F439052

General Info

Members Datasets Scaffolds Average Seq Length
417 227 834 138

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_11948173|Ga0105248_119481731
Length 152
Sequence MQINPYLNFNGNCAEAFKFYEEVLGGKILFSMTWGEMPGAAEHFPVETHSRIMHINFKVGDQSLMGADSPPDKYQPAKGMNVSLHVKDKAEGERVFKALSEGGNITMPFEQTFWSAGFGMCVDRFGIPWMVNTESEPQEAVVTQAVSLRNDR

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
107 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
169 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
174 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
180 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
185 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
190 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
191 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
217 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
226 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
227 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 0.96
Rhizosphere 97.84
Stem 0
Stem Tuber 0
Unclassified 24.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_11948173 3300009177 Bacteria 667
2 JGI24034J14986_100001 3300001432 Bacteria 10469
3 JGI24740J21852_10001580 3300001979 Bacteria 10465
4 JGI24739J22299_10046612 3300001989 Bacteria 1419
5 JGI24737J22298_10006103 3300001990 Bacteria 4129
6 JGI24735J21928_10042309 3300002067 Bacteria 1327
7 JGI24748J21848_1000012 3300002074 Bacteria 152599
8 JGI24034J26672_10000003 3300002239 Bacteria 501747
9 rootH2_10173696 3300003320 Bacteria 1807
10 Ga0055533_1000284 3300003756 Bacteria 26584
11 Ga0065704_10129630 3300005289 Unclassified 1646
12 Ga0065712_10076755 3300005290 Bacteria 3608
13 Ga0065715_10535684 3300005293 Bacteria 752
14 Ga0065707_10224794 3300005295 Unclassified 1211
15 Ga0065707_10760653 3300005295 Unclassified 614
16 Ga0070676_10119630 3300005328 Unclassified 1651
17 Ga0070683_100006159 3300005329 Bacteria 10059
18 Ga0070690_100023590 3300005330 Bacteria 3774
19 Ga0070690_100082718 3300005330 Bacteria 2102
20 Ga0070690_100216433 3300005330 Bacteria 1340
21 Ga0068869_100002739 3300005334 Bacteria 10667
22 Ga0068869_100034586 3300005334 Bacteria 3575
23 Ga0070680_100000100 3300005336 Bacteria 49540
24 Ga0070680_100033991 3300005336 Unclassified 4112
25 Ga0070680_100675843 3300005336 Bacteria 888
26 Ga0070680_100711270 3300005336 Bacteria 864
27 Ga0070680_100972785 3300005336 Unclassified 733
28 Ga0070682_100024669 3300005337 Unclassified 3581
29 Ga0070682_100080544 3300005337 Bacteria 2106
30 Ga0068868_100121971 3300005338 Unclassified 2127
31 Ga0068868_100176642 3300005338 Bacteria 1770
32 Ga0068868_100748545 3300005338 Bacteria 878
33 Ga0070687_100013514 3300005343 Bacteria 3640
34 Ga0070687_100581531 3300005343 Bacteria 766
35 Ga0070661_100041315 3300005344 Unclassified 3366
36 Ga0070692_10151766 3300005345 Bacteria 1320
37 Ga0070669_101247846 3300005353 Unclassified 643
38 Ga0070674_100470056 3300005356 Unclassified 1042
39 Ga0070673_100005167 3300005364 Bacteria 8332
40 Ga0070673_100817321 3300005364 Bacteria 861
41 Ga0070673_101053104 3300005364 Unclassified 759
42 Ga0070688_101138077 3300005365 Unclassified 625
43 Ga0070659_100103040 3300005366 Bacteria 2298
44 Ga0070709_10031670 3300005434 Bacteria 3182
45 Ga0070709_10213665 3300005434 Bacteria 1372
46 Ga0070710_10024531 3300005437 Bacteria 3182
47 Ga0070701_10016368 3300005438 Bacteria 3446
48 Ga0070711_100216499 3300005439 Unclassified 1486
49 Ga0070700_100211435 3300005441 Bacteria 1369
50 Ga0070700_100430496 3300005441 Bacteria 999
51 Ga0070700_100620876 3300005441 Unclassified 850
52 Ga0070694_100014539 3300005444 Bacteria 4927
53 Ga0070694_100022149 3300005444 Bacteria 4070
54 Ga0070694_100099095 3300005444 Bacteria 2059
55 Ga0070694_100780719 3300005444 Bacteria 782
56 Ga0070694_100987906 3300005444 Unclassified 698
57 Ga0070694_101098557 3300005444 Unclassified 663
58 Ga0070708_100002465 3300005445 Bacteria 14307
59 Ga0070708_100553145 3300005445 Bacteria 1085
60 Ga0070663_100274276 3300005455 Bacteria 1342
61 Ga0070662_100067982 3300005457 Bacteria 2618
62 Ga0070662_100124102 3300005457 Bacteria 1982
63 Ga0070662_101213150 3300005457 Unclassified 649
64 Ga0070681_10000003 3300005458 Bacteria 252785
65 Ga0070681_10005257 3300005458 Bacteria 12498
66 Ga0070681_10063854 3300005458 Unclassified 3655
67 Ga0068867_100086650 3300005459 Bacteria 2370
68 Ga0068867_100176710 3300005459 Bacteria 1695
69 Ga0068867_100240387 3300005459 Bacteria 1468
70 Ga0068867_100790825 3300005459 Unclassified 845
71 Ga0070685_10406375 3300005466 Unclassified 944
72 Ga0070685_10523547 3300005466 Bacteria 842
73 Ga0070706_100144347 3300005467 Bacteria 2223
74 Ga0070706_100527512 3300005467 Bacteria 1098
75 Ga0070706_100884122 3300005467 Bacteria 826
76 Ga0070707_100005821 3300005468 Bacteria 11498
77 Ga0070707_100180497 3300005468 Bacteria 2058
78 Ga0070707_101627412 3300005468 Bacteria 613
79 Ga0070707_102046500 3300005468 Bacteria 540
80 Ga0070698_100205829 3300005471 Bacteria 1903
81 Ga0070698_100275610 3300005471 Bacteria 1614
82 Ga0070699_100183099 3300005518 Bacteria 1859
83 Ga0070699_100227453 3300005518 Unclassified 1663
84 Ga0070699_100245933 3300005518 Bacteria 1598
85 Ga0070699_101163064 3300005518 Unclassified 708
86 Ga0070679_100000617 3300005530 Bacteria 30256
87 Ga0070679_100017176 3300005530 Bacteria 6999
88 Ga0070679_100018071 3300005530 Bacteria 6835
89 Ga0070679_100463787 3300005530 Unclassified 1211
90 Ga0070684_100004879 3300005535 Bacteria 10242
91 Ga0070697_100077717 3300005536 Bacteria 2731
92 Ga0070697_100125935 3300005536 Bacteria 2146
93 Ga0070697_100781888 3300005536 Unclassified 844
94 Ga0070697_100990494 3300005536 Unclassified 747
95 Ga0068853_100387043 3300005539 Bacteria 1307
96 Ga0068853_102110609 3300005539 Unclassified 546
97 Ga0070672_100444347 3300005543 Bacteria 1116
98 Ga0070686_100007978 3300005544 Bacteria 5917
99 Ga0070686_100086687 3300005544 Bacteria 2085
100 Ga0070695_100274541 3300005545 Unclassified 1236
101 Ga0070695_100359576 3300005545 Unclassified 1093
102 Ga0070695_100403783 3300005545 Bacteria 1037
103 Ga0070695_100450862 3300005545 Bacteria 986
104 Ga0070695_100926823 3300005545 Bacteria 705
105 Ga0070695_101729067 3300005545 Unclassified 524
106 Ga0070696_100075118 3300005546 Bacteria 2384
107 Ga0070693_100026675 3300005547 Bacteria 3121
108 Ga0070693_100259200 3300005547 Unclassified 1156
109 Ga0070693_100449450 3300005547 Unclassified 904
110 Ga0070704_100159562 3300005549 Bacteria 1782
111 Ga0070704_100442300 3300005549 Bacteria 1118
112 Ga0070704_100533256 3300005549 Unclassified 1023
113 Ga0068855_100045356 3300005563 Bacteria 5199
114 Ga0068855_101533756 3300005563 Bacteria 683
115 Ga0070664_100006653 3300005564 Bacteria 9322
116 Ga0068857_100010136 3300005577 Bacteria 8189
117 Ga0068857_100035722 3300005577 Bacteria 4402
118 Ga0068857_100171106 3300005577 Bacteria 1975
119 Ga0068857_100229110 3300005577 Bacteria 1699
120 Ga0068854_100016523 3300005578 Bacteria 4921
121 Ga0068854_100038826 3300005578 Bacteria 3351
122 Ga0068854_101627632 3300005578 Bacteria 589
123 Ga0068856_100002036 3300005614 Bacteria 20996
124 Ga0068856_100013769 3300005614 Bacteria 7819
125 Ga0070702_100396350 3300005615 Unclassified 986
126 Ga0070702_100545232 3300005615 Unclassified 860
127 Ga0070702_101022071 3300005615 Unclassified 656
128 Ga0068852_100159098 3300005616 Bacteria 2107
129 Ga0068852_101284984 3300005616 Unclassified 753
130 Ga0068859_100297953 3300005617 Unclassified 1706
131 Ga0068859_100754431 3300005617 Bacteria 1062
132 Ga0068864_100251495 3300005618 Unclassified 1641
133 Ga0068864_100826660 3300005618 Unclassified 912
134 Ga0068864_100891580 3300005618 Unclassified 878
135 Ga0068861_100079297 3300005719 Bacteria 2566
136 Ga0068851_10003461 3300005834 Bacteria 7024
137 Ga0068858_100000468 3300005842 Bacteria 42170
138 Ga0068858_100152408 3300005842 Bacteria 2174
139 Ga0068858_100285790 3300005842 Unclassified 1571
140 Ga0068858_100961624 3300005842 Unclassified 836
141 Ga0081455_10357242 3300005937 Bacteria 1028
142 Ga0070716_100009134 3300006173 Bacteria 4934
143 Ga0070716_100078071 3300006173 Bacteria 1967
144 Ga0070712_100199144 3300006175 Bacteria 1572
145 Ga0070712_100457053 3300006175 Bacteria 1064
146 Ga0068871_100240338 3300006358 Bacteria 1574
147 Ga0068871_101959585 3300006358 Bacteria 557
148 Ga0075431_100042864 3300006847 Bacteria 4668
149 Ga0075431_100166672 3300006847 Unclassified 2264
150 Ga0075433_10048713 3300006852 Unclassified 3685
151 Ga0075433_10132714 3300006852 Bacteria 2213
152 Ga0075433_10496064 3300006852 Bacteria 1075
153 Ga0075434_100236706 3300006871 Bacteria 1846
154 Ga0075434_100347541 3300006871 Bacteria 1504
155 Ga0075434_101175115 3300006871 Unclassified 780
156 Ga0075434_102417005 3300006871 Unclassified 527
157 Ga0075429_100845062 3300006880 Unclassified 801
158 Ga0075429_100940913 3300006880 Unclassified 756
159 Ga0075429_101370318 3300006880 Unclassified 616
160 Ga0068865_100018203 3300006881 Bacteria 4531
161 Ga0068865_100330339 3300006881 Unclassified 1229
162 Ga0075436_100000016 3300006914 Bacteria 167300
163 Ga0075436_100008158 3300006914 Bacteria 7169
164 Ga0075436_100164130 3300006914 Bacteria 1567
165 Ga0097620_100297953 3300006931 Unclassified 1706
166 Ga0097620_100754379 3300006931 Bacteria 1062
167 Ga0075435_100000971 3300007076 Bacteria 18123
168 Ga0075435_100579017 3300007076 Bacteria 973
169 Ga0075435_100781924 3300007076 Unclassified 831
170 Ga0075435_101740981 3300007076 Bacteria 547
171 Ga0099795_10013511 3300007788 Unclassified 2508
172 Ga0105244_10119001 3300009036 Bacteria 1280
173 Ga0105240_10004881 3300009093 Bacteria 20178
174 Ga0105240_10016877 3300009093 Bacteria 9867
175 Ga0105240_10049014 3300009093 Bacteria 5335
176 Ga0105240_10677509 3300009093 Unclassified 1128
177 Ga0111539_10351750 3300009094 Bacteria 1715
178 Ga0111539_10838663 3300009094 Bacteria 1069
179 Ga0105245_10101857 3300009098 Bacteria 2659
180 Ga0105245_10154421 3300009098 Bacteria 2173
181 Ga0105245_10788831 3300009098 Bacteria 987
182 Ga0105245_10870459 3300009098 Unclassified 942
183 Ga0105247_10000003 3300009101 Bacteria 694517
184 Ga0114129_10015871 3300009147 Bacteria 10710
185 Ga0114129_10135001 3300009147 Bacteria 3386
186 Ga0114129_10195385 3300009147 Bacteria 2744
187 Ga0114129_10601975 3300009147 Unclassified 1424
188 Ga0114129_11380682 3300009147 Unclassified 870
189 Ga0114129_11686952 3300009147 Unclassified 773
190 Ga0105243_10000382 3300009148 Bacteria 47538
191 Ga0105243_11403889 3300009148 Bacteria 719
192 Ga0105243_12114620 3300009148 Unclassified 599
193 Ga0105241_10001823 3300009174 Bacteria 16163
194 Ga0105242_10000344 3300009176 Bacteria 37518
195 Ga0105242_10002927 3300009176 Bacteria 13340
196 Ga0105242_10365796 3300009176 Bacteria 1336
197 Ga0105242_12952203 3300009176 Bacteria 526
198 Ga0105248_10122475 3300009177 Bacteria 2934
199 Ga0105248_11062179 3300009177 Unclassified 915
200 Ga0105248_13218584 3300009177 Unclassified 519
201 Ga0105237_10111094 3300009545 Bacteria 2733
202 Ga0105237_10321142 3300009545 Unclassified 1552
203 Ga0105238_10001367 3300009551 Bacteria 24466
204 Ga0105238_10038154 3300009551 Bacteria 4880
205 Ga0105239_10001966 3300010375 Bacteria 26740
206 Ga0105239_10015287 3300010375 Bacteria 8506
207 Ga0105239_10074191 3300010375 Bacteria 3741
208 Ga0105239_10134745 3300010375 Bacteria 2750
209 Ga0105239_11744830 3300010375 Unclassified 721
210 Ga0105246_10287471 3300011119 Unclassified 1322
211 Ga0157373_10093171 3300013100 Unclassified 2122
212 Ga0157373_10490864 3300013100 Unclassified 886
213 Ga0157373_10563922 3300013100 Bacteria 827
214 Ga0157373_11144584 3300013100 Unclassified 585
215 Ga0157371_10574895 3300013102 Unclassified 837
216 Ga0157369_10223903 3300013105 Bacteria 1968
217 Ga0157378_10000015 3300013297 Bacteria 143601
218 Ga0157378_10015736 3300013297 Bacteria 6623
219 Ga0157378_10048473 3300013297 Bacteria 3778
220 Ga0157378_10078759 3300013297 Bacteria 2974
221 Ga0157378_10082985 3300013297 Bacteria 2899
222 Ga0157378_10155021 3300013297 Bacteria 2137
223 Ga0157378_10168552 3300013297 Bacteria 2052
224 Ga0163162_10042131 3300013306 Bacteria 4568
225 Ga0163162_10657243 3300013306 Bacteria 1172
226 Ga0163162_10960069 3300013306 Bacteria 966
227 Ga0157372_10842310 3300013307 Bacteria 1065
228 Ga0157375_10021033 3300013308 Bacteria 5975
229 Ga0157375_10580302 3300013308 Bacteria 1281
230 Ga0157375_10823225 3300013308 Bacteria 1076
231 Ga0163163_10206312 3300014325 Bacteria 2014
232 Ga0157380_10121048 3300014326 Bacteria 2217
233 Ga0157379_10223553 3300014968 Bacteria 1706
234 Ga0157379_10467075 3300014968 Unclassified 1167
235 Ga0157376_10469727 3300014969 Bacteria 1231
236 Ga0163161_10008648 3300017792 Bacteria 7039
237 Ga0163161_10220319 3300017792 Unclassified 1469
238 Ga0213873_10139440 3300021358 Bacteria 723
239 Ga0207672_1000668 3300025223 Bacteria 3960
240 Ga0209674_100043 3300025226 Bacteria 369728
241 Ga0207656_10335357 3300025321 Bacteria 753
242 Ga0207655_1062600 3300025728 Bacteria 1430
243 Ga0207642_10529179 3300025899 Unclassified 725
244 Ga0207710_10000001 3300025900 Bacteria 1797433
245 Ga0207688_10580789 3300025901 Bacteria 705
246 Ga0207680_11334798 3300025903 Unclassified 510
247 Ga0207647_10001253 3300025904 Bacteria 19532
248 Ga0207685_10287379 3300025905 Bacteria 809
249 Ga0207699_10005137 3300025906 Bacteria 6267
250 Ga0207699_10041776 3300025906 Bacteria 2651
251 Ga0207645_10003535 3300025907 Bacteria 11823
252 Ga0207684_10297371 3300025910 Bacteria 1392
253 Ga0207684_10311982 3300025910 Unclassified 1356
254 Ga0207654_10000446 3300025911 Bacteria 23584
255 Ga0207707_10000001 3300025912 Bacteria 1212482
256 Ga0207707_10020211 3300025912 Bacteria 5814
257 Ga0207707_10026568 3300025912 Bacteria 5060
258 Ga0207695_10001480 3300025913 Bacteria 39293
259 Ga0207695_11169174 3300025913 Unclassified 649
260 Ga0207671_10265310 3300025914 Bacteria 1352
261 Ga0207693_10187978 3300025915 Unclassified 1626
262 Ga0207663_10194196 3300025916 Unclassified 1460
263 Ga0207660_10006202 3300025917 Bacteria 7764
264 Ga0207660_10010022 3300025917 Bacteria 6138
265 Ga0207660_10727727 3300025917 Unclassified 810
266 Ga0207662_10061976 3300025918 Bacteria 2246
267 Ga0207662_10218438 3300025918 Bacteria 1240
268 Ga0207662_10471789 3300025918 Bacteria 861
269 Ga0207652_10000413 3300025921 Bacteria 44358
270 Ga0207652_10016567 3300025921 Bacteria 6019
271 Ga0207652_10131317 3300025921 Bacteria 2234
272 Ga0207646_10006480 3300025922 Bacteria 12086
273 Ga0207646_10344465 3300025922 Bacteria 1347
274 Ga0207646_11257837 3300025922 Bacteria 647
275 Ga0207681_10190539 3300025923 Bacteria 1569
276 Ga0207694_10000136 3300025924 Bacteria 74908
277 Ga0207694_10348014 3300025924 Bacteria 1226
278 Ga0207687_10120436 3300025927 Bacteria 1962
279 Ga0207687_10191189 3300025927 Bacteria 1593
280 Ga0207687_10520003 3300025927 Unclassified 995
281 Ga0207644_10000637 3300025931 Bacteria 22247
282 Ga0207690_10033992 3300025932 Bacteria 3282
283 Ga0207706_10054193 3300025933 Bacteria 3539
284 Ga0207706_10086819 3300025933 Bacteria 2750
285 Ga0207706_10562895 3300025933 Bacteria 981
286 Ga0207686_10000160 3300025934 Bacteria 51361
287 Ga0207686_10004183 3300025934 Bacteria 7739
288 Ga0207686_10319392 3300025934 Unclassified 1160
289 Ga0207686_10331169 3300025934 Unclassified 1141
290 Ga0207709_10000731 3300025935 Bacteria 26259
291 Ga0207709_10288946 3300025935 Bacteria 1214
292 Ga0207709_10916052 3300025935 Bacteria 713
293 Ga0207670_10784634 3300025936 Unclassified 793
294 Ga0207665_10001258 3300025939 Bacteria 17082
295 Ga0207665_10133300 3300025939 Bacteria 1766
296 Ga0207691_10214993 3300025940 Unclassified 1669
297 Ga0207711_10134958 3300025941 Bacteria 2216
298 Ga0207711_10926098 3300025941 Bacteria 810
299 Ga0207711_11618271 3300025941 Bacteria 591
300 Ga0207689_10006937 3300025942 Bacteria 9957
301 Ga0207689_10042529 3300025942 Bacteria 3758
302 Ga0207661_10003484 3300025944 Bacteria 10928
303 Ga0207661_10165787 3300025944 Bacteria 1920
304 Ga0207679_10009558 3300025945 Bacteria 6217
305 Ga0207667_10039623 3300025949 Bacteria 5021
306 Ga0207651_10001373 3300025960 Bacteria 11014
307 Ga0207651_10416150 3300025960 Bacteria 1146
308 Ga0207640_10035821 3300025981 Bacteria 3109
309 Ga0207640_10172764 3300025981 Bacteria 1612
310 Ga0207640_10491158 3300025981 Unclassified 1020
311 Ga0207658_11377959 3300025986 Bacteria 645
312 Ga0207677_10047767 3300026023 Bacteria 2876
313 Ga0207677_10049794 3300026023 Bacteria 2829
314 Ga0207677_11818133 3300026023 Unclassified 566
315 Ga0207703_10000080 3300026035 Bacteria 111786
316 Ga0207703_10039419 3300026035 Bacteria 3776
317 Ga0207639_10038860 3300026041 Bacteria 3542
318 Ga0207678_10025952 3300026067 Bacteria 5112
319 Ga0207708_10133577 3300026075 Bacteria 1942
320 Ga0207708_10279983 3300026075 Unclassified 1351
321 Ga0207708_10535425 3300026075 Unclassified 986
322 Ga0207708_10641321 3300026075 Unclassified 903
323 Ga0207702_10000006 3300026078 Bacteria 346370
324 Ga0207702_10311379 3300026078 Bacteria 1497
325 Ga0207641_10229808 3300026088 Bacteria 1724
326 Ga0207648_10069101 3300026089 Unclassified 3078
327 Ga0207648_10237264 3300026089 Unclassified 1623
328 Ga0207648_10284626 3300026089 Bacteria 1479
329 Ga0207676_10318571 3300026095 Unclassified 1427
330 Ga0207674_10016173 3300026116 Bacteria 8171
331 Ga0207674_10142768 3300026116 Bacteria 2353
332 Ga0207675_100001169 3300026118 Bacteria 26145
333 Ga0207675_100134325 3300026118 Bacteria 2347
334 Ga0207675_102653536 3300026118 Unclassified 510
335 Ga0207698_10006512 3300026142 Bacteria 7294
336 Ga0209983_1022909 3300027665 Bacteria 1310
337 Ga0209971_1137206 3300027682 Bacteria 603
338 Ga0209998_10037236 3300027717 Bacteria 1095
339 Ga0265331_10045632 3300031250 Bacteria 2115
340 Ga0265316_10017275 3300031344 Bacteria 6242
341 Ga0265313_10028120 3300031595 Bacteria 2928
342 Ga0307411_10167814 3300032005 Bacteria 1652
343 Ga0373940_0261172 3300035088 Bacteria 586
344 Ga0373939_0048377 3300035114 Unclassified 1310
345 Ga0373941_0035968 3300035115 Unclassified 1503
346 Ga0373941_0123775 3300035115 Bacteria 924
347 Ga0373935_0317167 3300035692 Bacteria 1105
348 Ga0395900_1068660 3300037418 Bacteria 725
349 Ga0242422_04777 3300038699 Unclassified 840
350 Ga0242420_002362 3300038996 Bacteria 2683
351 Ga0436362_1135339 3300039453 Bacteria 3898
352 Ga0453683_0329097 3300044673 Bacteria 980
353 Ga0451576_0090693 3300045051 Bacteria 3179
354 Ga0451576_0569801 3300045051 Bacteria 1190
355 Ga0451576_0803984 3300045051 Bacteria 987
356 Ga0451576_1881736 3300045051 Bacteria 618
357 Ga0495592_0308842 3300046454 Bacteria 1026
358 Ga0495590_0080876 3300046457 Bacteria 1144
359 Ga0495591_122311 3300046458 Bacteria 634
360 Ga0495639_0471852 3300046475 Unclassified 639
361 Ga0495662_0146776 3300046476 Bacteria 1162
362 Ga0495664_0262049 3300046477 Bacteria 1045
363 Ga0495584_0001377 3300046491 Bacteria 14673
364 Ga0495607_0091951 3300046501 Bacteria 1642
365 Ga0495606_0014745 3300046507 Bacteria 6073
366 Ga0495610_0056111 3300046512 Bacteria 1895
367 Ga0495631_0026419 3300046518 Bacteria 2667
368 Ga0495632_0111669 3300046519 Bacteria 1283
369 Ga0495637_0075463 3300046520 Bacteria 1352
370 Ga0495643_0036811 3300046522 Bacteria 2687
371 Ga0495648_0005821 3300046524 Bacteria 10150
372 Ga0495654_0118816 3300046530 Bacteria 1198
373 Ga0495586_0443004 3300046535 Unclassified 749
374 Ga0495621_0006637 3300046539 Bacteria 3388
375 Ga0495633_0037121 3300046558 Bacteria 2332
376 Ga0495625_0005835 3300046660 Bacteria 11102
377 Ga0495635_0326946 3300046663 Bacteria 1026
378 Ga0495670_0040373 3300046691 Bacteria 2327
379 Ga0495671_0031889 3300046692 Bacteria 2692
380 Ga0495649_0085034 3300046694 Bacteria 1688
381 Ga0495589_0017370 3300046794 Bacteria 3693
382 Ga0495600_0138362 3300046809 Bacteria 1581
383 Ga0495660_0013699 3300046810 Bacteria 4700
384 Ga0495636_0067332 3300047318 Bacteria 1524
385 Ga0495680_0424663 3300047322 Bacteria 914
386 Ga0495683_0001008 3300047323 Bacteria 19627
387 Ga0495681_0088736 3300047470 Bacteria 1368
388 Ga0495686_0012529 3300047472 Bacteria 5928
389 Ga0496100_0187672 3300048903 Bacteria 1499
390 Ga0496106_0016737 3300048909 Bacteria 5425
391 Ga0496112_0110162 3300048915 Bacteria 2723
392 Ga0496114_0632440 3300048917 Bacteria 942
393 Ga0495682_0195852 3300049460 Bacteria 717
394 Ga0501048_0840478 3300049582 Bacteria 660
395 Ga0501223_115906 3300049663 Bacteria 563
396 Ga0501272_073536 3300049769 Unclassified 503
397 nmdc:mga05p37_12809_c1 3300050507 Bacteria 10026
398 nmdc:mga05p37_195169_c1 3300050507 Bacteria 2455
399 nmdc:mga05p37_317953_c1 3300050507 Unclassified 1843
400 nmdc:mga05p37_603272_c1 3300050507 Bacteria 1239
401 nmdc:mga05p37_633725_c1 3300050507 Unclassified 1200
402 nmdc:mga09592_1002592_c1 3300050508 Unclassified 698
403 nmdc:mga06r32_131744_c1 3300050510 Unclassified 2472
404 nmdc:mga06r32_3771_c1 3300050510 Bacteria 13556
405 nmdc:mga06r32_497341_c1 3300050510 Bacteria 1196
406 nmdc:mga0n895_281982_c1 3300050512 Bacteria 1685
407 nmdc:mga0rr50_440_c1 3300050513 Bacteria 22331
408 nmdc:mga08x19_171954_c1 3300050514 Bacteria 1476
409 nmdc:mga08x19_207137_c1 3300050514 Bacteria 1345
410 nmdc:mga08x19_8_c1 3300050514 Bacteria 427794
411 nmdc:mga0a205_122748_c2 3300050515 Bacteria 2198
412 nmdc:mga0a205_163073_c1 3300050515 Unclassified 2125
413 nmdc:mga0a205_441504_c1 3300050515 Unclassified 1162
414 nmdc:mga0a205_858506_c1 3300050515 Bacteria 755
415 Ga0530510_0069945 3300061734 Bacteria 2547
416 2819564365 2818991440 Bacteria 4774720
417 2904465008 2904463128 Bacteria 4775606
418 Ga0105248_11948173
419 JGI24034J14986_100001
420 JGI24740J21852_10001580
421 JGI24739J22299_10046612
422 JGI24737J22298_10006103
423 JGI24735J21928_10042309
424 JGI24748J21848_1000012
425 JGI24034J26672_10000003
426 rootH2_10173696
427 Ga0055533_1000284
428 Ga0065704_10129630
429 Ga0065712_10076755
430 Ga0065715_10535684
431 Ga0065707_10224794
432 Ga0065707_10760653
433 Ga0070676_10119630
434 Ga0070683_100006159
435 Ga0070690_100023590
436 Ga0070690_100082718
437 Ga0070690_100216433
438 Ga0068869_100002739
439 Ga0068869_100034586
440 Ga0070680_100000100
441 Ga0070680_100033991
442 Ga0070680_100675843
443 Ga0070680_100711270
444 Ga0070680_100972785
445 Ga0070682_100024669
446 Ga0070682_100080544
447 Ga0068868_100121971
448 Ga0068868_100176642
449 Ga0068868_100748545
450 Ga0070687_100013514
451 Ga0070687_100581531
452 Ga0070661_100041315
453 Ga0070692_10151766
454 Ga0070669_101247846
455 Ga0070674_100470056
456 Ga0070673_100005167
457 Ga0070673_100817321
458 Ga0070673_101053104
459 Ga0070688_101138077
460 Ga0070659_100103040
461 Ga0070709_10031670
462 Ga0070709_10213665
463 Ga0070710_10024531
464 Ga0070701_10016368
465 Ga0070711_100216499
466 Ga0070700_100211435
467 Ga0070700_100430496
468 Ga0070700_100620876
469 Ga0070694_100014539
470 Ga0070694_100022149
471 Ga0070694_100099095
472 Ga0070694_100780719
473 Ga0070694_100987906
474 Ga0070694_101098557
475 Ga0070708_100002465
476 Ga0070708_100553145
477 Ga0070663_100274276
478 Ga0070662_100067982
479 Ga0070662_100124102
480 Ga0070662_101213150
481 Ga0070681_10000003
482 Ga0070681_10005257
483 Ga0070681_10063854
484 Ga0068867_100086650
485 Ga0068867_100176710
486 Ga0068867_100240387
487 Ga0068867_100790825
488 Ga0070685_10406375
489 Ga0070685_10523547
490 Ga0070706_100144347
491 Ga0070706_100527512
492 Ga0070706_100884122
493 Ga0070707_100005821
494 Ga0070707_100180497
495 Ga0070707_101627412
496 Ga0070707_102046500
497 Ga0070698_100205829
498 Ga0070698_100275610
499 Ga0070699_100183099
500 Ga0070699_100227453
501 Ga0070699_100245933
502 Ga0070699_101163064
503 Ga0070679_100000617
504 Ga0070679_100017176
505 Ga0070679_100018071
506 Ga0070679_100463787
507 Ga0070684_100004879
508 Ga0070697_100077717
509 Ga0070697_100125935
510 Ga0070697_100781888
511 Ga0070697_100990494
512 Ga0068853_100387043
513 Ga0068853_102110609
514 Ga0070672_100444347
515 Ga0070686_100007978
516 Ga0070686_100086687
517 Ga0070695_100274541
518 Ga0070695_100359576
519 Ga0070695_100403783
520 Ga0070695_100450862
521 Ga0070695_100926823
522 Ga0070695_101729067
523 Ga0070696_100075118
524 Ga0070693_100026675
525 Ga0070693_100259200
526 Ga0070693_100449450
527 Ga0070704_100159562
528 Ga0070704_100442300
529 Ga0070704_100533256
530 Ga0068855_100045356
531 Ga0068855_101533756
532 Ga0070664_100006653
533 Ga0068857_100010136
534 Ga0068857_100035722
535 Ga0068857_100171106
536 Ga0068857_100229110
537 Ga0068854_100016523
538 Ga0068854_100038826
539 Ga0068854_101627632
540 Ga0068856_100002036
541 Ga0068856_100013769
542 Ga0070702_100396350
543 Ga0070702_100545232
544 Ga0070702_101022071
545 Ga0068852_100159098
546 Ga0068852_101284984
547 Ga0068859_100297953
548 Ga0068859_100754431
549 Ga0068864_100251495
550 Ga0068864_100826660
551 Ga0068864_100891580
552 Ga0068861_100079297
553 Ga0068851_10003461
554 Ga0068858_100000468
555 Ga0068858_100152408
556 Ga0068858_100285790
557 Ga0068858_100961624
558 Ga0081455_10357242
559 Ga0070716_100009134
560 Ga0070716_100078071
561 Ga0070712_100199144
562 Ga0070712_100457053
563 Ga0068871_100240338
564 Ga0068871_101959585
565 Ga0075431_100042864
566 Ga0075431_100166672
567 Ga0075433_10048713
568 Ga0075433_10132714
569 Ga0075433_10496064
570 Ga0075434_100236706
571 Ga0075434_100347541
572 Ga0075434_101175115
573 Ga0075434_102417005
574 Ga0075429_100845062
575 Ga0075429_100940913
576 Ga0075429_101370318
577 Ga0068865_100018203
578 Ga0068865_100330339
579 Ga0075436_100000016
580 Ga0075436_100008158
581 Ga0075436_100164130
582 Ga0097620_100297953
583 Ga0097620_100754379
584 Ga0075435_100000971
585 Ga0075435_100579017
586 Ga0075435_100781924
587 Ga0075435_101740981
588 Ga0099795_10013511
589 Ga0105244_10119001
590 Ga0105240_10004881
591 Ga0105240_10016877
592 Ga0105240_10049014
593 Ga0105240_10677509
594 Ga0111539_10351750
595 Ga0111539_10838663
596 Ga0105245_10101857
597 Ga0105245_10154421
598 Ga0105245_10788831
599 Ga0105245_10870459
600 Ga0105247_10000003
601 Ga0114129_10015871
602 Ga0114129_10135001
603 Ga0114129_10195385
604 Ga0114129_10601975
605 Ga0114129_11380682
606 Ga0114129_11686952
607 Ga0105243_10000382
608 Ga0105243_11403889
609 Ga0105243_12114620
610 Ga0105241_10001823
611 Ga0105242_10000344
612 Ga0105242_10002927
613 Ga0105242_10365796
614 Ga0105242_12952203
615 Ga0105248_10122475
616 Ga0105248_11062179
617 Ga0105248_13218584
618 Ga0105237_10111094
619 Ga0105237_10321142
620 Ga0105238_10001367
621 Ga0105238_10038154
622 Ga0105239_10001966
623 Ga0105239_10015287
624 Ga0105239_10074191
625 Ga0105239_10134745
626 Ga0105239_11744830
627 Ga0105246_10287471
628 Ga0157373_10093171
629 Ga0157373_10490864
630 Ga0157373_10563922
631 Ga0157373_11144584
632 Ga0157371_10574895
633 Ga0157369_10223903
634 Ga0157378_10000015
635 Ga0157378_10015736
636 Ga0157378_10048473
637 Ga0157378_10078759
638 Ga0157378_10082985
639 Ga0157378_10155021
640 Ga0157378_10168552
641 Ga0163162_10042131
642 Ga0163162_10657243
643 Ga0163162_10960069
644 Ga0157372_10842310
645 Ga0157375_10021033
646 Ga0157375_10580302
647 Ga0157375_10823225
648 Ga0163163_10206312
649 Ga0157380_10121048
650 Ga0157379_10223553
651 Ga0157379_10467075
652 Ga0157376_10469727
653 Ga0163161_10008648
654 Ga0163161_10220319
655 Ga0213873_10139440
656 Ga0207672_1000668
657 Ga0209674_100043
658 Ga0207656_10335357
659 Ga0207655_1062600
660 Ga0207642_10529179
661 Ga0207710_10000001
662 Ga0207688_10580789
663 Ga0207680_11334798
664 Ga0207647_10001253
665 Ga0207685_10287379
666 Ga0207699_10005137
667 Ga0207699_10041776
668 Ga0207645_10003535
669 Ga0207684_10297371
670 Ga0207684_10311982
671 Ga0207654_10000446
672 Ga0207707_10000001
673 Ga0207707_10020211
674 Ga0207707_10026568
675 Ga0207695_10001480
676 Ga0207695_11169174
677 Ga0207671_10265310
678 Ga0207693_10187978
679 Ga0207663_10194196
680 Ga0207660_10006202
681 Ga0207660_10010022
682 Ga0207660_10727727
683 Ga0207662_10061976
684 Ga0207662_10218438
685 Ga0207662_10471789
686 Ga0207652_10000413
687 Ga0207652_10016567
688 Ga0207652_10131317
689 Ga0207646_10006480
690 Ga0207646_10344465
691 Ga0207646_11257837
692 Ga0207681_10190539
693 Ga0207694_10000136
694 Ga0207694_10348014
695 Ga0207687_10120436
696 Ga0207687_10191189
697 Ga0207687_10520003
698 Ga0207644_10000637
699 Ga0207690_10033992
700 Ga0207706_10054193
701 Ga0207706_10086819
702 Ga0207706_10562895
703 Ga0207686_10000160
704 Ga0207686_10004183
705 Ga0207686_10319392
706 Ga0207686_10331169
707 Ga0207709_10000731
708 Ga0207709_10288946
709 Ga0207709_10916052
710 Ga0207670_10784634
711 Ga0207665_10001258
712 Ga0207665_10133300
713 Ga0207691_10214993
714 Ga0207711_10134958
715 Ga0207711_10926098
716 Ga0207711_11618271
717 Ga0207689_10006937
718 Ga0207689_10042529
719 Ga0207661_10003484
720 Ga0207661_10165787
721 Ga0207679_10009558
722 Ga0207667_10039623
723 Ga0207651_10001373
724 Ga0207651_10416150
725 Ga0207640_10035821
726 Ga0207640_10172764
727 Ga0207640_10491158
728 Ga0207658_11377959
729 Ga0207677_10047767
730 Ga0207677_10049794
731 Ga0207677_11818133
732 Ga0207703_10000080
733 Ga0207703_10039419
734 Ga0207639_10038860
735 Ga0207678_10025952
736 Ga0207708_10133577
737 Ga0207708_10279983
738 Ga0207708_10535425
739 Ga0207708_10641321
740 Ga0207702_10000006
741 Ga0207702_10311379
742 Ga0207641_10229808
743 Ga0207648_10069101
744 Ga0207648_10237264
745 Ga0207648_10284626
746 Ga0207676_10318571
747 Ga0207674_10016173
748 Ga0207674_10142768
749 Ga0207675_100001169
750 Ga0207675_100134325
751 Ga0207675_102653536
752 Ga0207698_10006512
753 Ga0209983_1022909
754 Ga0209971_1137206
755 Ga0209998_10037236
756 Ga0265331_10045632
757 Ga0265316_10017275
758 Ga0265313_10028120
759 Ga0307411_10167814
760 Ga0373940_0261172
761 Ga0373939_0048377
762 Ga0373941_0035968
763 Ga0373941_0123775
764 Ga0373935_0317167
765 Ga0395900_1068660
766 Ga0242422_04777
767 Ga0242420_002362
768 Ga0436362_1135339
769 Ga0453683_0329097
770 Ga0451576_0090693
771 Ga0451576_0569801
772 Ga0451576_0803984
773 Ga0451576_1881736
774 Ga0495592_0308842
775 Ga0495590_0080876
776 Ga0495591_122311
777 Ga0495639_0471852
778 Ga0495662_0146776
779 Ga0495664_0262049
780 Ga0495584_0001377
781 Ga0495607_0091951
782 Ga0495606_0014745
783 Ga0495610_0056111
784 Ga0495631_0026419
785 Ga0495632_0111669
786 Ga0495637_0075463
787 Ga0495643_0036811
788 Ga0495648_0005821
789 Ga0495654_0118816
790 Ga0495586_0443004
791 Ga0495621_0006637
792 Ga0495633_0037121
793 Ga0495625_0005835
794 Ga0495635_0326946
795 Ga0495670_0040373
796 Ga0495671_0031889
797 Ga0495649_0085034
798 Ga0495589_0017370
799 Ga0495600_0138362
800 Ga0495660_0013699
801 Ga0495636_0067332
802 Ga0495680_0424663
803 Ga0495683_0001008
804 Ga0495681_0088736
805 Ga0495686_0012529
806 Ga0496100_0187672
807 Ga0496106_0016737
808 Ga0496112_0110162
809 Ga0496114_0632440
810 Ga0495682_0195852
811 Ga0501048_0840478
812 Ga0501223_115906
813 Ga0501272_073536
814 nmdc:mga05p37_12809_c1
815 nmdc:mga05p37_195169_c1
816 nmdc:mga05p37_317953_c1
817 nmdc:mga05p37_603272_c1
818 nmdc:mga05p37_633725_c1
819 nmdc:mga09592_1002592_c1
820 nmdc:mga06r32_131744_c1
821 nmdc:mga06r32_3771_c1
822 nmdc:mga06r32_497341_c1
823 nmdc:mga0n895_281982_c1
824 nmdc:mga0rr50_440_c1
825 nmdc:mga08x19_171954_c1
826 nmdc:mga08x19_207137_c1
827 nmdc:mga08x19_8_c1
828 nmdc:mga0a205_122748_c2
829 nmdc:mga0a205_163073_c1
830 nmdc:mga0a205_441504_c1
831 nmdc:mga0a205_858506_c1
832 Ga0530510_0069945
833 2819564365
834 2904465008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

2

131

0.94

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

1

132

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.9341 1 137
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.9209 1 137
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8538 1 135
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8476 1 135
1u7i-assembly1.cif.gz_B crystal structure of protein of unknown function pa1358 from pseudomonas aeruginosa 0.8391 1 136
ID Description Score Start End Superfamily
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9217 7 137 3.10.180.10
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9144 7 137 3.10.180.10
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9074 81 135 3.30.720.110
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8954 75 135 3.30.720.110
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8866 7 140 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A1M7QCG0-F1-model_v4 PhnB protein 0.9888 1 135
AF-A0A2M9PGM3-F1-model_v4 VOC family protein 0.9851 1 134
AF-V4NVB4-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 0.9828 1 136
AF-A0A1M7QCG0-F1-model_v4 PhnB protein 0.9815 1 135
AF-A0A2S0XRP2-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.9802 1 134 GO:0008168
GO:0032259

Map