F439021

General Info

Members Datasets Scaffolds Average Seq Length
417 265 834 276

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100192137|Ga0075430_1001921372
Length 298
Sequence VIDLNLPMQEYKTTGQQQAEPAPAAASRFDPRRIYTILVLAPLVYAVIRYLPPLAFSGAVVLAGGLALFEFYRMCFGGRSHSLLIGIGLTGFAALILVTHRPDILVPILLATLIGIISVPLLSRISLEQSLRDSAVTLFGVLYLGLTLGTLSMTRLLPQGEWLIFFLLLVTWASDTGAYYVGTLFGRHRLAPTISPKKTVEGLVGGFFGAIIVAYAARWWFLPELSSLDCLILATLLTITGLWGDLTESAMKRSVGMKDSGGILPGHGGMLDRLDSLLFTAPVFYYYVTMVSRLRVIE

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
171 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
194 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
195 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
196 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
197 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
198 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
199 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
200 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
217 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
218 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
219 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
220 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
221 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
222 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
223 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
224 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
225 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
226 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
227 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
228 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
229 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
230 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
231 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
232 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
233 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
234 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
235 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
236 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
237 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
238 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
239 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
243 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
244 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
245 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
246 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
247 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
248 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
249 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
253 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.24
Rhizosphere 99.52
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100192137 3300006846 Bacteria 1697
2 JGI26145J50221_1001158 3300003371 Bacteria 2088
3 Ga0065715_10194181 3300005293 Bacteria 1397
4 Ga0065707_10024541 3300005295 Bacteria 1474
5 Ga0065707_10106092 3300005295 Bacteria 2607
6 Ga0070658_10024907 3300005327 Bacteria 4799
7 Ga0070676_10003268 3300005328 Bacteria 8419
8 Ga0070690_100000107 3300005330 Bacteria 43179
9 Ga0070690_100001542 3300005330 Bacteria 12083
10 Ga0070690_100005746 3300005330 Bacteria 6989
11 Ga0070690_100023160 3300005330 Bacteria 3807
12 Ga0070670_100001784 3300005331 Bacteria 17512
13 Ga0070670_100009949 3300005331 Bacteria 8118
14 Ga0070670_100527682 3300005331 Unclassified 1052
15 Ga0070677_10003491 3300005333 Bacteria 5071
16 Ga0068869_100027063 3300005334 Bacteria 3995
17 Ga0068869_100300993 3300005334 Bacteria 1295
18 Ga0070666_10007075 3300005335 Bacteria 6915
19 Ga0070666_10031264 3300005335 Bacteria 3514
20 Ga0070680_100002947 3300005336 Bacteria 12648
21 Ga0068868_100652163 3300005338 Bacteria 937
22 Ga0070660_100014250 3300005339 Bacteria 5725
23 Ga0070689_100000022 3300005340 Bacteria 127360
24 Ga0070689_100004489 3300005340 Bacteria 9439
25 Ga0070689_100431600 3300005340 Bacteria 1118
26 Ga0070691_10104098 3300005341 Bacteria 1413
27 Ga0070687_100004764 3300005343 Bacteria 5431
28 Ga0070687_100005006 3300005343 Bacteria 5337
29 Ga0070687_100061043 3300005343 Bacteria 1991
30 Ga0070661_100002141 3300005344 Bacteria 13611
31 Ga0070661_100010493 3300005344 Bacteria 6445
32 Ga0070692_10009243 3300005345 Bacteria 4437
33 Ga0070669_100000006 3300005353 Bacteria 268982
34 Ga0070669_100003084 3300005353 Bacteria 11996
35 Ga0070675_100004992 3300005354 Bacteria 10130
36 Ga0070675_100178461 3300005354 Bacteria 1835
37 Ga0070675_100347756 3300005354 Bacteria 1314
38 Ga0070671_100060742 3300005355 Bacteria 3147
39 Ga0070674_100005236 3300005356 Bacteria 7464
40 Ga0070673_100002304 3300005364 Bacteria 11596
41 Ga0070673_100020037 3300005364 Bacteria 4816
42 Ga0070673_100325832 3300005364 Bacteria 1358
43 Ga0070673_100852760 3300005364 Unclassified 843
44 Ga0070688_100001166 3300005365 Bacteria 13076
45 Ga0070688_100043473 3300005365 Bacteria 2768
46 Ga0070659_100008981 3300005366 Bacteria 7329
47 Ga0070667_100016466 3300005367 Bacteria 6118
48 Ga0070709_10329980 3300005434 Bacteria 1122
49 Ga0070701_10000175 3300005438 Bacteria 19804
50 Ga0070701_10040281 3300005438 Bacteria 2374
51 Ga0070705_100007838 3300005440 Bacteria 5274
52 Ga0070705_100027780 3300005440 Bacteria 3092
53 Ga0070700_100002053 3300005441 Bacteria 10234
54 Ga0070700_100006861 3300005441 Bacteria 6111
55 Ga0070694_100013982 3300005444 Bacteria 5019
56 Ga0070694_100047319 3300005444 Bacteria 2890
57 Ga0070694_100097950 3300005444 Bacteria 2069
58 Ga0070708_100008526 3300005445 Bacteria 8235
59 Ga0070708_100336676 3300005445 Unclassified 1422
60 Ga0070663_100066607 3300005455 Bacteria 2610
61 Ga0070678_100001803 3300005456 Bacteria 11540
62 Ga0070662_100013662 3300005457 Bacteria 5406
63 Ga0070681_10002791 3300005458 Bacteria 16131
64 Ga0070681_10017818 3300005458 Bacteria 7097
65 Ga0070681_10210815 3300005458 Bacteria 1859
66 Ga0068867_100005005 3300005459 Bacteria 9344
67 Ga0068867_100007291 3300005459 Bacteria 7825
68 Ga0070685_10000110 3300005466 Bacteria 52202
69 Ga0070685_10109240 3300005466 Bacteria 1701
70 Ga0070706_100024216 3300005467 Bacteria 5587
71 Ga0070706_100031970 3300005467 Bacteria 4853
72 Ga0070706_100061188 3300005467 Bacteria 3477
73 Ga0070707_100000110 3300005468 Bacteria 75472
74 Ga0070707_100035027 3300005468 Bacteria 4787
75 Ga0070707_100053334 3300005468 Bacteria 3877
76 Ga0070698_100077044 3300005471 Bacteria 3335
77 Ga0070699_100044362 3300005518 Bacteria 3850
78 Ga0070699_100089715 3300005518 Bacteria 2686
79 Ga0070679_100211154 3300005530 Bacteria 1905
80 Ga0070684_100038513 3300005535 Bacteria 4107
81 Ga0070697_100083672 3300005536 Bacteria 2631
82 Ga0070697_100174417 3300005536 Bacteria 1821
83 Ga0068853_100144771 3300005539 Bacteria 2135
84 Ga0070672_100002138 3300005543 Bacteria 12467
85 Ga0070672_100182614 3300005543 Bacteria 1749
86 Ga0070686_100000025 3300005544 Bacteria 127360
87 Ga0070686_100003006 3300005544 Bacteria 9242
88 Ga0070686_100003747 3300005544 Bacteria 8355
89 Ga0070686_100007035 3300005544 Bacteria 6272
90 Ga0070686_100020084 3300005544 Bacteria 3950
91 Ga0070695_100005400 3300005545 Bacteria 7523
92 Ga0070695_100159814 3300005545 Bacteria 1581
93 Ga0070696_100014027 3300005546 Bacteria 5380
94 Ga0070696_100046913 3300005546 Bacteria 2997
95 Ga0070693_100036068 3300005547 Bacteria 2747
96 Ga0070665_100269803 3300005548 Bacteria 1703
97 Ga0070704_100001426 3300005549 Bacteria 12763
98 Ga0070704_100038568 3300005549 Bacteria 3274
99 Ga0070704_100228439 3300005549 Bacteria 1517
100 Ga0070664_100002236 3300005564 Bacteria 15581
101 Ga0070664_100009588 3300005564 Bacteria 7853
102 Ga0070664_100042457 3300005564 Bacteria 3838
103 Ga0068857_100013282 3300005577 Bacteria 7173
104 Ga0068857_100175684 3300005577 Unclassified 1948
105 Ga0068854_100024418 3300005578 Bacteria 4139
106 Ga0070702_100056347 3300005615 Bacteria 2270
107 Ga0068859_100000648 3300005617 Bacteria 34840
108 Ga0068859_100170916 3300005617 Bacteria 2254
109 Ga0068859_100708205 3300005617 Bacteria 1097
110 Ga0068864_100007859 3300005618 Bacteria 8789
111 Ga0068864_100042991 3300005618 Bacteria 3867
112 Ga0068864_100637626 3300005618 Bacteria 1037
113 Ga0068870_10050688 3300005840 Bacteria 2194
114 Ga0068863_100066785 3300005841 Bacteria 3402
115 Ga0068863_100123146 3300005841 Bacteria 2474
116 Ga0068863_100242543 3300005841 Bacteria 1739
117 Ga0068858_100014808 3300005842 Bacteria 7338
118 Ga0068858_100127629 3300005842 Bacteria 2383
119 Ga0068860_100052332 3300005843 Bacteria 3884
120 Ga0068860_100496283 3300005843 Bacteria 1218
121 Ga0075432_10001423 3300006058 Bacteria 7794
122 Ga0070715_10026162 3300006163 Bacteria 2317
123 Ga0070716_100022703 3300006173 Bacteria 3319
124 Ga0070716_100208904 3300006173 Bacteria 1303
125 Ga0070716_100270004 3300006173 Bacteria 1168
126 Ga0097621_100008607 3300006237 Bacteria 7357
127 Ga0097621_100009356 3300006237 Bacteria 7112
128 Ga0097621_100101393 3300006237 Bacteria 2422
129 Ga0097621_100248973 3300006237 Bacteria 1555
130 Ga0097621_100348150 3300006237 Unclassified 1317
131 Ga0068871_100002097 3300006358 Bacteria 13494
132 Ga0068871_100143757 3300006358 Bacteria 2030
133 Ga0068871_100184931 3300006358 Bacteria 1792
134 Ga0068871_100333536 3300006358 Bacteria 1338
135 Ga0075428_100442988 3300006844 Bacteria 1391
136 Ga0075430_100030369 3300006846 Bacteria 4589
137 Ga0075430_100072263 3300006846 Bacteria 2893
138 Ga0075431_100171809 3300006847 Bacteria 2227
139 Ga0075433_10007563 3300006852 Bacteria 8618
140 Ga0075433_10130768 3300006852 Bacteria 2230
141 Ga0075433_10460681 3300006852 Bacteria 1120
142 Ga0075434_100023836 3300006871 Bacteria 5972
143 Ga0075434_100038777 3300006871 Bacteria 4720
144 Ga0075434_100546026 3300006871 Bacteria 1178
145 Ga0075429_100021825 3300006880 Bacteria 5550
146 Ga0075429_100055151 3300006880 Bacteria 3458
147 Ga0068865_100006429 3300006881 Bacteria 7165
148 Ga0097620_100000648 3300006931 Bacteria 34840
149 Ga0097620_100170914 3300006931 Bacteria 2254
150 Ga0097620_100708194 3300006931 Bacteria 1097
151 Ga0075435_100056118 3300007076 Bacteria 3183
152 Ga0075435_100062725 3300007076 Bacteria 3017
153 Ga0075435_100248892 3300007076 Bacteria 1513
154 Ga0105245_10005072 3300009098 Bacteria 11578
155 Ga0114129_10007844 3300009147 Bacteria 15189
156 Ga0114129_10012020 3300009147 Bacteria 12315
157 Ga0105241_10178433 3300009174 Bacteria 1760
158 Ga0105242_10003752 3300009176 Bacteria 11807
159 Ga0105242_10008891 3300009176 Bacteria 7706
160 Ga0105242_10049656 3300009176 Bacteria 3414
161 Ga0105248_10000624 3300009177 Bacteria 40257
162 Ga0105248_10095833 3300009177 Bacteria 3341
163 Ga0105248_10493295 3300009177 Bacteria 1381
164 Ga0105239_10035951 3300010375 Bacteria 5438
165 Ga0105239_10160329 3300010375 Bacteria 2513
166 Ga0105246_10007146 3300011119 Bacteria 6838
167 Ga0157371_10025081 3300013102 Bacteria 4349
168 Ga0157374_10009960 3300013296 Bacteria 8160
169 Ga0157374_10019299 3300013296 Bacteria 6032
170 Ga0157374_10216509 3300013296 Bacteria 1879
171 Ga0157378_10003351 3300013297 Bacteria 14258
172 Ga0157378_10075086 3300013297 Bacteria 3043
173 Ga0157378_10213492 3300013297 Bacteria 1831
174 Ga0163162_10001426 3300013306 Bacteria 22245
175 Ga0157375_10015430 3300013308 Bacteria 6838
176 Ga0157375_10021745 3300013308 Bacteria 5890
177 Ga0163163_10004635 3300014325 Bacteria 11746
178 Ga0163163_10038143 3300014325 Bacteria 4680
179 Ga0163163_10056810 3300014325 Bacteria 3868
180 Ga0163163_10588770 3300014325 Bacteria 1176
181 Ga0157380_10009506 3300014326 Bacteria 6970
182 Ga0157380_10017005 3300014326 Bacteria 5373
183 Ga0157377_10000808 3300014745 Bacteria 12944
184 Ga0157376_10000364 3300014969 Bacteria 29767
185 Ga0157376_10000954 3300014969 Bacteria 18842
186 Ga0207697_10037804 3300025315 Bacteria 1979
187 Ga0207642_10040408 3300025899 Bacteria 2035
188 Ga0207688_10038066 3300025901 Bacteria 2668
189 Ga0207680_10019647 3300025903 Bacteria 3617
190 Ga0207680_10021377 3300025903 Bacteria 3500
191 Ga0207680_10100828 3300025903 Bacteria 1855
192 Ga0207685_10005879 3300025905 Bacteria 3288
193 Ga0207685_10022388 3300025905 Bacteria 2135
194 Ga0207645_10000012 3300025907 Bacteria 131374
195 Ga0207684_10086052 3300025910 Bacteria 2677
196 Ga0207684_10090643 3300025910 Bacteria 2605
197 Ga0207684_10100415 3300025910 Bacteria 2473
198 Ga0207707_10017047 3300025912 Bacteria 6328
199 Ga0207707_10120246 3300025912 Bacteria 2296
200 Ga0207660_10030184 3300025917 Bacteria 3725
201 Ga0207660_10090444 3300025917 Bacteria 2268
202 Ga0207662_10002618 3300025918 Bacteria 9081
203 Ga0207662_10035594 3300025918 Bacteria 2908
204 Ga0207662_10040086 3300025918 Bacteria 2751
205 Ga0207657_10000268 3300025919 Bacteria 55307
206 Ga0207649_10008315 3300025920 Bacteria 5655
207 Ga0207649_10012280 3300025920 Bacteria 4747
208 Ga0207646_10000035 3300025922 Bacteria 209056
209 Ga0207646_10052929 3300025922 Bacteria 3632
210 Ga0207646_10097135 3300025922 Bacteria 2639
211 Ga0207681_10000006 3300025923 Bacteria 496979
212 Ga0207681_10004869 3300025923 Bacteria 8249
213 Ga0207650_10005302 3300025925 Bacteria 8797
214 Ga0207659_10260714 3300025926 Bacteria 1410
215 Ga0207659_10298514 3300025926 Bacteria 1322
216 Ga0207687_10010468 3300025927 Bacteria 6058
217 Ga0207644_10006510 3300025931 Bacteria 7615
218 Ga0207690_10007297 3300025932 Bacteria 6564
219 Ga0207706_10001875 3300025933 Bacteria 20601
220 Ga0207686_10004711 3300025934 Bacteria 7315
221 Ga0207709_10006506 3300025935 Bacteria 6563
222 Ga0207670_10000023 3300025936 Bacteria 145527
223 Ga0207704_10001416 3300025938 Bacteria 10725
224 Ga0207665_10015818 3300025939 Bacteria 4951
225 Ga0207665_10036102 3300025939 Bacteria 3285
226 Ga0207665_10100334 3300025939 Bacteria 2020
227 Ga0207665_10329325 3300025939 Bacteria 1148
228 Ga0207691_10002462 3300025940 Bacteria 18101
229 Ga0207691_10005243 3300025940 Bacteria 12511
230 Ga0207711_10005817 3300025941 Bacteria 10420
231 Ga0207711_10268395 3300025941 Bacteria 1569
232 Ga0207711_10461242 3300025941 Bacteria 1183
233 Ga0207689_10008569 3300025942 Bacteria 8911
234 Ga0207679_10002576 3300025945 Bacteria 11175
235 Ga0207679_10005067 3300025945 Bacteria 8237
236 Ga0207667_10118624 3300025949 Bacteria 2726
237 Ga0207651_10001895 3300025960 Bacteria 9809
238 Ga0207651_10002993 3300025960 Bacteria 8183
239 Ga0207651_10034572 3300025960 Bacteria 3275
240 Ga0207640_10393860 3300025981 Bacteria 1126
241 Ga0207658_10026168 3300025986 Bacteria 4088
242 Ga0207708_10000228 3300026075 Bacteria 44336
243 Ga0207708_10001059 3300026075 Bacteria 20614
244 Ga0207641_10033855 3300026088 Bacteria 4246
245 Ga0207641_10349242 3300026088 Bacteria 1409
246 Ga0207648_10006261 3300026089 Bacteria 11850
247 Ga0207648_10016694 3300026089 Bacteria 6699
248 Ga0207676_10001461 3300026095 Bacteria 17564
249 Ga0207676_10051101 3300026095 Bacteria 3226
250 Ga0207674_10013002 3300026116 Bacteria 9276
251 Ga0207674_10299508 3300026116 Unclassified 1557
252 Ga0207675_100108086 3300026118 Bacteria 2623
253 Ga0207683_10000028 3300026121 Bacteria 109908
254 Ga0209973_1011489 3300027252 Unclassified 1063
255 Ga0209969_1000198 3300027360 Bacteria 8049
256 Ga0209981_1000373 3300027378 Bacteria 5713
257 Ga0209996_1000079 3300027395 Bacteria 13164
258 Ga0210000_1000096 3300027462 Bacteria 12256
259 Ga0209995_1000009 3300027471 Bacteria 32653
260 Ga0209968_1000024 3300027526 Bacteria 28731
261 Ga0209982_1000908 3300027552 Bacteria 3892
262 Ga0209970_1000067 3300027614 Bacteria 14173
263 Ga0210002_1000051 3300027617 Bacteria 17640
264 Ga0209983_1007987 3300027665 Bacteria 2165
265 Ga0209971_1000276 3300027682 Bacteria 14514
266 Ga0209966_1000248 3300027695 Bacteria 19851
267 Ga0209998_10000378 3300027717 Bacteria 12841
268 Ga0209974_10000246 3300027876 Bacteria 17475
269 Ga0209974_10000308 3300027876 Bacteria 15916
270 Ga0207428_10002466 3300027907 Bacteria 18484
271 Ga0268264_10506665 3300028381 Bacteria 1178
272 Ga0307408_100047252 3300031548 Bacteria 3081
273 Ga0316576_10012286 3300031727 Bacteria 5652
274 Ga0307405_10015756 3300031731 Bacteria 4102
275 Ga0307407_10113023 3300031903 Bacteria 1708
276 Ga0307412_10083334 3300031911 Bacteria 2216
277 Ga0307409_100104192 3300031995 Bacteria 2362
278 Ga0307416_100130431 3300032002 Bacteria 2261
279 Ga0307411_10081518 3300032005 Bacteria 2228
280 Ga0307411_10407286 3300032005 Bacteria 1126
281 Ga0307415_100018556 3300032126 Bacteria 4204
282 Ga0316593_10003080 3300032168 Bacteria 4076
283 Ga0373926_0056024 3300035083 Bacteria 1430
284 Ga0373949_0026475 3300035090 Bacteria 1359
285 Ga0373954_0033664 3300035118 Bacteria 2371
286 Ga0373942_0011486 3300035207 Bacteria 2101
287 Ga0373931_0076648 3300035691 Unclassified 1837
288 Ga0373935_0081258 3300035692 Bacteria 2107
289 Ga0373947_0013274 3300035725 Bacteria 4719
290 Ga0373947_0129291 3300035725 Bacteria 1611
291 Ga0373937_0026972 3300036401 Bacteria 5193
292 Ga0373937_0086523 3300036401 Bacteria 2900
293 Ga0373925_0137902 3300037068 Bacteria 1907
294 Ga0373925_0348790 3300037068 Bacteria 1202
295 Ga0400483_262215 3300039062 Bacteria 1768
296 Ga0439461_0012864 3300041410 Bacteria 1572
297 Ga0451807_0759082 3300041486 Bacteria 2946
298 Ga0439448_0016218 3300042005 Bacteria 2266
299 Ga0439446_0001962 3300042156 Bacteria 4855
300 Ga0439434_0003270 3300042435 Bacteria 4758
301 Ga0451577_0000051 3300042876 Bacteria 297831
302 Ga0453684_0563936 3300044712 Bacteria 1252
303 Ga0451576_0007611 3300045051 Bacteria 12897
304 Ga0451576_0195050 3300045051 Bacteria 2115
305 Ga0451576_0493979 3300045051 Bacteria 1286
306 Ga0495629_0020034 3300046459 Bacteria 4775
307 Ga0495580_0260247 3300046472 Bacteria 1187
308 Ga0495594_0003347 3300046499 Bacteria 8286
309 Ga0495594_0024201 3300046499 Bacteria 3259
310 Ga0495618_0132326 3300046514 Bacteria 1596
311 Ga0495618_0156536 3300046514 Bacteria 1454
312 Ga0495630_0448868 3300046517 Unclassified 988
313 Ga0495667_0002855 3300046559 Bacteria 11559
314 Ga0495657_0003984 3300046675 Bacteria 11850
315 Ga0495657_0042943 3300046675 Bacteria 3084
316 Ga0495599_0196985 3300046678 Bacteria 1238
317 Ga0495647_0146028 3300046681 Bacteria 1011
318 Ga0495613_0098453 3300046689 Bacteria 2113
319 Ga0495581_0015233 3300047315 Bacteria 4463
320 Ga0495674_0099690 3300047319 Bacteria 2473
321 Ga0495676_0129067 3300047321 Bacteria 1828
322 Ga0495680_0026204 3300047322 Bacteria 4811
323 Ga0495615_0005444 3300048090 Bacteria 2290
324 Ga0501292_000416 3300049515 Bacteria 5641
325 Ga0501292_007630 3300049515 Bacteria 1567
326 Ga0501294_000911 3300049517 Bacteria 3179
327 Ga0501295_000318 3300049518 Bacteria 4659
328 Ga0501296_000042 3300049519 Bacteria 14294
329 Ga0501297_002519 3300049520 Bacteria 1775
330 Ga0501300_000410 3300049523 Bacteria 6488
331 Ga0501303_000288 3300049526 Bacteria 4146
332 Ga0501303_009066 3300049526 Bacteria 913
333 Ga0501031_0012144 3300049568 Bacteria 5616
334 Ga0501031_0073597 3300049568 Unclassified 2224
335 Ga0501032_0018719 3300049569 Bacteria 4847
336 Ga0501036_0036341 3300049572 Bacteria 4169
337 Ga0501037_0011449 3300049573 Bacteria 6530
338 Ga0501038_0017176 3300049574 Bacteria 6542
339 Ga0501039_0018843 3300049575 Bacteria 5297
340 Ga0501040_0048670 3300049576 Bacteria 2897
341 Ga0501040_0053334 3300049576 Bacteria 2769
342 Ga0501041_0000673 3300049577 Bacteria 18097
343 Ga0501042_0000380 3300049578 Bacteria 22511
344 Ga0501043_0072414 3300049579 Bacteria 2707
345 Ga0501043_0130563 3300049579 Bacteria 1969
346 Ga0501048_0000196 3300049582 Bacteria 39241
347 Ga0501067_0011660 3300049583 Bacteria 4869
348 Ga0501075_0003125 3300049591 Bacteria 11070
349 Ga0501076_0071006 3300049592 Unclassified 2785
350 Ga0501077_0000106 3300049593 Bacteria 44096
351 Ga0501198_014892 3300049649 Bacteria 1189
352 Ga0501199_000754 3300049650 Bacteria 2879
353 Ga0501201_002072 3300049651 Bacteria 1845
354 Ga0501202_002120 3300049652 Bacteria 3296
355 Ga0501202_004990 3300049652 Bacteria 2338
356 Ga0501206_000369 3300049653 Bacteria 5339
357 Ga0501206_002740 3300049653 Bacteria 2220
358 Ga0501207_013242 3300049654 Bacteria 1247
359 Ga0501214_002644 3300049659 Bacteria 1526
360 Ga0501217_001358 3300049661 Bacteria 4557
361 Ga0501217_016723 3300049661 Bacteria 1684
362 Ga0501233_000054 3300049668 Bacteria 15155
363 Ga0501235_001791 3300049669 Bacteria 4608
364 Ga0501236_001033 3300049670 Bacteria 3161
365 Ga0501243_002111 3300049675 Bacteria 2894
366 Ga0501249_000734 3300049679 Bacteria 7376
367 Ga0501251_000718 3300049681 Bacteria 2980
368 Ga0501252_002611 3300049682 Bacteria 1801
369 Ga0501253_000224 3300049683 Bacteria 4335
370 Ga0501255_000243 3300049684 Bacteria 3374
371 Ga0501257_003781 3300049686 Bacteria 3272
372 Ga0501260_000161 3300049689 Bacteria 5103
373 Ga0501219_001950 3300049703 Bacteria 1717
374 Ga0501225_0012579 3300049705 Bacteria 2375
375 Ga0501229_000510 3300049706 Bacteria 4397
376 Ga0501234_000329 3300049707 Bacteria 6954
377 Ga0501245_001738 3300049708 Bacteria 2853
378 Ga0501080_0004658 3300049742 Bacteria 12231
379 Ga0501083_0000455 3300049744 Bacteria 26198
380 Ga0501264_001108 3300049761 Bacteria 3154
381 Ga0501265_003140 3300049762 Bacteria 1878
382 Ga0501270_004046 3300049767 Bacteria 1625
383 Ga0501272_000517 3300049769 Bacteria 3441
384 Ga0501275_000590 3300049772 Bacteria 4033
385 Ga0501279_000605 3300049775 Bacteria 4720
386 Ga0501282_000634 3300049778 Bacteria 4055
387 Ga0501283_000047 3300049779 Bacteria 15101
388 Ga0501283_003073 3300049779 Bacteria 2193
389 Ga0501035_0025273 3300049822 Bacteria 5444
390 Ga0501045_0344568 3300049824 Unclassified 1109
391 Ga0501204_000889 3300049850 Bacteria 2782
392 Ga0501212_000164 3300049851 Bacteria 5580
393 nmdc:mga05p37_203044_c1 3300050507 Bacteria 2399
394 nmdc:mga05p37_250369_c1 3300050507 Bacteria 2125
395 nmdc:mga05p37_35961_c1 3300050507 Bacteria 6077
396 nmdc:mga05p37_368128_c1 3300050507 Bacteria 1688
397 nmdc:mga09592_12531_c1 3300050508 Bacteria 6909
398 nmdc:mga0qj67_10328_c1 3300050509 Bacteria 6974
399 nmdc:mga06r32_10377_c1 3300050510 Bacteria 8404
400 nmdc:mga06r32_288273_c1 3300050510 Bacteria 1628
401 nmdc:mga08y16_22832_c1 3300050511 Bacteria 6603
402 nmdc:mga0n895_16996_c1 3300050512 Bacteria 6693
403 nmdc:mga0n895_64799_c1 3300050512 Bacteria 3615
404 nmdc:mga0n895_65089_c1 3300050512 Bacteria 3608
405 nmdc:mga0n895_715039_c1 3300050512 Unclassified 997
406 nmdc:mga0rr50_478724_c1 3300050513 Bacteria 1057
407 nmdc:mga0rr50_54572_c1 3300050513 Bacteria 2978
408 nmdc:mga08x19_124685_c1 3300050514 Bacteria 1729
409 nmdc:mga08x19_30491_c1 3300050514 Bacteria 3388
410 nmdc:mga0a205_152908_c1 3300050515 Bacteria 2206
411 nmdc:mga0a205_19495_c1 3300050515 Bacteria 6396
412 nmdc:mga0a205_407373_c1 3300050515 Bacteria 1223
413 nmdc:mga0a205_9471_c1 3300050515 Bacteria 8909
414 Ga0495601_0011078 3300053077 Bacteria 5388
415 Ga0495619_0012711 3300053085 Bacteria 5299
416 Ga0501082_0003040 3300060353 Bacteria 14660
417 Ga0501082_0058753 3300060353 Bacteria 3314
418 Ga0075430_100192137
419 JGI26145J50221_1001158
420 Ga0065715_10194181
421 Ga0065707_10024541
422 Ga0065707_10106092
423 Ga0070658_10024907
424 Ga0070676_10003268
425 Ga0070690_100000107
426 Ga0070690_100001542
427 Ga0070690_100005746
428 Ga0070690_100023160
429 Ga0070670_100001784
430 Ga0070670_100009949
431 Ga0070670_100527682
432 Ga0070677_10003491
433 Ga0068869_100027063
434 Ga0068869_100300993
435 Ga0070666_10007075
436 Ga0070666_10031264
437 Ga0070680_100002947
438 Ga0068868_100652163
439 Ga0070660_100014250
440 Ga0070689_100000022
441 Ga0070689_100004489
442 Ga0070689_100431600
443 Ga0070691_10104098
444 Ga0070687_100004764
445 Ga0070687_100005006
446 Ga0070687_100061043
447 Ga0070661_100002141
448 Ga0070661_100010493
449 Ga0070692_10009243
450 Ga0070669_100000006
451 Ga0070669_100003084
452 Ga0070675_100004992
453 Ga0070675_100178461
454 Ga0070675_100347756
455 Ga0070671_100060742
456 Ga0070674_100005236
457 Ga0070673_100002304
458 Ga0070673_100020037
459 Ga0070673_100325832
460 Ga0070673_100852760
461 Ga0070688_100001166
462 Ga0070688_100043473
463 Ga0070659_100008981
464 Ga0070667_100016466
465 Ga0070709_10329980
466 Ga0070701_10000175
467 Ga0070701_10040281
468 Ga0070705_100007838
469 Ga0070705_100027780
470 Ga0070700_100002053
471 Ga0070700_100006861
472 Ga0070694_100013982
473 Ga0070694_100047319
474 Ga0070694_100097950
475 Ga0070708_100008526
476 Ga0070708_100336676
477 Ga0070663_100066607
478 Ga0070678_100001803
479 Ga0070662_100013662
480 Ga0070681_10002791
481 Ga0070681_10017818
482 Ga0070681_10210815
483 Ga0068867_100005005
484 Ga0068867_100007291
485 Ga0070685_10000110
486 Ga0070685_10109240
487 Ga0070706_100024216
488 Ga0070706_100031970
489 Ga0070706_100061188
490 Ga0070707_100000110
491 Ga0070707_100035027
492 Ga0070707_100053334
493 Ga0070698_100077044
494 Ga0070699_100044362
495 Ga0070699_100089715
496 Ga0070679_100211154
497 Ga0070684_100038513
498 Ga0070697_100083672
499 Ga0070697_100174417
500 Ga0068853_100144771
501 Ga0070672_100002138
502 Ga0070672_100182614
503 Ga0070686_100000025
504 Ga0070686_100003006
505 Ga0070686_100003747
506 Ga0070686_100007035
507 Ga0070686_100020084
508 Ga0070695_100005400
509 Ga0070695_100159814
510 Ga0070696_100014027
511 Ga0070696_100046913
512 Ga0070693_100036068
513 Ga0070665_100269803
514 Ga0070704_100001426
515 Ga0070704_100038568
516 Ga0070704_100228439
517 Ga0070664_100002236
518 Ga0070664_100009588
519 Ga0070664_100042457
520 Ga0068857_100013282
521 Ga0068857_100175684
522 Ga0068854_100024418
523 Ga0070702_100056347
524 Ga0068859_100000648
525 Ga0068859_100170916
526 Ga0068859_100708205
527 Ga0068864_100007859
528 Ga0068864_100042991
529 Ga0068864_100637626
530 Ga0068870_10050688
531 Ga0068863_100066785
532 Ga0068863_100123146
533 Ga0068863_100242543
534 Ga0068858_100014808
535 Ga0068858_100127629
536 Ga0068860_100052332
537 Ga0068860_100496283
538 Ga0075432_10001423
539 Ga0070715_10026162
540 Ga0070716_100022703
541 Ga0070716_100208904
542 Ga0070716_100270004
543 Ga0097621_100008607
544 Ga0097621_100009356
545 Ga0097621_100101393
546 Ga0097621_100248973
547 Ga0097621_100348150
548 Ga0068871_100002097
549 Ga0068871_100143757
550 Ga0068871_100184931
551 Ga0068871_100333536
552 Ga0075428_100442988
553 Ga0075430_100030369
554 Ga0075430_100072263
555 Ga0075431_100171809
556 Ga0075433_10007563
557 Ga0075433_10130768
558 Ga0075433_10460681
559 Ga0075434_100023836
560 Ga0075434_100038777
561 Ga0075434_100546026
562 Ga0075429_100021825
563 Ga0075429_100055151
564 Ga0068865_100006429
565 Ga0097620_100000648
566 Ga0097620_100170914
567 Ga0097620_100708194
568 Ga0075435_100056118
569 Ga0075435_100062725
570 Ga0075435_100248892
571 Ga0105245_10005072
572 Ga0114129_10007844
573 Ga0114129_10012020
574 Ga0105241_10178433
575 Ga0105242_10003752
576 Ga0105242_10008891
577 Ga0105242_10049656
578 Ga0105248_10000624
579 Ga0105248_10095833
580 Ga0105248_10493295
581 Ga0105239_10035951
582 Ga0105239_10160329
583 Ga0105246_10007146
584 Ga0157371_10025081
585 Ga0157374_10009960
586 Ga0157374_10019299
587 Ga0157374_10216509
588 Ga0157378_10003351
589 Ga0157378_10075086
590 Ga0157378_10213492
591 Ga0163162_10001426
592 Ga0157375_10015430
593 Ga0157375_10021745
594 Ga0163163_10004635
595 Ga0163163_10038143
596 Ga0163163_10056810
597 Ga0163163_10588770
598 Ga0157380_10009506
599 Ga0157380_10017005
600 Ga0157377_10000808
601 Ga0157376_10000364
602 Ga0157376_10000954
603 Ga0207697_10037804
604 Ga0207642_10040408
605 Ga0207688_10038066
606 Ga0207680_10019647
607 Ga0207680_10021377
608 Ga0207680_10100828
609 Ga0207685_10005879
610 Ga0207685_10022388
611 Ga0207645_10000012
612 Ga0207684_10086052
613 Ga0207684_10090643
614 Ga0207684_10100415
615 Ga0207707_10017047
616 Ga0207707_10120246
617 Ga0207660_10030184
618 Ga0207660_10090444
619 Ga0207662_10002618
620 Ga0207662_10035594
621 Ga0207662_10040086
622 Ga0207657_10000268
623 Ga0207649_10008315
624 Ga0207649_10012280
625 Ga0207646_10000035
626 Ga0207646_10052929
627 Ga0207646_10097135
628 Ga0207681_10000006
629 Ga0207681_10004869
630 Ga0207650_10005302
631 Ga0207659_10260714
632 Ga0207659_10298514
633 Ga0207687_10010468
634 Ga0207644_10006510
635 Ga0207690_10007297
636 Ga0207706_10001875
637 Ga0207686_10004711
638 Ga0207709_10006506
639 Ga0207670_10000023
640 Ga0207704_10001416
641 Ga0207665_10015818
642 Ga0207665_10036102
643 Ga0207665_10100334
644 Ga0207665_10329325
645 Ga0207691_10002462
646 Ga0207691_10005243
647 Ga0207711_10005817
648 Ga0207711_10268395
649 Ga0207711_10461242
650 Ga0207689_10008569
651 Ga0207679_10002576
652 Ga0207679_10005067
653 Ga0207667_10118624
654 Ga0207651_10001895
655 Ga0207651_10002993
656 Ga0207651_10034572
657 Ga0207640_10393860
658 Ga0207658_10026168
659 Ga0207708_10000228
660 Ga0207708_10001059
661 Ga0207641_10033855
662 Ga0207641_10349242
663 Ga0207648_10006261
664 Ga0207648_10016694
665 Ga0207676_10001461
666 Ga0207676_10051101
667 Ga0207674_10013002
668 Ga0207674_10299508
669 Ga0207675_100108086
670 Ga0207683_10000028
671 Ga0209973_1011489
672 Ga0209969_1000198
673 Ga0209981_1000373
674 Ga0209996_1000079
675 Ga0210000_1000096
676 Ga0209995_1000009
677 Ga0209968_1000024
678 Ga0209982_1000908
679 Ga0209970_1000067
680 Ga0210002_1000051
681 Ga0209983_1007987
682 Ga0209971_1000276
683 Ga0209966_1000248
684 Ga0209998_10000378
685 Ga0209974_10000246
686 Ga0209974_10000308
687 Ga0207428_10002466
688 Ga0268264_10506665
689 Ga0307408_100047252
690 Ga0316576_10012286
691 Ga0307405_10015756
692 Ga0307407_10113023
693 Ga0307412_10083334
694 Ga0307409_100104192
695 Ga0307416_100130431
696 Ga0307411_10081518
697 Ga0307411_10407286
698 Ga0307415_100018556
699 Ga0316593_10003080
700 Ga0373926_0056024
701 Ga0373949_0026475
702 Ga0373954_0033664
703 Ga0373942_0011486
704 Ga0373931_0076648
705 Ga0373935_0081258
706 Ga0373947_0013274
707 Ga0373947_0129291
708 Ga0373937_0026972
709 Ga0373937_0086523
710 Ga0373925_0137902
711 Ga0373925_0348790
712 Ga0400483_262215
713 Ga0439461_0012864
714 Ga0451807_0759082
715 Ga0439448_0016218
716 Ga0439446_0001962
717 Ga0439434_0003270
718 Ga0451577_0000051
719 Ga0453684_0563936
720 Ga0451576_0007611
721 Ga0451576_0195050
722 Ga0451576_0493979
723 Ga0495629_0020034
724 Ga0495580_0260247
725 Ga0495594_0003347
726 Ga0495594_0024201
727 Ga0495618_0132326
728 Ga0495618_0156536
729 Ga0495630_0448868
730 Ga0495667_0002855
731 Ga0495657_0003984
732 Ga0495657_0042943
733 Ga0495599_0196985
734 Ga0495647_0146028
735 Ga0495613_0098453
736 Ga0495581_0015233
737 Ga0495674_0099690
738 Ga0495676_0129067
739 Ga0495680_0026204
740 Ga0495615_0005444
741 Ga0501292_000416
742 Ga0501292_007630
743 Ga0501294_000911
744 Ga0501295_000318
745 Ga0501296_000042
746 Ga0501297_002519
747 Ga0501300_000410
748 Ga0501303_000288
749 Ga0501303_009066
750 Ga0501031_0012144
751 Ga0501031_0073597
752 Ga0501032_0018719
753 Ga0501036_0036341
754 Ga0501037_0011449
755 Ga0501038_0017176
756 Ga0501039_0018843
757 Ga0501040_0048670
758 Ga0501040_0053334
759 Ga0501041_0000673
760 Ga0501042_0000380
761 Ga0501043_0072414
762 Ga0501043_0130563
763 Ga0501048_0000196
764 Ga0501067_0011660
765 Ga0501075_0003125
766 Ga0501076_0071006
767 Ga0501077_0000106
768 Ga0501198_014892
769 Ga0501199_000754
770 Ga0501201_002072
771 Ga0501202_002120
772 Ga0501202_004990
773 Ga0501206_000369
774 Ga0501206_002740
775 Ga0501207_013242
776 Ga0501214_002644
777 Ga0501217_001358
778 Ga0501217_016723
779 Ga0501233_000054
780 Ga0501235_001791
781 Ga0501236_001033
782 Ga0501243_002111
783 Ga0501249_000734
784 Ga0501251_000718
785 Ga0501252_002611
786 Ga0501253_000224
787 Ga0501255_000243
788 Ga0501257_003781
789 Ga0501260_000161
790 Ga0501219_001950
791 Ga0501225_0012579
792 Ga0501229_000510
793 Ga0501234_000329
794 Ga0501245_001738
795 Ga0501080_0004658
796 Ga0501083_0000455
797 Ga0501264_001108
798 Ga0501265_003140
799 Ga0501270_004046
800 Ga0501272_000517
801 Ga0501275_000590
802 Ga0501279_000605
803 Ga0501282_000634
804 Ga0501283_000047
805 Ga0501283_003073
806 Ga0501035_0025273
807 Ga0501045_0344568
808 Ga0501204_000889
809 Ga0501212_000164
810 nmdc:mga05p37_203044_c1
811 nmdc:mga05p37_250369_c1
812 nmdc:mga05p37_35961_c1
813 nmdc:mga05p37_368128_c1
814 nmdc:mga09592_12531_c1
815 nmdc:mga0qj67_10328_c1
816 nmdc:mga06r32_10377_c1
817 nmdc:mga06r32_288273_c1
818 nmdc:mga08y16_22832_c1
819 nmdc:mga0n895_16996_c1
820 nmdc:mga0n895_64799_c1
821 nmdc:mga0n895_65089_c1
822 nmdc:mga0n895_715039_c1
823 nmdc:mga0rr50_478724_c1
824 nmdc:mga0rr50_54572_c1
825 nmdc:mga08x19_124685_c1
826 nmdc:mga08x19_30491_c1
827 nmdc:mga0a205_152908_c1
828 nmdc:mga0a205_19495_c1
829 nmdc:mga0a205_407373_c1
830 nmdc:mga0a205_9471_c1
831 Ga0495601_0011078
832 Ga0495619_0012711
833 Ga0501082_0003040
834 Ga0501082_0058753

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01148

CTP_transf_1

Cytidylyltransferase family

31

291

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.8779 29 288
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.8774 29 288
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.8716 29 288
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.8681 29 288
5guf-assembly1.cif.gz_A-2 structural insight into an intramembrane enzyme for archaeal membrane lipids biosynthesis 0.7574 158 281
ID Description Score Start End Superfamily
af_O44196_80_262_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4134 135 285 1.10.357.20
af_O44196_80_262_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.3593 135 285 1.10.357.20
af_Q2FZB9_1_168_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.3244 106 286 1.20.1270.60
af_Q2FZB9_1_168_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.32 106 286 1.20.1270.60
af_X1WEU3_262_422_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3197 132 285 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A521L1C2-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9867 143 283 GO:0004605
GO:0005886
GO:0016024
AF-A0A7C3ULX2-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) 0.9654 132 288 GO:0004605
GO:0005886
GO:0016024
AF-A0A1W9TWC8-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) 0.9621 133 284 GO:0004605
GO:0005886
GO:0016024
AF-A0A1Q7PLM6-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9617 41 285 GO:0004605
GO:0005886
GO:0016024
AF-A0A3A4R4B1-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9605 24 281 GO:0004605
GO:0005886
GO:0016024

Map