44 Ga0070700_100000802 3300005441 Bacteria 15414
45 Ga0070700_100025677 3300005441 Bacteria 3470
46 Ga0070663_100272581 3300005455 Bacteria 1346
47 Ga0070662_100019300 3300005457 Bacteria 4627
48 Ga0070681_10048102 3300005458 Bacteria 4262
49 Ga0070681_10118026 3300005458 Bacteria 2589
50 Ga0070681_10208704 3300005458 Bacteria 1870
51 Ga0068867_100023057 3300005459 Bacteria 4455
52 Ga0070707_100093619 3300005468 Bacteria 2909
53 Ga0070707_100170679 3300005468 Bacteria 2120
54 Ga0070707_100187756 3300005468 Bacteria 2015
55 Ga0070698_100039014 3300005471 Bacteria 4892
56 Ga0070699_100080854 3300005518 Bacteria 2832
57 Ga0070679_100014339 3300005530 Bacteria 7612
58 Ga0070679_100035271 3300005530 Bacteria 4962
59 Ga0070684_100116013 3300005535 Bacteria 2405
60 Ga0070684_100293907 3300005535 Unclassified 1490
61 Ga0068853_100090041 3300005539 Bacteria 2696
62 Ga0070672_100009246 3300005543 Bacteria 6785
63 Ga0070686_100030785 3300005544 Bacteria 3276
64 Ga0070695_100005607 3300005545 Bacteria 7392
65 Ga0070665_100001935 3300005548 Bacteria 23347
66 Ga0070665_100017778 3300005548 Bacteria 7138
67 Ga0070665_100018624 3300005548 Bacteria 6959
68 Ga0070665_100135276 3300005548 Bacteria 2466
69 Ga0070665_100162684 3300005548 Bacteria 2234
70 Ga0070704_100002528 3300005549 Bacteria 10290
71 Ga0070704_100056556 3300005549 Bacteria 2786
72 Ga0068855_100116293 3300005563 Bacteria 3065
73 Ga0070664_100043700 3300005564 Bacteria 3781
74 Ga0068857_100004393 3300005577 Bacteria 11921
75 Ga0068854_100043532 3300005578 Bacteria 3183
76 Ga0068854_100085926 3300005578 Bacteria 2331
77 Ga0068856_100010819 3300005614 Bacteria 8861
78 Ga0068856_100033891 3300005614 Bacteria 5000
79 Ga0070702_100041300 3300005615 Bacteria 2586
80 Ga0068852_100264524 3300005616 Bacteria 1652
81 Ga0068852_100357354 3300005616 Bacteria 1428
82 Ga0068859_100023843 3300005617 Bacteria 6143
83 Ga0068864_100220874 3300005618 Bacteria 1748
84 Ga0068866_10025635 3300005718 Bacteria 2774
85 Ga0068866_10107723 3300005718 Bacteria 1549
86 Ga0068861_100007944 3300005719 Bacteria 7299
87 Ga0068861_100031927 3300005719 Bacteria 3873
88 Ga0068861_100235058 3300005719 Bacteria 1556
89 Ga0068861_100349176 3300005719 Bacteria 1297
90 Ga0068863_100004319 3300005841 Bacteria 14007
91 Ga0068863_100174452 3300005841 Bacteria 2063
92 Ga0068858_100005989 3300005842 Bacteria 11873
93 Ga0068858_100014579 3300005842 Bacteria 7406
94 Ga0068858_100201579 3300005842 Bacteria 1882
95 Ga0068860_100018749 3300005843 Bacteria 6724
96 Ga0068860_100063335 3300005843 Bacteria 3513
97 Ga0068860_100232487 3300005843 Bacteria 1792
98 Ga0068862_100031070 3300005844 Bacteria 4505
99 Ga0068862_100116401 3300005844 Bacteria 2351
100 Ga0068862_100181028 3300005844 Bacteria 1892
101 Ga0081539_10000122 3300005985 Bacteria 183393
102 Ga0070717_10002497 3300006028 Bacteria 12985
103 Ga0070717_10104049 3300006028 Bacteria 2414
104 Ga0097621_100001628 3300006237 Bacteria 15402
105 Ga0097621_100001862 3300006237 Bacteria 14468
106 Ga0068871_100000536 3300006358 Bacteria 25860
107 Ga0068871_100013570 3300006358 Bacteria 6049
108 Ga0075428_100009981 3300006844 Bacteria 10551
109 Ga0075428_100084539 3300006844 Bacteria 3462
110 Ga0075428_100089351 3300006844 Bacteria 3360
111 Ga0075428_100166774 3300006844 Bacteria 2389
112 Ga0075428_100291695 3300006844 Bacteria 1754
113 Ga0075430_100000981 3300006846 Bacteria 22489
114 Ga0075431_100003481 3300006847 Bacteria 15260
115 Ga0075431_100110443 3300006847 Bacteria 2838
116 Ga0075431_100178185 3300006847 Bacteria 2182
117 Ga0075433_10006686 3300006852 Bacteria 9132
118 Ga0075434_100020151 3300006871 Bacteria 6464
119 Ga0075434_100038065 3300006871 Bacteria 4764
120 Ga0075429_100001454 3300006880 Bacteria 19443
121 Ga0068865_100006875 3300006881 Bacteria 6970
122 Ga0075436_100025966 3300006914 Bacteria 4033
123 Ga0097620_100023843 3300006931 Bacteria 6143
124 Ga0075435_100077148 3300007076 Bacteria 2732
125 Ga0075435_100126967 3300007076 Bacteria 2132
126 Ga0105240_10015650 3300009093 Bacteria 10301
127 Ga0105240_10037676 3300009093 Bacteria 6213
128 Ga0105240_10442576 3300009093 Bacteria 1456
129 Ga0111539_10001852 3300009094 Bacteria 28133
130 Ga0111539_10066478 3300009094 Bacteria 4258
131 Ga0111539_10182127 3300009094 Bacteria 2453
132 Ga0111539_10240510 3300009094 Bacteria 2107
133 Ga0105245_10009333 3300009098 Bacteria 8556
134 Ga0105245_10218577 3300009098 Bacteria 1837
135 Ga0114129_10004308 3300009147 Bacteria 20111
136 Ga0114129_10015271 3300009147 Bacteria 10929
137 Ga0114129_10032654 3300009147 Bacteria 7355
138 Ga0114129_10112592 3300009147 Bacteria 3753
139 Ga0105242_10035051 3300009176 Bacteria 4024
140 Ga0105242_10075385 3300009176 Bacteria 2808
141 Ga0105242_10105263 3300009176 Bacteria 2396
142 Ga0105242_10132340 3300009176 Bacteria 2154
143 Ga0105242_10232975 3300009176 Bacteria 1651
144 Ga0105242_10360849 3300009176 Bacteria 1345
145 Ga0105248_10004279 3300009177 Bacteria 15796
146 Ga0105248_10185057 3300009177 Bacteria 2347
147 Ga0105248_10241618 3300009177 Bacteria 2033
148 Ga0105248_10335833 3300009177 Bacteria 1701
149 Ga0105248_10528822 3300009177 Bacteria 1330
150 Ga0105249_10048103 3300009553 Bacteria 3889
151 Ga0105249_10157438 3300009553 Bacteria 2192
152 Ga0105249_10174292 3300009553 Bacteria 2088
153 Ga0105249_10258050 3300009553 Bacteria 1731
154 Ga0105239_10300911 3300010375 Bacteria 1806
155 Ga0157373_10062571 3300013100 Bacteria 2636
156 Ga0157371_10030873 3300013102 Bacteria 3862
157 Ga0157369_10037029 3300013105 Bacteria 5343
158 Ga0157369_10058659 3300013105 Bacteria 4152
159 Ga0157369_10103073 3300013105 Bacteria 3039
160 Ga0157374_10002512 3300013296 Bacteria 15478
161 Ga0157374_10055107 3300013296 Bacteria 3710
162 Ga0157374_10258346 3300013296 Bacteria 1715
163 Ga0157378_10030731 3300013297 Bacteria 4743
164 Ga0157378_10125209 3300013297 Bacteria 2373
165 Ga0157378_10211845 3300013297 Bacteria 1838
166 Ga0163162_10074824 3300013306 Bacteria 3446
167 Ga0157372_10150537 3300013307 Unclassified 2685
168 Ga0157372_10279140 3300013307 Bacteria 1942
169 Ga0157375_10096275 3300013308 Bacteria 3032
170 Ga0157375_10493532 3300013308 Bacteria 1389
171 Ga0163163_10000206 3300014325 Bacteria 60942
172 Ga0163163_10015334 3300014325 Bacteria 7083
173 Ga0163163_10168092 3300014325 Bacteria 2239
174 Ga0157380_10000919 3300014326 Bacteria 18556
175 Ga0157380_10071200 3300014326 Bacteria 2812
176 Ga0157380_10126317 3300014326 Bacteria 2174
177 Ga0157379_10007324 3300014968 Bacteria 9550
178 Ga0157379_10082741 3300014968 Bacteria 2876
179 Ga0157376_10033607 3300014969 Bacteria 4130
180 Ga0157376_10052212 3300014969 Bacteria 3398
181 Ga0157376_10214238 3300014969 Bacteria 1780
182 Ga0163161_10186841 3300017792 Bacteria 1591
183 Ga0197907_10048501 3300020069 Eukaryota 1690
184 Ga0206349_1821232 3300020075 Eukaryota 1309
185 Ga0206355_1458730 3300020076 Eukaryota 1577
186 Ga0206352_11060799 3300020078 Eukaryota 1663
187 Ga0206354_11649459 3300020081 Eukaryota 1559
188 Ga0213875_10005513 3300021388 Bacteria 6785
189 Ga0207692_10010692 3300025898 Bacteria 3879
190 Ga0207680_10031751 3300025903 Bacteria 2995
191 Ga0207699_10041002 3300025906 Bacteria 2671
192 Ga0207645_10001862 3300025907 Bacteria 17014
193 Ga0207705_10153001 3300025909 Bacteria 1729
194 Ga0207707_10128686 3300025912 Unclassified 2214
195 Ga0207707_10131854 3300025912 Bacteria 2185
196 Ga0207663_10152492 3300025916 Bacteria 1622
197 Ga0207657_10001951 3300025919 Bacteria 22271
198 Ga0207657_10099546 3300025919 Bacteria 2415
199 Ga0207652_10025225 3300025921 Bacteria 4940
200 Ga0207652_10223635 3300025921 Bacteria 1696
201 Ga0207646_10034109 3300025922 Bacteria 4600
202 Ga0207646_10151220 3300025922 Bacteria 2093
203 Ga0207681_10028174 3300025923 Bacteria 3637
204 Ga0207681_10050131 3300025923 Bacteria 2824
205 Ga0207681_10174318 3300025923 Bacteria 1633
206 Ga0207650_10031568 3300025925 Bacteria 3827
207 Ga0207700_10102864 3300025928 Bacteria 2282
208 Ga0207706_10117541 3300025933 Bacteria 2338
209 Ga0207686_10003504 3300025934 Bacteria 8430
210 Ga0207686_10007733 3300025934 Bacteria 5792
211 Ga0207686_10054040 3300025934 Bacteria 2514
212 Ga0207686_10076732 3300025934 Bacteria 2168
213 Ga0207709_10045410 3300025935 Bacteria 2660
214 Ga0207670_10118796 3300025936 Bacteria 1918
215 Ga0207669_10010201 3300025937 Bacteria 4514
216 Ga0207669_10174845 3300025937 Bacteria 1533
217 Ga0207704_10007840 3300025938 Bacteria 5067
218 Ga0207704_10033028 3300025938 Bacteria 2937
219 Ga0207704_10121655 3300025938 Bacteria 1788
220 Ga0207691_10009708 3300025940 Bacteria 9235
221 Ga0207691_10033282 3300025940 Bacteria 4798
222 Ga0207711_10111028 3300025941 Bacteria 2439
223 Ga0207711_10172294 3300025941 Bacteria 1964
224 Ga0207711_10410478 3300025941 Bacteria 1259
225 Ga0207689_10157893 3300025942 Bacteria 1869
226 Ga0207712_10039138 3300025961 Bacteria 3247
227 Ga0207668_10034977 3300025972 Bacteria 3341
228 Ga0207640_10063086 3300025981 Bacteria 2461
229 Ga0207703_10009445 3300026035 Bacteria 7660
230 Ga0207703_10177383 3300026035 Bacteria 1878
231 Ga0207639_10204513 3300026041 Bacteria 1696
232 Ga0207708_10001940 3300026075 Bacteria 15246
233 Ga0207708_10015220 3300026075 Bacteria 5767
234 Ga0207708_10028787 3300026075 Bacteria 4206
235 Ga0207708_10159912 3300026075 Unclassified 1778
236 Ga0207702_10008118 3300026078 Bacteria 8882
237 Ga0207641_10003602 3300026088 Bacteria 13673
238 Ga0207641_10121941 3300026088 Bacteria 2328
239 Ga0207648_10032771 3300026089 Bacteria 4585
240 Ga0207676_10204173 3300026095 Bacteria 1748
241 Ga0207675_100004885 3300026118 Bacteria 12926
242 Ga0207675_100165826 3300026118 Bacteria 2109
243 Ga0207675_100231717 3300026118 Bacteria 1782
244 Ga0207683_10040569 3300026121 Bacteria 4063
245 Ga0207698_10306083 3300026142 Bacteria 1482
246 Ga0207698_10392264 3300026142 Bacteria 1324
247 Ga0209971_1003293 3300027682 Bacteria 3840
248 Ga0207428_10024667 3300027907 Bacteria 5048
249 Ga0207428_10035502 3300027907 Bacteria 4075
250 Ga0207428_10086212 3300027907 Bacteria 2444
251 Ga0268266_10011241 3300028379 Bacteria 7790
252 Ga0268266_10015169 3300028379 Bacteria 6615
253 Ga0268265_10007735 3300028380 Bacteria 7253
254 Ga0268265_10012292 3300028380 Bacteria 5802
255 Ga0268265_10031584 3300028380 Bacteria 3825
256 Ga0268264_10013460 3300028381 Bacteria 6735
257 Ga0268264_10141642 3300028381 Bacteria 2145
258 Ga0268264_10211753 3300028381 Bacteria 1780
259 Ga0307512_10001014 3300030522 Eukaryota 41283
260 Ga0307512_10007208 3300030522 Eukaryota 11063
261 Ga0307408_100042524 3300031548 Bacteria 3228
262 Ga0307508_10000529 3300031616 Eukaryota 45362
263 Ga0307514_10000027 3300031649 Eukaryota 387247
264 Ga0316579_10035348 3300031691 Bacteria 2303
265 Ga0265314_10138952 3300031711 Bacteria 1505
266 Ga0316578_10055241 3300031728 Bacteria 2330
267 Ga0307516_10001221 3300031730 Eukaryota 35809
268 Ga0316577_10004694 3300031733 Bacteria 7096
269 Ga0307406_10033801 3300031901 Bacteria 3132
270 Ga0307406_10040167 3300031901 Bacteria 2908
271 Ga0307407_10004206 3300031903 Bacteria 6073
272 Ga0307412_10060076 3300031911 Bacteria 2550
273 Ga0307409_100024059 3300031995 Bacteria 4238
274 Ga0307409_100041456 3300031995 Bacteria 3439
275 Ga0307409_100197318 3300031995 Bacteria 1797
276 Ga0307416_100075316 3300032002 Bacteria 2824
277 Ga0307416_100304403 3300032002 Bacteria 1586
278 Ga0307414_10322936 3300032004 Bacteria 1315
279 Ga0307411_10059963 3300032005 Bacteria 2524
280 Ga0307415_100012685 3300032126 Bacteria 4883
281 Ga0373958_0004890 3300034819 Bacteria 2007
282 Ga0373944_0015939 3300035089 Bacteria 2113
283 Ga0373923_0007779 3300035111 Bacteria 3787
284 Ga0373923_0015037 3300035111 Bacteria 2916
285 Ga0373953_0039505 3300035117 Bacteria 1870
286 Ga0373956_0053691 3300035119 Bacteria 1815
287 Ga0373957_0030014 3300035120 Bacteria 1990
288 Ga0373943_0000938 3300035170 Bacteria 12865
289 Ga0373946_0059251 3300035171 Bacteria 1624
290 Ga0373955_0005538 3300035172 Bacteria 5678
291 Ga0373955_0067689 3300035172 Bacteria 1988
292 Ga0373955_0076975 3300035172 Bacteria 1878
293 Ga0316574_0042945 3300035398 Bacteria 2792
294 Ga0373924_0001506 3300035410 Bacteria 7587
295 Ga0373935_0064663 3300035692 Bacteria 2346
296 Ga0373935_0118780 3300035692 Bacteria 1764
297 Ga0373933_0007161 3300035724 Bacteria 6076
298 Ga0373947_0127450 3300035725 Bacteria 1622
299 Ga0373937_0000591 3300036401 Bacteria 32189
300 Ga0373937_0009483 3300036401 Bacteria 8462
301 Ga0373937_0175711 3300036401 Bacteria 2010
302 Ga0373937_0222309 3300036401 Bacteria 1778
303 Ga0373937_0242256 3300036401 Bacteria 1699
304 Ga0373937_0255470 3300036401 Bacteria 1652
305 Ga0316582_0010175 3300036647 Bacteria 5140
306 Ga0316584_0000797 3300036712 Bacteria 17746
307 Ga0373925_0077027 3300037068 Bacteria 2530
308 Ga0373925_0091760 3300037068 Bacteria 2323
309 Ga0373925_0137718 3300037068 Bacteria 1909
310 Ga0395905_0157787 3300037471 Bacteria 2133
311 Ga0400490_47630 3300038726 Bacteria 2060
312 Ga0436365_0893992 3300039437 Bacteria 2351
313 Ga0436362_0792217 3300039453 Bacteria 2238
314 Ga0439439_0015069 3300041406 Bacteria 1886
315 Ga0439433_0024503 3300041999 Bacteria 1360
316 Ga0466974_0101810 3300044660 Eukaryota 1903
317 Ga0466963_0053426 3300044694 Bacteria 2682
318 Ga0453684_0000132 3300044712 Bacteria 331157
319 Ga0453684_0128339 3300044712 Bacteria 3048
320 Ga0453684_0257543 3300044712 Bacteria 2000
321 Ga0451576_0002722 3300045051 Bacteria 25668
322 Ga0451576_0025437 3300045051 Bacteria 6376
323 Ga0466958_0139847 3300045836 Bacteria 1524
324 Ga0466967_0347829 3300045976 Bacteria 1434
325 Ga0495629_0142101 3300046459 Bacteria 1670
326 Ga0495580_0084023 3300046472 Bacteria 2218
327 Ga0495608_0060923 3300046511 Eukaryota 2483
328 Ga0495640_0001078 3300046533 Eukaryota 21241
329 Ga0495640_0031854 3300046533 Bacteria 3761
330 Ga0495586_0084941 3300046535 Bacteria 1743
331 Ga0495621_0005916 3300046539 Bacteria 3544
332 Ga0495621_0012103 3300046539 Bacteria 2685
333 Ga0495621_0035493 3300046539 Bacteria 1727
334 Ga0495645_0201973 3300046543 Bacteria 1348
335 Ga0495634_0036583 3300046642 Bacteria 3357
336 Ga0495635_0093243 3300046663 Bacteria 2059
337 Ga0495635_0129711 3300046663 Bacteria 1719
338 Ga0495661_0011672 3300046665 Eukaryota 5953
339 Ga0495657_0081800 3300046675 Eukaryota 2088
340 Ga0495658_0158784 3300046683 Bacteria 1393
341 Ga0495674_0054413 3300047319 Bacteria 3515
342 Ga0496100_0016371 3300048903 Bacteria 4354
343 Ga0496102_0241586 3300048905 Bacteria 1703
344 Ga0496104_0198381 3300048907 Bacteria 1919
345 Ga0496104_0269585 3300048907 Bacteria 1615
346 Ga0496104_0307346 3300048907 Bacteria 1498
347 Ga0496105_0316237 3300048908 Bacteria 1252
348 Ga0496106_0285746 3300048909 Bacteria 1322
349 Ga0496107_0006255 3300048910 Eukaryota 8184
350 Ga0496110_0292051 3300048913 Bacteria 1485
351 Ga0496112_0216173 3300048915 Bacteria 1873
352 Ga0496114_0045171 3300048917 Bacteria 3658
353 Ga0496114_0070962 3300048917 Bacteria 2926
354 Ga0496114_0308124 3300048917 Bacteria 1398
355 Ga0501034_0203479 3300049571 Bacteria 1937
356 Ga0501036_0384862 3300049572 Bacteria 1171
357 Ga0501039_0033143 3300049575 Bacteria 3985
358 Ga0501039_0072357 3300049575 Bacteria 2679
359 Ga0501042_0229479 3300049578 Bacteria 1339
360 Ga0501048_0203742 3300049582 Bacteria 1403
361 Ga0501071_0035375 3300049587 Bacteria 3558
362 Ga0501071_0039223 3300049587 Bacteria 3388
363 Ga0501072_0014276 3300049588 Bacteria 6086
364 Ga0501072_0211983 3300049588 Bacteria 1543
365 Ga0501073_0007019 3300049589 Bacteria 8391
366 Ga0501074_0151627 3300049590 Bacteria 1657
367 Ga0501075_0078301 3300049591 Bacteria 2502
368 Ga0501076_0019939 3300049592 Bacteria 5130
369 Ga0501076_0027828 3300049592 Bacteria 4384
370 Ga0501079_0026431 3300049741 Bacteria 4450
371 Ga0501079_0029691 3300049741 Bacteria 4200
372 Ga0501081_0097644 3300049743 Bacteria 2073
373 Ga0501045_0070906 3300049824 Bacteria 2564
374 nmdc:mga05p37_13352_c1 3300050507 Bacteria 9838
375 nmdc:mga05p37_13420_c1 3300050507 Bacteria 9819
376 nmdc:mga05p37_155927_c1 3300050507 Bacteria 2790
377 nmdc:mga05p37_22800_c1 3300050507 Bacteria 7593
378 nmdc:mga05p37_25725_c1 3300050507 Bacteria 7158
379 nmdc:mga05p37_44383_c1 3300050507 Bacteria 5469
380 nmdc:mga05p37_5691_c1 3300050507 Bacteria 14647
381 nmdc:mga05p37_9851_c1 3300050507 Bacteria 11343
382 nmdc:mga09592_16084_c1 3300050508 Bacteria 6115
383 nmdc:mga09592_230375_c1 3300050508 Bacteria 1605
384 nmdc:mga09592_60124_c1 3300050508 Bacteria 3212
385 nmdc:mga0qj67_197077_c1 3300050509 Bacteria 1636
386 nmdc:mga0qj67_2482_c1 3300050509 Bacteria 13153
387 nmdc:mga06r32_126940_c1 3300050510 Bacteria 2520
388 nmdc:mga06r32_441_c1 3300050510 Bacteria 35197
389 nmdc:mga08y16_188537_c1 3300050511 Bacteria 2140
390 nmdc:mga08y16_22193_c1 3300050511 Bacteria 6699
391 nmdc:mga08y16_22857_c1 3300050511 Bacteria 6600
392 nmdc:mga08y16_45015_c1 3300050511 Bacteria 4624
393 nmdc:mga08y16_54087_c1 3300050511 Bacteria 4195
394 nmdc:mga08y16_8253_c1 3300050511 Bacteria 10894
395 nmdc:mga0n895_22013_c1 3300050512 Bacteria 5972
396 nmdc:mga0rr50_325906_c1 3300050513 Bacteria 1288
397 nmdc:mga0rr50_9431_c1 3300050513 Bacteria 6135
398 nmdc:mga08x19_73790_c1 3300050514 Bacteria 2228
399 nmdc:mga08x19_97085_c1 3300050514 Bacteria 1951
400 nmdc:mga0a205_11803_c1 3300050515 Bacteria 8062
401 nmdc:mga0a205_330095_c1 3300050515 Bacteria 1395
402 Ga0495601_0034590 3300053077 Bacteria 3153
403 Ga0495595_0024989 3300053084 Bacteria 2642
404 Ga0495595_0035630 3300053084 Bacteria 2254
405 Ga0495619_0002634 3300053085 Bacteria 11726
406 Ga0495619_0027916 3300053085 Bacteria 3640
407 Ga0495619_0097564 3300053085 Bacteria 1997
408 Ga0500556_0029136 3300053104 Bacteria 1859
409 Ga0500659_0001769 3300053135 Eukaryota 13490
410 Ga0500600_0001733 3300053149 Eukaryota 11825
411 Ga0501084_0035537 3300054114 Bacteria 4166
412 Ga0590071_000320 3300059421 Bacteria 14044
413 Ga0590071_008199 3300059421 Bacteria 2463
414 Ga0590074_000756 3300059423 Bacteria 4948
415 Ga0590075_000445 3300059424 Bacteria 11130
416 Ga0590077_000387 3300059426 Bacteria 12378
417 Ga0501082_0049121 3300060353 Bacteria 3638
418 Ga0307515_10001855
419 LJQas_1000298
420 JGI24751J29686_10002504
421 JGI25406J46586_10002238
422 Ga0065704_10085443
423 Ga0065712_10082799
424 Ga0065715_10010957
425 Ga0070658_10096102
426 Ga0070676_10005446
427 Ga0070676_10045700
428 Ga0070683_100420286
429 Ga0070690_100019529
430 Ga0070690_100079153
431 Ga0070670_100036190
432 Ga0070670_100043154
433 Ga0070666_10038084
434 Ga0070666_10095493
435 Ga0070666_10106395
436 Ga0070680_100181775
437 Ga0070680_100256273
438 Ga0070682_100051511
439 Ga0068868_100013407
440 Ga0068868_100097361
441 Ga0068868_100105818
442 Ga0070660_100063833
443 Ga0070660_100070790
444 Ga0070691_10001359
445 Ga0070687_100053344
446 Ga0070661_100011610
447 Ga0070661_100070004
448 Ga0070668_100205163
449 Ga0070669_100015118
450 Ga0070675_100025869
451 Ga0070675_100136096
452 Ga0070674_100174942
453 Ga0070659_100038976
454 Ga0070667_100003497
455 Ga0070709_10014768
456 Ga0070714_100014045
457 Ga0070714_100030985
458 Ga0070713_100080035
459 Ga0070701_10004051
460 Ga0070711_100094084
461 Ga0070700_100000802
462 Ga0070700_100025677
463 Ga0070663_100272581
464 Ga0070662_100019300
465 Ga0070681_10048102
466 Ga0070681_10118026
467 Ga0070681_10208704
468 Ga0068867_100023057
469 Ga0070707_100093619
470 Ga0070707_100170679
471 Ga0070707_100187756
472 Ga0070698_100039014
473 Ga0070699_100080854
474 Ga0070679_100014339
475 Ga0070679_100035271
476 Ga0070684_100116013
477 Ga0070684_100293907
478 Ga0068853_100090041
479 Ga0070672_100009246
480 Ga0070686_100030785
481 Ga0070695_100005607
482 Ga0070665_100001935
483 Ga0070665_100017778
484 Ga0070665_100018624
485 Ga0070665_100135276
486 Ga0070665_100162684
487 Ga0070704_100002528
488 Ga0070704_100056556
489 Ga0068855_100116293
490 Ga0070664_100043700
491 Ga0068857_100004393
492 Ga0068854_100043532
493 Ga0068854_100085926
494 Ga0068856_100010819
495 Ga0068856_100033891
496 Ga0070702_100041300
497 Ga0068852_100264524
498 Ga0068852_100357354
499 Ga0068859_100023843
500 Ga0068864_100220874
501 Ga0068866_10025635
502 Ga0068866_10107723
503 Ga0068861_100007944
504 Ga0068861_100031927
505 Ga0068861_100235058
506 Ga0068861_100349176
507 Ga0068863_100004319
508 Ga0068863_100174452
509 Ga0068858_100005989
510 Ga0068858_100014579
511 Ga0068858_100201579
512 Ga0068860_100018749
513 Ga0068860_100063335
514 Ga0068860_100232487
515 Ga0068862_100031070
516 Ga0068862_100116401
517 Ga0068862_100181028
518 Ga0081539_10000122
519 Ga0070717_10002497
520 Ga0070717_10104049
521 Ga0097621_100001628
522 Ga0097621_100001862
523 Ga0068871_100000536
524 Ga0068871_100013570
525 Ga0075428_100009981
526 Ga0075428_100084539
527 Ga0075428_100089351
528 Ga0075428_100166774
529 Ga0075428_100291695
530 Ga0075430_100000981
531 Ga0075431_100003481
532 Ga0075431_100110443
533 Ga0075431_100178185
534 Ga0075433_10006686
535 Ga0075434_100020151
536 Ga0075434_100038065
537 Ga0075429_100001454
538 Ga0068865_100006875
539 Ga0075436_100025966
540 Ga0097620_100023843
541 Ga0075435_100077148
542 Ga0075435_100126967
543 Ga0105240_10015650
544 Ga0105240_10037676
545 Ga0105240_10442576
546 Ga0111539_10001852
547 Ga0111539_10066478
548 Ga0111539_10182127
549 Ga0111539_10240510
550 Ga0105245_10009333
551 Ga0105245_10218577
552 Ga0114129_10004308
553 Ga0114129_10015271
554 Ga0114129_10032654
555 Ga0114129_10112592
556 Ga0105242_10035051
557 Ga0105242_10075385
558 Ga0105242_10105263
559 Ga0105242_10132340
560 Ga0105242_10232975
561 Ga0105242_10360849
562 Ga0105248_10004279
563 Ga0105248_10185057
564 Ga0105248_10241618
565 Ga0105248_10335833
566 Ga0105248_10528822
567 Ga0105249_10048103
568 Ga0105249_10157438
569 Ga0105249_10174292
570 Ga0105249_10258050
571 Ga0105239_10300911
572 Ga0157373_10062571
573 Ga0157371_10030873
574 Ga0157369_10037029
575 Ga0157369_10058659
576 Ga0157369_10103073
577 Ga0157374_10002512
578 Ga0157374_10055107
579 Ga0157374_10258346
580 Ga0157378_10030731
581 Ga0157378_10125209
582 Ga0157378_10211845
583 Ga0163162_10074824
584 Ga0157372_10150537
585 Ga0157372_10279140
586 Ga0157375_10096275
587 Ga0157375_10493532
588 Ga0163163_10000206
589 Ga0163163_10015334
590 Ga0163163_10168092
591 Ga0157380_10000919
592 Ga0157380_10071200
593 Ga0157380_10126317
594 Ga0157379_10007324
595 Ga0157379_10082741
596 Ga0157376_10033607
597 Ga0157376_10052212
598 Ga0157376_10214238
599 Ga0163161_10186841
600 Ga0197907_10048501
601 Ga0206349_1821232
602 Ga0206355_1458730
603 Ga0206352_11060799
604 Ga0206354_11649459
605 Ga0213875_10005513
606 Ga0207692_10010692
607 Ga0207680_10031751
608 Ga0207699_10041002
609 Ga0207645_10001862
610 Ga0207705_10153001
611 Ga0207707_10128686
612 Ga0207707_10131854
613 Ga0207663_10152492
614 Ga0207657_10001951
615 Ga0207657_10099546
616 Ga0207652_10025225
617 Ga0207652_10223635
618 Ga0207646_10034109
619 Ga0207646_10151220
620 Ga0207681_10028174
621 Ga0207681_10050131
622 Ga0207681_10174318
623 Ga0207650_10031568
624 Ga0207700_10102864
625 Ga0207706_10117541
626 Ga0207686_10003504
627 Ga0207686_10007733
628 Ga0207686_10054040
629 Ga0207686_10076732
630 Ga0207709_10045410
631 Ga0207670_10118796
632 Ga0207669_10010201
633 Ga0207669_10174845
634 Ga0207704_10007840
635 Ga0207704_10033028
636 Ga0207704_10121655
637 Ga0207691_10009708
638 Ga0207691_10033282
639 Ga0207711_10111028
640 Ga0207711_10172294
641 Ga0207711_10410478
642 Ga0207689_10157893
643 Ga0207712_10039138
644 Ga0207668_10034977
645 Ga0207640_10063086
646 Ga0207703_10009445
647 Ga0207703_10177383
648 Ga0207639_10204513
649 Ga0207708_10001940
650 Ga0207708_10015220
651 Ga0207708_10028787
652 Ga0207708_10159912
653 Ga0207702_10008118
654 Ga0207641_10003602
655 Ga0207641_10121941
656 Ga0207648_10032771
657 Ga0207676_10204173
658 Ga0207675_100004885
659 Ga0207675_100165826
660 Ga0207675_100231717
661 Ga0207683_10040569
662 Ga0207698_10306083
663 Ga0207698_10392264
664 Ga0209971_1003293
665 Ga0207428_10024667
666 Ga0207428_10035502
667 Ga0207428_10086212
668 Ga0268266_10011241
669 Ga0268266_10015169
670 Ga0268265_10007735
671 Ga0268265_10012292
672 Ga0268265_10031584
673 Ga0268264_10013460
674 Ga0268264_10141642
675 Ga0268264_10211753
676 Ga0307512_10001014
677 Ga0307512_10007208
678 Ga0307408_100042524
679 Ga0307508_10000529
680 Ga0307514_10000027
681 Ga0316579_10035348
682 Ga0265314_10138952
683 Ga0316578_10055241
684 Ga0307516_10001221
685 Ga0316577_10004694
686 Ga0307406_10033801
687 Ga0307406_10040167
688 Ga0307407_10004206
689 Ga0307412_10060076
690 Ga0307409_100024059
691 Ga0307409_100041456
692 Ga0307409_100197318
693 Ga0307416_100075316
694 Ga0307416_100304403
695 Ga0307414_10322936
696 Ga0307411_10059963
697 Ga0307415_100012685
698 Ga0373958_0004890
699 Ga0373944_0015939
700 Ga0373923_0007779
701 Ga0373923_0015037
702 Ga0373953_0039505
703 Ga0373956_0053691
704 Ga0373957_0030014
705 Ga0373943_0000938
706 Ga0373946_0059251
707 Ga0373955_0005538
708 Ga0373955_0067689
709 Ga0373955_0076975
710 Ga0316574_0042945
711 Ga0373924_0001506
712 Ga0373935_0064663
713 Ga0373935_0118780
714 Ga0373933_0007161
715 Ga0373947_0127450
716 Ga0373937_0000591
717 Ga0373937_0009483
718 Ga0373937_0175711
719 Ga0373937_0222309
720 Ga0373937_0242256
721 Ga0373937_0255470
722 Ga0316582_0010175
723 Ga0316584_0000797
724 Ga0373925_0077027
725 Ga0373925_0091760
726 Ga0373925_0137718
727 Ga0395905_0157787
728 Ga0400490_47630
729 Ga0436365_0893992
730 Ga0436362_0792217
731 Ga0439439_0015069
732 Ga0439433_0024503
733 Ga0466974_0101810
734 Ga0466963_0053426
735 Ga0453684_0000132
736 Ga0453684_0128339
737 Ga0453684_0257543
738 Ga0451576_0002722
739 Ga0451576_0025437
740 Ga0466958_0139847
741 Ga0466967_0347829
742 Ga0495629_0142101
743 Ga0495580_0084023
744 Ga0495608_0060923
745 Ga0495640_0001078
746 Ga0495640_0031854
747 Ga0495586_0084941
748 Ga0495621_0005916
749 Ga0495621_0012103
750 Ga0495621_0035493
751 Ga0495645_0201973
752 Ga0495634_0036583
753 Ga0495635_0093243
754 Ga0495635_0129711
755 Ga0495661_0011672
756 Ga0495657_0081800
757 Ga0495658_0158784
758 Ga0495674_0054413
759 Ga0496100_0016371
760 Ga0496102_0241586
761 Ga0496104_0198381
762 Ga0496104_0269585
763 Ga0496104_0307346
764 Ga0496105_0316237
765 Ga0496106_0285746
766 Ga0496107_0006255
767 Ga0496110_0292051
768 Ga0496112_0216173
769 Ga0496114_0045171
770 Ga0496114_0070962
771 Ga0496114_0308124
772 Ga0501034_0203479
773 Ga0501036_0384862
774 Ga0501039_0033143
775 Ga0501039_0072357
776 Ga0501042_0229479
777 Ga0501048_0203742
778 Ga0501071_0035375
779 Ga0501071_0039223
780 Ga0501072_0014276
781 Ga0501072_0211983
782 Ga0501073_0007019
783 Ga0501074_0151627
784 Ga0501075_0078301
785 Ga0501076_0019939
786 Ga0501076_0027828
787 Ga0501079_0026431
788 Ga0501079_0029691
789 Ga0501081_0097644
790 Ga0501045_0070906
791 nmdc:mga05p37_13352_c1
792 nmdc:mga05p37_13420_c1
793 nmdc:mga05p37_155927_c1
794 nmdc:mga05p37_22800_c1
795 nmdc:mga05p37_25725_c1
796 nmdc:mga05p37_44383_c1
797 nmdc:mga05p37_5691_c1
798 nmdc:mga05p37_9851_c1
799 nmdc:mga09592_16084_c1
800 nmdc:mga09592_230375_c1
801 nmdc:mga09592_60124_c1
802 nmdc:mga0qj67_197077_c1
803 nmdc:mga0qj67_2482_c1
804 nmdc:mga06r32_126940_c1
805 nmdc:mga06r32_441_c1
806 nmdc:mga08y16_188537_c1
807 nmdc:mga08y16_22193_c1
808 nmdc:mga08y16_22857_c1
809 nmdc:mga08y16_45015_c1
810 nmdc:mga08y16_54087_c1
811 nmdc:mga08y16_8253_c1
812 nmdc:mga0n895_22013_c1
813 nmdc:mga0rr50_325906_c1
814 nmdc:mga0rr50_9431_c1
815 nmdc:mga08x19_73790_c1
816 nmdc:mga08x19_97085_c1
817 nmdc:mga0a205_11803_c1
818 nmdc:mga0a205_330095_c1
819 Ga0495601_0034590
820 Ga0495595_0024989
821 Ga0495595_0035630
822 Ga0495619_0002634
823 Ga0495619_0027916
824 Ga0495619_0097564
825 Ga0500556_0029136
826 Ga0500659_0001769
827 Ga0500600_0001733
828 Ga0501084_0035537
829 Ga0590071_000320
830 Ga0590071_008199
831 Ga0590074_000756
832 Ga0590075_000445
833 Ga0590077_000387
834 Ga0501082_0049121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

285

440

0.96

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

176

273

0.93

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

300

429

0.93

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

45

173

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jqi-assembly1.cif.gz_B crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa 0.9751 17 311
2vig-assembly1.cif.gz_A crystal structure of human short-chain acyl coa dehydrogenase 0.9745 18 311
4kto-assembly1.cif.gz_C crystal structure of a putative isovaleryl-coa dehydrogenase (psi-nysgrc-012251) from sinorhizobium meliloti 1021 0.9744 17 312
4n5f-assembly1.cif.gz_A-2 crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315 0.9733 18 311
2vig-assembly2.cif.gz_F crystal structure of human short-chain acyl coa dehydrogenase 0.9726 18 311
ID Description Score Start End Superfamily
af_P0A9U8_233_383_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9899 252 311 1.20.140.10
af_M0RAD8_170_241_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9855 131 201 2.40.110.10
af_O86319_234_379_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9847 248 311 1.20.140.10
5jscD03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9846 255 312 1.20.140.10
af_I6Y4R2_239_388_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9828 251 312 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A0B1SPR9-F1-model_v4 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial (EC 1.3.8.5) (2-methyl branched chain acyl-CoA dehydrogenase) (2-methylbutyryl-coenzyme A dehydrogenase) 0.9854 45 274 GO:0003995
GO:0005739
GO:0006631
GO:0050660
AF-A0A7C7L8F3-F1-model_v4 Acyl-CoA dehydrogenase 0.9827 17 279 GO:0003995
GO:0050660
AF-A0A2E1H3C3-F1-model_v4 Acyl-CoA dehydrogenase 0.9818 17 311 GO:0003995
GO:0050660
AF-X1PRZ4-F1-model_v4 Acyl-CoA dehydrogenase 0.9809 87 312 GO:0003995
GO:0050660
AF-A0A534VIU1-F1-model_v4 Acyl-CoA dehydrogenase 0.9807 17 312 GO:0003995
GO:0050660

Map