F438901

General Info

Members Datasets Scaffolds Average Seq Length
416 269 411 290

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0210382|Ga0496108_0210382_200_1174
Length 324
Sequence VSANQTHYPLSVLCRTLKVSCSGFYAWKKRPMSQRARADVCLTALIRAIHESSHCTYGVPRIHAELRQEYGVHVARKRVARLMRAAGLKGVQKRRFICTTRSGERQRWAPDLVDRDFTTSEPDTLWVADATYIATAEGFLYLAVVVDAFSRRVVGWAMDARLQTTLVLAALEMAYGQRVPRGVIHHSDHGCQYTSIAFGKRCRELGVRPSMGSVGDCFDNAMAESFFSSLECEVLDRCRFETREEARAAVFSWIEGWYNTHRRHSSLGYLSPIEFEQAFIEGQSSGNPELLPQTRQTPLLEDPMGNRSKSKEVLENMMLTQKSH

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
199 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
200 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
211 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
246 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
247 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
248 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
249 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
250 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
264 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
265 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
266 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
269 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 0.48
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.01
Nodule 0
Rhizoplane 5.05
Rhizosphere 83.89
Stem 0
Stem Tuber 0
Unclassified 5.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1003055 3300002155 Bacteria 1747
2 JGI24742J22300_10017193 3300002244 Bacteria 1222
3 JGI25151J46595_10055946 3300003187 Bacteria 1297
4 JGI25153J46596_10040910 3300003215 Bacteria 1432
5 rootL2_10105033 3300003322 Bacteria 1521
6 rootL2_10173153 3300003322 Bacteria 1439
7 JGI25160J50197_1030440 3300003354 Bacteria 1407
8 Ga0055531_10011175 3300003794 Bacteria 4365
9 Ga0055531_10011926 3300003794 Bacteria 4136
10 Ga0055543_1013737 3300004625 Bacteria 1594
11 Ga0070658_10025892 3300005327 Bacteria 4705
12 Ga0070676_10202354 3300005328 Bacteria 1302
13 Ga0070690_100192538 3300005330 Bacteria 1415
14 Ga0068869_100218235 3300005334 Bacteria 1510
15 Ga0068869_100275740 3300005334 Unclassified 1351
16 Ga0068869_100326608 3300005334 Bacteria 1245
17 Ga0068869_100358319 3300005334 Bacteria 1190
18 Ga0070666_10199146 3300005335 Bacteria 1409
19 Ga0070680_100092984 3300005336 Bacteria 2498
20 Ga0070682_100155946 3300005337 Bacteria 1572
21 Ga0070682_100169413 3300005337 Bacteria 1516
22 Ga0068868_100233461 3300005338 Bacteria 1544
23 Ga0070660_100112963 3300005339 Bacteria 2163
24 Ga0070660_100147070 3300005339 Unclassified 1893
25 Ga0070691_10068285 3300005341 Bacteria 1721
26 Ga0070687_100124934 3300005343 Bacteria 1477
27 Ga0070661_100200830 3300005344 Bacteria 1523
28 Ga0070661_100298214 3300005344 Bacteria 1254
29 Ga0070692_10078032 3300005345 Bacteria 1777
30 Ga0070668_100208194 3300005347 Bacteria 1608
31 Ga0070669_100221318 3300005353 Bacteria 1497
32 Ga0070674_100189352 3300005356 Bacteria 1582
33 Ga0070674_100204439 3300005356 Bacteria 1527
34 Ga0070673_100269408 3300005364 Bacteria 1490
35 Ga0070659_100095690 3300005366 Bacteria 2385
36 Ga0070667_100144684 3300005367 Bacteria 2084
37 Ga0070667_100284211 3300005367 Bacteria 1486
38 Ga0070703_10034943 3300005406 Bacteria 1537
39 Ga0070714_100115446 3300005435 Bacteria 2383
40 Ga0070713_100062674 3300005436 Bacteria 3115
41 Ga0070713_100169958 3300005436 Bacteria 1952
42 Ga0070710_10118619 3300005437 Bacteria 1598
43 Ga0070701_10091455 3300005438 Bacteria 1668
44 Ga0070705_100116129 3300005440 Bacteria 1720
45 Ga0070700_100205367 3300005441 Bacteria 1387
46 Ga0070694_100202046 3300005444 Bacteria 1482
47 Ga0070663_100101746 3300005455 Bacteria 2145
48 Ga0070663_100152945 3300005455 Bacteria 1770
49 Ga0070678_100201038 3300005456 Bacteria 1645
50 Ga0070678_100255199 3300005456 Bacteria 1472
51 Ga0070662_100103115 3300005457 Bacteria 2162
52 Ga0070662_100200013 3300005457 Bacteria 1585
53 Ga0070681_10012696 3300005458 Bacteria 8359
54 Ga0068867_100088748 3300005459 Bacteria 2344
55 Ga0068867_100119187 3300005459 Bacteria 2037
56 Ga0070707_100356464 3300005468 Bacteria 1421
57 Ga0070707_100529944 3300005468 Bacteria 1140
58 Ga0070698_100134981 3300005471 Bacteria 2422
59 Ga0070698_100135421 3300005471 Bacteria 2417
60 Ga0070698_100380709 3300005471 Bacteria 1344
61 Ga0070679_100092857 3300005530 Bacteria 3005
62 Ga0070679_100340835 3300005530 Bacteria 1447
63 Ga0070684_100222887 3300005535 Bacteria 1720
64 Ga0068853_100130981 3300005539 Unclassified 2245
65 Ga0068853_100253251 3300005539 Bacteria 1616
66 Ga0068853_100358448 3300005539 Bacteria 1358
67 Ga0070686_100179289 3300005544 Bacteria 1504
68 Ga0070695_100071840 3300005545 Bacteria 2267
69 Ga0070696_100096139 3300005546 Bacteria 2116
70 Ga0070693_100158018 3300005547 Bacteria 1441
71 Ga0070665_100015994 3300005548 Bacteria 7531
72 Ga0070665_100213435 3300005548 Bacteria 1931
73 Ga0070665_100219296 3300005548 Bacteria 1902
74 Ga0070704_100226869 3300005549 Bacteria 1521
75 Ga0068855_100107880 3300005563 Unclassified 3199
76 Ga0068855_100127516 3300005563 Bacteria 2908
77 Ga0068855_100201151 3300005563 Bacteria 2242
78 Ga0070664_100001346 3300005564 Bacteria 19603
79 Ga0070664_100116592 3300005564 Bacteria 2335
80 Ga0068857_100117210 3300005577 Bacteria 2396
81 Ga0068854_100043359 3300005578 Bacteria 3188
82 Ga0068856_100185925 3300005614 Bacteria 2091
83 Ga0068856_100241059 3300005614 Bacteria 1823
84 Ga0068856_100279869 3300005614 Bacteria 1685
85 Ga0070702_100063908 3300005615 Bacteria 2151
86 Ga0068852_100148566 3300005616 Bacteria 2177
87 Ga0068852_100301003 3300005616 Bacteria 1552
88 Ga0068852_100344501 3300005616 Bacteria 1453
89 Ga0068852_100352169 3300005616 Bacteria 1438
90 Ga0068859_100010442 3300005617 Bacteria 9343
91 Ga0068859_100541803 3300005617 Bacteria 1258
92 Ga0068864_100237561 3300005618 Bacteria 1687
93 Ga0068864_100309577 3300005618 Bacteria 1480
94 Ga0068866_10029346 3300005718 Bacteria 2630
95 Ga0068851_10064689 3300005834 Bacteria 1880
96 Ga0068870_10090338 3300005840 Bacteria 1711
97 Ga0068863_100148148 3300005841 Unclassified 2245
98 Ga0068863_100372758 3300005841 Bacteria 1393
99 Ga0068863_100388830 3300005841 Unclassified 1363
100 Ga0068858_100002984 3300005842 Bacteria 16982
101 Ga0068858_100051863 3300005842 Bacteria 3795
102 Ga0068858_100113637 3300005842 Bacteria 2529
103 Ga0068860_100016963 3300005843 Bacteria 7098
104 Ga0068860_100035145 3300005843 Plasmid 4809
105 Ga0068860_100108992 3300005843 Bacteria 2646
106 Ga0068862_100196901 3300005844 Bacteria 1815
107 Ga0068862_100298281 3300005844 Bacteria 1482
108 Ga0068862_100338690 3300005844 Bacteria 1392
109 Ga0081455_10086171 3300005937 Bacteria 2559
110 Ga0081538_10091842 3300005981 Bacteria 1566
111 Ga0075364_10196403 3300006051 Unclassified 1367
112 Ga0075362_10080230 3300006177 Unclassified 1503
113 Ga0075366_10098324 3300006195 Unclassified 1756
114 Ga0097621_100180170 3300006237 Bacteria 1826
115 Ga0097621_100341637 3300006237 Bacteria 1329
116 Ga0075370_10187173 3300006353 Bacteria 1219
117 Ga0068871_100171410 3300006358 Bacteria 1860
118 Ga0068871_100213247 3300006358 Bacteria 1671
119 Ga0068871_100293602 3300006358 Bacteria 1425
120 Ga0068871_100475384 3300006358 Bacteria 1123
121 Ga0075428_100406588 3300006844 Bacteria 1459
122 Ga0075430_100204991 3300006846 Bacteria 1637
123 Ga0075430_100276463 3300006846 Bacteria 1390
124 Ga0075431_100547305 3300006847 Bacteria 1145
125 Ga0075429_100218943 3300006880 Bacteria 1668
126 Ga0068865_100197137 3300006881 Bacteria 1561
127 Ga0068865_100231434 3300006881 Bacteria 1450
128 Ga0097620_100010442 3300006931 Bacteria 9343
129 Ga0097620_100541790 3300006931 Bacteria 1258
130 Ga0105240_10306972 3300009093 Bacteria 1813
131 Ga0105240_10366095 3300009093 Bacteria 1631
132 Ga0111539_10413148 3300009094 Bacteria 1572
133 Ga0105245_10215257 3300009098 Bacteria 1851
134 Ga0105245_10273322 3300009098 Bacteria 1649
135 Ga0105247_10131716 3300009101 Bacteria 1630
136 Ga0114129_10600837 3300009147 Bacteria 1425
137 Ga0105243_10150357 3300009148 Bacteria 1997
138 Ga0105243_10237647 3300009148 Bacteria 1620
139 Ga0105243_10311111 3300009148 Bacteria 1431
140 Ga0105241_10208958 3300009174 Bacteria 1634
141 Ga0105241_10365935 3300009174 Bacteria 1256
142 Ga0105242_10162891 3300009176 Bacteria 1954
143 Ga0105242_10357917 3300009176 Bacteria 1350
144 Ga0105248_10027410 3300009177 Bacteria 6343
145 Ga0105248_10220362 3300009177 Unclassified 2136
146 Ga0105237_10096816 3300009545 Plasmid 2942
147 Ga0105237_10143621 3300009545 Bacteria 2381
148 Ga0105237_10475251 3300009545 Bacteria 1256
149 Ga0105238_10109322 3300009551 Bacteria 2746
150 Ga0105238_10235833 3300009551 Bacteria 1807
151 Ga0105249_10046345 3300009553 Bacteria 3956
152 Ga0105249_10234670 3300009553 Bacteria 1811
153 Ga0105239_10172835 3300010375 Bacteria 2416
154 Ga0105239_10313522 3300010375 Bacteria 1768
155 Ga0105239_10599773 3300010375 Bacteria 1256
156 Ga0105246_10117756 3300011119 Bacteria 1963
157 Ga0157371_10206878 3300013102 Bacteria 1408
158 Ga0157370_10236140 3300013104 Bacteria 1692
159 Ga0157370_10271051 3300013104 Unclassified 1568
160 Ga0157369_10459009 3300013105 Bacteria 1319
161 Ga0157374_10260848 3300013296 Bacteria 1707
162 Ga0157378_10035380 3300013297 Unclassified 4417
163 Ga0157378_10164874 3300013297 Bacteria 2075
164 Ga0163162_10135549 3300013306 Bacteria 2573
165 Ga0163162_10251598 3300013306 Bacteria 1899
166 Ga0163162_10615433 3300013306 Bacteria 1212
167 Ga0157372_10184345 3300013307 Bacteria 2417
168 Ga0157375_10096868 3300013308 Bacteria 3024
169 Ga0157375_10360378 3300013308 Bacteria 1620
170 Ga0163163_10154625 3300014325 Unclassified 2338
171 Ga0163163_10274190 3300014325 Bacteria 1738
172 Ga0157380_10622910 3300014326 Bacteria 1071
173 Ga0157379_10248777 3300014968 Bacteria 1613
174 Ga0157379_10304782 3300014968 Bacteria 1452
175 Ga0157376_10290929 3300014969 Bacteria 1542
176 Ga0213872_10023285 3300021361 Bacteria 2849
177 Ga0213872_10068817 3300021361 Bacteria 1597
178 Ga0213872_10087182 3300021361 Bacteria 1398
179 Ga0213876_10086119 3300021384 Bacteria 1662
180 Ga0213876_10112597 3300021384 Bacteria 1444
181 Ga0213871_10018379 3300021441 Bacteria 1709
182 Ga0209130_1003432 3300025284 Bacteria 6736
183 Ga0209025_1033124 3300025294 Bacteria 2396
184 Ga0209758_1051509 3300025297 Bacteria 1432
185 Ga0207426_1000484 3300025302 Bacteria 60124
186 Ga0207426_1030327 3300025302 Bacteria 1774
187 Ga0209257_1001185 3300025304 Bacteria 32850
188 Ga0207656_10104076 3300025321 Unclassified 1304
189 Ga0207656_10106642 3300025321 Bacteria 1290
190 Ga0207653_10029937 3300025885 Bacteria 1755
191 Ga0207692_10137070 3300025898 Bacteria 1388
192 Ga0207642_10031629 3300025899 Bacteria 2218
193 Ga0207710_10004056 3300025900 Bacteria 6443
194 Ga0207710_10040069 3300025900 Bacteria 2075
195 Ga0207688_10242677 3300025901 Bacteria 1090
196 Ga0207647_10061021 3300025904 Bacteria 2303
197 Ga0207643_10146936 3300025908 Bacteria 1411
198 Ga0207705_10204049 3300025909 Bacteria 1498
199 Ga0207654_10066638 3300025911 Bacteria 2125
200 Ga0207707_10046763 3300025912 Bacteria 3770
201 Ga0207695_10213721 3300025913 Bacteria 1838
202 Ga0207695_10384121 3300025913 Bacteria 1290
203 Ga0207671_10239443 3300025914 Bacteria 1425
204 Ga0207671_10299299 3300025914 Bacteria 1271
205 Ga0207660_10295556 3300025917 Bacteria 1289
206 Ga0207662_10149231 3300025918 Bacteria 1486
207 Ga0207657_10250664 3300025919 Bacteria 1411
208 Ga0207649_10007861 3300025920 Bacteria 5802
209 Ga0207649_10192094 3300025920 Bacteria 1437
210 Ga0207652_10187739 3300025921 Bacteria 1858
211 Ga0207694_10107258 3300025924 Bacteria 2219
212 Ga0207687_10145590 3300025927 Bacteria 1802
213 Ga0207687_10173836 3300025927 Bacteria 1663
214 Ga0207687_10179725 3300025927 Unclassified 1638
215 Ga0207687_10254419 3300025927 Bacteria 1398
216 Ga0207700_10085542 3300025928 Bacteria 2475
217 Ga0207700_10190595 3300025928 Bacteria 1723
218 Ga0207644_10150945 3300025931 Unclassified 1798
219 Ga0207644_10341173 3300025931 Bacteria 1215
220 Ga0207690_10046526 3300025932 Bacteria 2874
221 Ga0207706_10132038 3300025933 Bacteria 2196
222 Ga0207706_10172377 3300025933 Bacteria 1901
223 Ga0207686_10225458 3300025934 Bacteria 1356
224 Ga0207709_10155802 3300025935 Bacteria 1587
225 Ga0207669_10269780 3300025937 Unclassified 1277
226 Ga0207669_10367068 3300025937 Bacteria 1117
227 Ga0207704_10178527 3300025938 Bacteria 1532
228 Ga0207711_10218804 3300025941 Bacteria 1741
229 Ga0207689_10127951 3300025942 Bacteria 2089
230 Ga0207689_10146599 3300025942 Bacteria 1945
231 Ga0207689_10291983 3300025942 Unclassified 1351
232 Ga0207661_10314065 3300025944 Bacteria 1407
233 Ga0207679_10000846 3300025945 Bacteria 19674
234 Ga0207679_10160675 3300025945 Bacteria 1839
235 Ga0207667_10195977 3300025949 Bacteria 2072
236 Ga0207667_10249691 3300025949 Bacteria 1815
237 Ga0207667_10474258 3300025949 Bacteria 1270
238 Ga0207712_10082977 3300025961 Bacteria 2338
239 Ga0207712_10216510 3300025961 Bacteria 1529
240 Ga0207640_10061084 3300025981 Bacteria 2494
241 Ga0207658_10010540 3300025986 Bacteria 6281
242 Ga0207658_10321233 3300025986 Bacteria 1340
243 Ga0207658_10325015 3300025986 Unclassified 1332
244 Ga0207703_10002070 3300026035 Bacteria 17645
245 Ga0207703_10036213 3300026035 Bacteria 3926
246 Ga0207703_10102945 3300026035 Unclassified 2423
247 Ga0207703_10161087 3300026035 Bacteria 1965
248 Ga0207639_10018756 3300026041 Bacteria 4919
249 Ga0207639_10382616 3300026041 Bacteria 1264
250 Ga0207639_10387789 3300026041 Bacteria 1256
251 Ga0207678_10052514 3300026067 Bacteria 3516
252 Ga0207678_10106692 3300026067 Bacteria 2389
253 Ga0207708_10142562 3300026075 Bacteria 1881
254 Ga0207702_10087002 3300026078 Bacteria 2726
255 Ga0207702_10467776 3300026078 Bacteria 1225
256 Ga0207641_10308875 3300026088 Unclassified 1496
257 Ga0207641_10397296 3300026088 Bacteria 1323
258 Ga0207641_10430129 3300026088 Unclassified 1272
259 Ga0207641_10447914 3300026088 Bacteria 1247
260 Ga0207648_10051778 3300026089 Bacteria 3589
261 Ga0207648_10162179 3300026089 Bacteria 1974
262 Ga0207676_10276591 3300026095 Bacteria 1522
263 Ga0207676_10335676 3300026095 Bacteria 1392
264 Ga0207674_10187849 3300026116 Bacteria 2016
265 Ga0207683_10237311 3300026121 Bacteria 1663
266 Ga0207683_10264647 3300026121 Bacteria 1570
267 Ga0207683_10522867 3300026121 Bacteria 1096
268 Ga0207698_10422570 3300026142 Bacteria 1279
269 Ga0207698_10432633 3300026142 Bacteria 1266
270 Ga0268266_10076168 3300028379 Bacteria 2915
271 Ga0268266_10101216 3300028379 Bacteria 2539
272 Ga0268266_10201512 3300028379 Bacteria 1821
273 Ga0268265_10209747 3300028380 Bacteria 1696
274 Ga0268264_10027362 3300028381 Bacteria 4658
275 Ga0268264_10048894 3300028381 Plasmid 3518
276 Ga0268264_10157214 3300028381 Bacteria 2044
277 Ga0307515_10000438 3300028794 Bacteria 99963
278 Ga0265770_1019402 3300030878 Unclassified 1066
279 Ga0265760_10017839 3300031090 Bacteria 2040
280 Ga0265329_10018688 3300031242 Bacteria 2365
281 Ga0307408_100124872 3300031548 Bacteria 1999
282 Ga0307408_100487663 3300031548 Unclassified 1076
283 Ga0265314_10037363 3300031711 Bacteria 3519
284 Ga0307516_10388568 3300031730 Bacteria 1056
285 Ga0307405_10011135 3300031731 Bacteria 4694
286 Ga0307413_10017747 3300031824 Bacteria 3714
287 Ga0307413_10283514 3300031824 Bacteria 1247
288 Ga0307410_10038046 3300031852 Bacteria 3148
289 Ga0307410_10173822 3300031852 Bacteria 1625
290 Ga0307410_10238357 3300031852 Bacteria 1408
291 Ga0307407_10042522 3300031903 Bacteria 2548
292 Ga0307412_10013844 3300031911 Bacteria 4741
293 Ga0307412_10315341 3300031911 Bacteria 1242
294 Ga0307409_100344001 3300031995 Bacteria 1405
295 Ga0307416_100173381 3300032002 Bacteria 2011
296 Ga0307416_100389834 3300032002 Bacteria 1426
297 Ga0307416_100452785 3300032002 Bacteria 1336
298 Ga0307414_10151843 3300032004 Bacteria 1828
299 Ga0307414_10237646 3300032004 Bacteria 1506
300 Ga0307414_10395688 3300032004 Bacteria 1198
301 Ga0307411_10057398 3300032005 Bacteria 2571
302 Ga0307415_100297838 3300032126 Bacteria 1335
303 Ga0307415_100303580 3300032126 Bacteria 1323
304 Ga0373954_0060720 3300035118 Bacteria 1783
305 Ga0373955_0076310 3300035172 Bacteria 1885
306 Ga0373935_0206655 3300035692 Bacteria 1359
307 Ga0373933_0248631 3300035724 Bacteria 1145
308 Ga0373947_0042568 3300035725 Bacteria 2711
309 Ga0373937_0174620 3300036401 Bacteria 2017
310 Ga0373937_0206825 3300036401 Bacteria 1846
311 Ga0373925_0327107 3300037068 Bacteria 1241
312 Ga0395898_0669167 3300037466 Bacteria 980
313 Ga0395905_0295074 3300037471 Bacteria 1508
314 Ga0395905_0309323 3300037471 Bacteria 1468
315 Ga0395905_0614512 3300037471 Bacteria 989
316 Ga0436365_0357799 3300039437 Bacteria 1790
317 Ga0436360_0489396 3300039438 Bacteria 1896
318 Ga0436360_0656441 3300039438 Bacteria 1105
319 Ga0436361_0125707 3300039447 Bacteria 12524
320 Ga0436361_0126553 3300039447 Bacteria 1256
321 Ga0436361_0134234 3300039447 Bacteria 1978
322 Ga0436363_0273477 3300039450 Bacteria 1530
323 Ga0436362_0727039 3300039453 Bacteria 2737
324 Ga0451837_1190143 3300041494 Unclassified 888
325 Ga0439458_0048257 3300042157 Bacteria 1046
326 Ga0466961_0128133 3300044693 Bacteria 1591
327 Ga0466963_0146096 3300044694 Bacteria 1640
328 Ga0466971_0061821 3300044719 Bacteria 1694
329 Ga0466959_0302761 3300045049 Unclassified 1094
330 Ga0451576_0502463 3300045051 Bacteria 1274
331 Ga0466967_0268366 3300045976 Bacteria 1634
332 Ga0466967_0297708 3300045976 Bacteria 1551
333 Ga0466967_0298111 3300045976 Unclassified 1550
334 Ga0466967_0388632 3300045976 Bacteria 1356
335 Ga0495603_0098841 3300046455 Bacteria 1704
336 Ga0495594_0215790 3300046499 Bacteria 1094
337 Ga0495608_0133966 3300046511 Bacteria 1584
338 Ga0495610_0005349 3300046512 Bacteria 9159
339 Ga0495643_0075147 3300046522 Unclassified 1768
340 Ga0495640_0148621 3300046533 Bacteria 1507
341 Ga0495645_0335326 3300046543 Bacteria 978
342 Ga0495667_0116631 3300046559 Bacteria 1725
343 Ga0495647_0056258 3300046681 Bacteria 1542
344 Ga0495658_0105308 3300046683 Bacteria 1689
345 Ga0495581_0144985 3300047315 Bacteria 1386
346 Ga0495604_0331514 3300047317 Bacteria 1015
347 Ga0495674_0317734 3300047319 Bacteria 1269
348 Ga0495674_0366258 3300047319 Bacteria 1168
349 Ga0496100_0164980 3300048903 Bacteria 1590
350 Ga0496100_0226388 3300048903 Bacteria 1374
351 Ga0496101_0070881 3300048904 Bacteria 2553
352 Ga0496102_0110059 3300048905 Bacteria 2567
353 Ga0496102_0252612 3300048905 Bacteria 1662
354 Ga0496103_0167636 3300048906 Bacteria 1409
355 Ga0496104_0133872 3300048907 Bacteria 2381
356 Ga0496104_0242557 3300048907 Bacteria 1714
357 Ga0496105_0066422 3300048908 Bacteria 2977
358 Ga0496105_0238172 3300048908 Bacteria 1477
359 Ga0496106_0140779 3300048909 Bacteria 1897
360 Ga0496107_0179426 3300048910 Bacteria 1572
361 Ga0496108_0210382 3300048911 Bacteria 1688
362 Ga0496110_0227157 3300048913 Bacteria 1697
363 Ga0496112_0281690 3300048915 Bacteria 1609
364 Ga0496113_0289164 3300048916 Bacteria 1311
365 Ga0496114_0232926 3300048917 Bacteria 1618
366 Ga0496114_0287390 3300048917 Bacteria 1450
367 Ga0496115_0053839 3300048918 Bacteria 3230
368 Ga0496115_0246028 3300048918 Bacteria 1473
369 Ga0496115_0447671 3300048918 Bacteria 1043
370 Ga0496119_0094587 3300048922 Bacteria 1690
371 Ga0496121_0041279 3300048924 Bacteria 4035
372 Ga0496121_0077289 3300048924 Bacteria 2651
373 Ga0496125_0035308 3300048928 Bacteria 4389
374 Ga0496125_0097625 3300048928 Bacteria 2176
375 Ga0496126_0009408 3300048929 Bacteria 10378
376 Ga0496126_0219129 3300048929 Bacteria 1599
377 Ga0496126_0355476 3300048929 Unclassified 1197
378 Ga0501048_0253010 3300049582 Bacteria 1251
379 Ga0501069_0139233 3300049585 Unclassified 1392
380 Ga0501072_0286211 3300049588 Bacteria 1310
381 Ga0501073_0148670 3300049589 Bacteria 1623
382 Ga0501074_0351992 3300049590 Bacteria 1045
383 Ga0501076_0250392 3300049592 Bacteria 1449
384 Ga0501077_0138608 3300049593 Bacteria 1542
385 Ga0501077_0216559 3300049593 Bacteria 1217
386 Ga0501202_017125 3300049652 Unclassified 1413
387 Ga0501216_014734 3300049660 Bacteria 1310
388 Ga0501217_066404 3300049661 Bacteria 974
389 Ga0501259_013080 3300049688 Bacteria 1390
390 Ga0501259_016390 3300049688 Unclassified 1273
391 Ga0501261_009318 3300049690 Bacteria 1279
392 Ga0501225_0059861 3300049705 Bacteria 1070
393 Ga0501079_0361025 3300049741 Bacteria 1138
394 Ga0501081_0219932 3300049743 Bacteria 1381
395 Ga0501271_004406 3300049768 Bacteria 1333
396 Ga0501045_0283419 3300049824 Bacteria 1233
397 nmdc:mga03683_100988_c1 3300050489 Unclassified 1268
398 nmdc:mga00v17_190448_c1 3300050491 Bacteria 1325
399 nmdc:mga0k408_167490_c1 3300050493 Unclassified 1310
400 nmdc:mga06z11_139064_c1 3300050494 Unclassified 1371
401 nmdc:mga07m45_160742_c1 3300050496 Unclassified 1304
402 nmdc:mga07m45_1922_c1 3300050496 Bacteria 9602
403 nmdc:mga0qj67_297265_c1 3300050509 Bacteria 1308
404 nmdc:mga06r32_447310_c1 3300050510 Bacteria 1272
405 nmdc:mga0n895_365324_c1 3300050512 Bacteria 1461
406 Ga0495612_0092873 3300053078 Bacteria 1279
407 Ga0500566_0080599 3300053094 Bacteria 1812
408 Ga0500616_0012812 3300053153 Bacteria 4893
409 Ga0500636_0137677 3300053177 Bacteria 1354
410 Ga0501082_0305873 3300060353 Bacteria 1384
411 Ga0466962_0056834 3300061719 Bacteria 1868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049661 Ga0501217_066404 Ga0501217_066404_60_776 234
2 3300031852 Ga0307410_10173822 Ga0307410_101738222 240
3 3300032002 Ga0307416_100173381 Ga0307416_1001733812 240
4 3300041494 Ga0451837_1190143 Ga0451837_1190143_135_860 241
5 iso_pu_bacteria 2881101125 2881104145 241
6 3300046533 Ga0495640_0148621 Ga0495640_0148621_532_1320 247
7 3300046559 Ga0495667_0116631 Ga0495667_0116631_814_1602 247
8 3300053078 Ga0495612_0092873 Ga0495612_0092873_127_915 247
9 3300031711 Ga0265314_10037363 Ga0265314_100373631 249
10 3300005563 Ga0068855_100127516 Ga0068855_1001275161 250
11 3300009093 Ga0105240_10366095 Ga0105240_103660952 250
12 3300025913 Ga0207695_10384121 Ga0207695_103841211 250
13 3300025949 Ga0207667_10249691 Ga0207667_102496912 250
14 3300005471 Ga0070698_100380709 Ga0070698_1003807092 251
15 3300044693 Ga0466961_0128133 Ga0466961_0128133_552_1454 252
16 3300048915 Ga0496112_0281690 Ga0496112_0281690_128_1030 254
17 3300048924 Ga0496121_0077289 Ga0496121_0077289_353_1255 254
18 3300048928 Ga0496125_0035308 Ga0496125_0035308_666_1568 254
19 3300031731 Ga0307405_10011135 Ga0307405_100111351 255
20 3300031911 Ga0307412_10013844 Ga0307412_100138446 255
21 3300005981 Ga0081538_10091842 Ga0081538_100918422 256
22 3300005841 Ga0068863_100148148 Ga0068863_1001481482 259
23 3300005843 Ga0068860_100035145 Ga0068860_1000351455 259
24 3300025927 Ga0207687_10179725 Ga0207687_101797252 259
25 3300026035 Ga0207703_10102945 Ga0207703_101029453 259
26 3300028381 Ga0268264_10048894 Ga0268264_100488942 259
27 3300025898 Ga0207692_10137070 Ga0207692_101370701 260
28 3300046543 Ga0495645_0335326 Ga0495645_0335326_17_871 261
29 3300003322 rootL2_10173153 rootL2_101731532 263
30 3300005457 Ga0070662_100200013 Ga0070662_1002000132 263
31 3300013306 Ga0163162_10615433 Ga0163162_106154331 263
32 3300047317 Ga0495604_0331514 Ga0495604_0331514_49_867 263
33 3300047319 Ga0495674_0317734 Ga0495674_0317734_400_1218 263
34 3300050496 nmdc:mga07m45_1922_c1 nmdc:mga07m45_1922_c1_2942_3841 263
35 3300005468 Ga0070707_100529944 Ga0070707_1005299442 265
36 3300005616 Ga0068852_100344501 Ga0068852_1003445011 265
37 3300006358 Ga0068871_100293602 Ga0068871_1002936021 265
38 3300009177 Ga0105248_10220362 Ga0105248_102203622 265
39 3300009545 Ga0105237_10096816 Ga0105237_100968164 265
40 3300013297 Ga0157378_10035380 Ga0157378_100353803 265
41 3300013306 Ga0163162_10135549 Ga0163162_101355492 265
42 3300014325 Ga0163163_10154625 Ga0163163_101546252 265
43 3300025927 Ga0207687_10145590 Ga0207687_101455902 265
44 3300026088 Ga0207641_10308875 Ga0207641_103088752 265
45 3300048916 Ga0496113_0289164 Ga0496113_0289164_144_956 265
46 3300028794 Ga0307515_10000438 Ga0307515_1000043890 266
47 3300045051 Ga0451576_0502463 Ga0451576_0502463_336_1187 266
48 3300009147 Ga0114129_10600837 Ga0114129_106008372 267
49 3300009553 Ga0105249_10046345 Ga0105249_100463455 267
50 3300010375 Ga0105239_10172835 Ga0105239_101728352 267
51 3300014325 Ga0163163_10274190 Ga0163163_102741902 267
52 3300048922 Ga0496119_0094587 Ga0496119_0094587_290_1132 267
53 3300048924 Ga0496121_0041279 Ga0496121_0041279_3112_3954 267
54 3300048929 Ga0496126_0009408 Ga0496126_0009408_4912_5754 267
55 3300048929 Ga0496126_0219129 Ga0496126_0219129_519_1397 267
56 3300048929 Ga0496126_0355476 Ga0496126_0355476_146_1096 267
57 3300050509 nmdc:mga0qj67_297265_c1 nmdc:mga0qj67_297265_c1_447_1298 267
58 3300050510 nmdc:mga06r32_447310_c1 nmdc:mga06r32_447310_c1_385_1236 267
59 3300005436 Ga0070713_100169958 Ga0070713_1001699583 268
60 3300025928 Ga0207700_10190595 Ga0207700_101905952 268
61 3300037471 Ga0395905_0614512 Ga0395905_0614512_162_968 268
62 3300039438 Ga0436360_0656441 Ga0436360_0656441_26_892 268
63 3300045049 Ga0466959_0302761 Ga0466959_0302761_53_877 268
64 3300006353 Ga0075370_10187173 Ga0075370_101871731 269
65 3300025933 Ga0207706_10132038 Ga0207706_101320383 269
66 3300005548 Ga0070665_100219296 Ga0070665_1002192962 270
67 3300006358 Ga0068871_100213247 Ga0068871_1002132473 270
68 3300006844 Ga0075428_100406588 Ga0075428_1004065882 270
69 3300006846 Ga0075430_100276463 Ga0075430_1002764631 270
70 3300006880 Ga0075429_100218943 Ga0075429_1002189432 270
71 3300009094 Ga0111539_10413148 Ga0111539_104131482 270
72 3300025900 Ga0207710_10040069 Ga0207710_100400692 270
73 3300025914 Ga0207671_10239443 Ga0207671_102394431 270
74 3300025931 Ga0207644_10341173 Ga0207644_103411731 270
75 3300025961 Ga0207712_10082977 Ga0207712_100829771 270
76 3300028379 Ga0268266_10201512 Ga0268266_102015121 270
77 3300032002 Ga0307416_100452785 Ga0307416_1004527852 270
78 3300032004 Ga0307414_10395688 Ga0307414_103956881 270
79 3300032126 Ga0307415_100297838 Ga0307415_1002978382 270
80 3300005437 Ga0070710_10118619 Ga0070710_101186192 272
81 3300021361 Ga0213872_10023285 Ga0213872_100232853 273
82 3300021361 Ga0213872_10087182 Ga0213872_100871821 273
83 3300039447 Ga0436361_0125707 Ga0436361_0125707_11214_12122 273
84 3300039447 Ga0436361_0126553 Ga0436361_0126553_170_1078 273
85 3300039447 Ga0436361_0134234 Ga0436361_0134234_640_1548 273
86 3300049589 Ga0501073_0148670 Ga0501073_0148670_109_984 273
87 3300049593 Ga0501077_0138608 Ga0501077_0138608_464_1339 273
88 3300050512 nmdc:mga0n895_365324_c1 nmdc:mga0n895_365324_c1_22_918 273
89 3300060353 Ga0501082_0305873 Ga0501082_0305873_85_960 273
90 3300003187 JGI25151J46595_10055946 JGI25151J46595_100559461 274
91 3300003215 JGI25153J46596_10040910 JGI25153J46596_100409102 274
92 3300003354 JGI25160J50197_1030440 JGI25160J50197_10304402 274
93 3300003794 Ga0055531_10011175 Ga0055531_100111753 274
94 3300003794 Ga0055531_10011926 Ga0055531_100119266 274
95 3300004625 Ga0055543_1013737 Ga0055543_10137372 274
96 3300005436 Ga0070713_100062674 Ga0070713_1000626742 274
97 3300005455 Ga0070663_100101746 Ga0070663_1001017463 274
98 3300005548 Ga0070665_100015994 Ga0070665_1000159942 274
99 3300005614 Ga0068856_100185925 Ga0068856_1001859253 274
100 3300005937 Ga0081455_10086171 Ga0081455_100861712 274
101 3300021361 Ga0213872_10068817 Ga0213872_100688172 274
102 3300021384 Ga0213876_10112597 Ga0213876_101125971 274
103 3300025284 Ga0209130_1003432 Ga0209130_10034328 274
104 3300025294 Ga0209025_1033124 Ga0209025_10331243 274
105 3300025297 Ga0209758_1051509 Ga0209758_10515091 274
106 3300025302 Ga0207426_1000484 Ga0207426_10004847 274
107 3300025302 Ga0207426_1030327 Ga0207426_10303272 274
108 3300025304 Ga0209257_1001185 Ga0209257_100118517 274
109 3300025928 Ga0207700_10085542 Ga0207700_100855422 274
110 3300026067 Ga0207678_10052514 Ga0207678_100525143 274
111 3300028379 Ga0268266_10101216 Ga0268266_101012162 274
112 3300031090 Ga0265760_10017839 Ga0265760_100178391 274
113 3300031548 Ga0307408_100124872 Ga0307408_1001248722 274
114 3300031824 Ga0307413_10017747 Ga0307413_100177472 274
115 3300031852 Ga0307410_10038046 Ga0307410_100380462 274
116 3300031903 Ga0307407_10042522 Ga0307407_100425223 274
117 3300032005 Ga0307411_10057398 Ga0307411_100573983 274
118 3300035725 Ga0373947_0042568 Ga0373947_0042568_1404_2300 274
119 3300037068 Ga0373925_0327107 Ga0373925_0327107_50_946 274
120 3300037466 Ga0395898_0669167 Ga0395898_0669167_43_951 274
121 3300037471 Ga0395905_0309323 Ga0395905_0309323_443_1402 274
122 3300039437 Ga0436365_0357799 Ga0436365_0357799_631_1539 274
123 3300042157 Ga0439458_0048257 Ga0439458_0048257_113_1024 274
124 3300044694 Ga0466963_0146096 Ga0466963_0146096_570_1478 274
125 3300044719 Ga0466971_0061821 Ga0466971_0061821_193_1101 274
126 3300045976 Ga0466967_0268366 Ga0466967_0268366_138_1046 274
127 3300045976 Ga0466967_0388632 Ga0466967_0388632_392_1303 274
128 3300046455 Ga0495603_0098841 Ga0495603_0098841_726_1622 274
129 3300046499 Ga0495594_0215790 Ga0495594_0215790_70_966 274
130 3300046512 Ga0495610_0005349 Ga0495610_0005349_7789_8688 274
131 3300046683 Ga0495658_0105308 Ga0495658_0105308_160_1056 274
132 3300049585 Ga0501069_0139233 Ga0501069_0139233_457_1353 274
133 3300061719 Ga0466962_0056834 Ga0466962_0056834_858_1766 274
134 3300009176 Ga0105242_10357917 Ga0105242_103579172 275
135 3300009551 Ga0105238_10235833 Ga0105238_102358331 275
136 3300021441 Ga0213871_10018379 Ga0213871_100183793 275
137 3300035118 Ga0373954_0060720 Ga0373954_0060720_40_936 275
138 3300035692 Ga0373935_0206655 Ga0373935_0206655_166_1062 275
139 3300035724 Ga0373933_0248631 Ga0373933_0248631_125_1021 275
140 3300036401 Ga0373937_0174620 Ga0373937_0174620_447_1343 275
141 3300039438 Ga0436360_0489396 Ga0436360_0489396_578_1540 275
142 3300039453 Ga0436362_0727039 Ga0436362_0727039_1266_2228 275
143 3300046511 Ga0495608_0133966 Ga0495608_0133966_125_1021 275
144 3300047315 Ga0495581_0144985 Ga0495581_0144985_39_935 275
145 3300003322 rootL2_10105033 rootL2_101050332 276
146 3300005435 Ga0070714_100115446 Ga0070714_1001154462 276
147 3300005530 Ga0070679_100340835 Ga0070679_1003408352 276
148 3300039450 Ga0436363_0273477 Ga0436363_0273477_191_1051 276
149 3300047319 Ga0495674_0366258 Ga0495674_0366258_105_1010 276
150 3300048903 Ga0496100_0164980 Ga0496100_0164980_655_1560 276
151 3300048904 Ga0496101_0070881 Ga0496101_0070881_1110_2015 276
152 3300048907 Ga0496104_0242557 Ga0496104_0242557_500_1405 276
153 3300048908 Ga0496105_0066422 Ga0496105_0066422_530_1435 276
154 3300048913 Ga0496110_0227157 Ga0496110_0227157_673_1578 276
155 3300048917 Ga0496114_0287390 Ga0496114_0287390_76_981 276
156 3300048918 Ga0496115_0447671 Ga0496115_0447671_82_987 276
157 3300005330 Ga0070690_100192538 Ga0070690_1001925382 277
158 3300005334 Ga0068869_100218235 Ga0068869_1002182352 277
159 3300005335 Ga0070666_10199146 Ga0070666_101991462 277
160 3300005336 Ga0070680_100092984 Ga0070680_1000929842 277
161 3300005337 Ga0070682_100155946 Ga0070682_1001559461 277
162 3300005337 Ga0070682_100169413 Ga0070682_1001694131 277
163 3300005338 Ga0068868_100233461 Ga0068868_1002334612 277
164 3300005339 Ga0070660_100112963 Ga0070660_1001129632 277
165 3300005341 Ga0070691_10068285 Ga0070691_100682853 277
166 3300005343 Ga0070687_100124934 Ga0070687_1001249342 277
167 3300005344 Ga0070661_100200830 Ga0070661_1002008302 277
168 3300005345 Ga0070692_10078032 Ga0070692_100780322 277
169 3300005347 Ga0070668_100208194 Ga0070668_1002081943 277
170 3300005353 Ga0070669_100221318 Ga0070669_1002213181 277
171 3300005356 Ga0070674_100189352 Ga0070674_1001893523 277
172 3300005364 Ga0070673_100269408 Ga0070673_1002694083 277
173 3300005366 Ga0070659_100095690 Ga0070659_1000956902 277
174 3300005367 Ga0070667_100144684 Ga0070667_1001446843 277
175 3300005406 Ga0070703_10034943 Ga0070703_100349433 277
176 3300005438 Ga0070701_10091455 Ga0070701_100914554 277
177 3300005440 Ga0070705_100116129 Ga0070705_1001161292 277
178 3300005441 Ga0070700_100205367 Ga0070700_1002053671 277
179 3300005444 Ga0070694_100202046 Ga0070694_1002020462 277
180 3300005455 Ga0070663_100152945 Ga0070663_1001529453 277
181 3300005456 Ga0070678_100255199 Ga0070678_1002551991 277
182 3300005457 Ga0070662_100103115 Ga0070662_1001031154 277
183 3300005458 Ga0070681_10012696 Ga0070681_100126968 277
184 3300005459 Ga0068867_100119187 Ga0068867_1001191872 277
185 3300005468 Ga0070707_100356464 Ga0070707_1003564641 277
186 3300005471 Ga0070698_100135421 Ga0070698_1001354212 277
187 3300005530 Ga0070679_100092857 Ga0070679_1000928573 277
188 3300005535 Ga0070684_100222887 Ga0070684_1002228873 277
189 3300005539 Ga0068853_100253251 Ga0068853_1002532512 277
190 3300005544 Ga0070686_100179289 Ga0070686_1001792892 277
191 3300005545 Ga0070695_100071840 Ga0070695_1000718404 277
192 3300005546 Ga0070696_100096139 Ga0070696_1000961393 277
193 3300005547 Ga0070693_100158018 Ga0070693_1001580182 277
194 3300005549 Ga0070704_100226869 Ga0070704_1002268691 277
195 3300005563 Ga0068855_100201151 Ga0068855_1002011513 277
196 3300005564 Ga0070664_100001346 Ga0070664_1000013464 277
197 3300005564 Ga0070664_100116592 Ga0070664_1001165921 277
198 3300005577 Ga0068857_100117210 Ga0068857_1001172103 277
199 3300005578 Ga0068854_100043359 Ga0068854_1000433595 277
200 3300005614 Ga0068856_100241059 Ga0068856_1002410591 277
201 3300005615 Ga0070702_100063908 Ga0070702_1000639081 277
202 3300005616 Ga0068852_100148566 Ga0068852_1001485664 277
203 3300005617 Ga0068859_100541803 Ga0068859_1005418032 277
204 3300005618 Ga0068864_100237561 Ga0068864_1002375611 277
205 3300005718 Ga0068866_10029346 Ga0068866_100293463 277
206 3300005834 Ga0068851_10064689 Ga0068851_100646892 277
207 3300005840 Ga0068870_10090338 Ga0068870_100903382 277
208 3300005842 Ga0068858_100113637 Ga0068858_1001136374 277
209 3300005843 Ga0068860_100108992 Ga0068860_1001089922 277
210 3300005844 Ga0068862_100196901 Ga0068862_1001969012 277
211 3300006237 Ga0097621_100180170 Ga0097621_1001801702 277
212 3300006358 Ga0068871_100171410 Ga0068871_1001714102 277
213 3300006881 Ga0068865_100231434 Ga0068865_1002314342 277
214 3300006931 Ga0097620_100541790 Ga0097620_1005417901 277
215 3300009093 Ga0105240_10306972 Ga0105240_103069723 277
216 3300009098 Ga0105245_10215257 Ga0105245_102152573 277
217 3300009098 Ga0105245_10273322 Ga0105245_102733223 277
218 3300009148 Ga0105243_10237647 Ga0105243_102376472 277
219 3300009148 Ga0105243_10311111 Ga0105243_103111112 277
220 3300009174 Ga0105241_10365935 Ga0105241_103659351 277
221 3300009176 Ga0105242_10162891 Ga0105242_101628913 277
222 3300009545 Ga0105237_10475251 Ga0105237_104752511 277
223 3300009551 Ga0105238_10109322 Ga0105238_101093223 277
224 3300009553 Ga0105249_10234670 Ga0105249_102346703 277
225 3300010375 Ga0105239_10599773 Ga0105239_105997731 277
226 3300011119 Ga0105246_10117756 Ga0105246_101177562 277
227 3300013102 Ga0157371_10206878 Ga0157371_102068781 277
228 3300013105 Ga0157369_10459009 Ga0157369_104590092 277
229 3300013296 Ga0157374_10260848 Ga0157374_102608482 277
230 3300013297 Ga0157378_10164874 Ga0157378_101648743 277
231 3300013306 Ga0163162_10251598 Ga0163162_102515983 277
232 3300013307 Ga0157372_10184345 Ga0157372_101843456 277
233 3300013308 Ga0157375_10096868 Ga0157375_100968685 277
234 3300014968 Ga0157379_10248777 Ga0157379_102487772 277
235 3300021384 Ga0213876_10086119 Ga0213876_100861193 277
236 3300025321 Ga0207656_10106642 Ga0207656_101066421 277
237 3300025885 Ga0207653_10029937 Ga0207653_100299373 277
238 3300025899 Ga0207642_10031629 Ga0207642_100316293 277
239 3300025901 Ga0207688_10242677 Ga0207688_102426772 277
240 3300025904 Ga0207647_10061021 Ga0207647_100610212 277
241 3300025908 Ga0207643_10146936 Ga0207643_101469361 277
242 3300025911 Ga0207654_10066638 Ga0207654_100666383 277
243 3300025912 Ga0207707_10046763 Ga0207707_100467635 277
244 3300025913 Ga0207695_10213721 Ga0207695_102137212 277
245 3300025914 Ga0207671_10299299 Ga0207671_102992991 277
246 3300025917 Ga0207660_10295556 Ga0207660_102955561 277
247 3300025918 Ga0207662_10149231 Ga0207662_101492311 277
248 3300025919 Ga0207657_10250664 Ga0207657_102506641 277
249 3300025920 Ga0207649_10007861 Ga0207649_100078612 277
250 3300025920 Ga0207649_10192094 Ga0207649_101920941 277
251 3300025921 Ga0207652_10187739 Ga0207652_101877394 277
252 3300025924 Ga0207694_10107258 Ga0207694_101072583 277
253 3300025927 Ga0207687_10173836 Ga0207687_101738362 277
254 3300025927 Ga0207687_10254419 Ga0207687_102544191 277
255 3300025932 Ga0207690_10046526 Ga0207690_100465263 277
256 3300025933 Ga0207706_10172377 Ga0207706_101723773 277
257 3300025934 Ga0207686_10225458 Ga0207686_102254582 277
258 3300025935 Ga0207709_10155802 Ga0207709_101558021 277
259 3300025937 Ga0207669_10367068 Ga0207669_103670682 277
260 3300025938 Ga0207704_10178527 Ga0207704_101785272 277
261 3300025942 Ga0207689_10146599 Ga0207689_101465991 277
262 3300025944 Ga0207661_10314065 Ga0207661_103140652 277
263 3300025945 Ga0207679_10000846 Ga0207679_100008467 277
264 3300025945 Ga0207679_10160675 Ga0207679_101606752 277
265 3300025949 Ga0207667_10195977 Ga0207667_101959772 277
266 3300025961 Ga0207712_10216510 Ga0207712_102165101 277
267 3300025981 Ga0207640_10061084 Ga0207640_100610841 277
268 3300025986 Ga0207658_10321233 Ga0207658_103212331 277
269 3300026035 Ga0207703_10161087 Ga0207703_101610872 277
270 3300026041 Ga0207639_10018756 Ga0207639_100187565 277
271 3300026067 Ga0207678_10106692 Ga0207678_101066925 277
272 3300026075 Ga0207708_10142562 Ga0207708_101425623 277
273 3300026078 Ga0207702_10087002 Ga0207702_100870022 277
274 3300026089 Ga0207648_10051778 Ga0207648_100517785 277
275 3300026095 Ga0207676_10335676 Ga0207676_103356761 277
276 3300026116 Ga0207674_10187849 Ga0207674_101878491 277
277 3300026121 Ga0207683_10264647 Ga0207683_102646471 277
278 3300026142 Ga0207698_10422570 Ga0207698_104225701 277
279 3300028380 Ga0268265_10209747 Ga0268265_102097472 277
280 3300028381 Ga0268264_10157214 Ga0268264_101572143 277
281 3300035172 Ga0373955_0076310 Ga0373955_0076310_235_1188 277
282 3300036401 Ga0373937_0206825 Ga0373937_0206825_495_1448 277
283 3300046681 Ga0495647_0056258 Ga0495647_0056258_141_1094 277
284 3300048903 Ga0496100_0226388 Ga0496100_0226388_482_1330 277
285 3300048905 Ga0496102_0110059 Ga0496102_0110059_841_1689 277
286 3300048907 Ga0496104_0133872 Ga0496104_0133872_1293_2141 277
287 3300048908 Ga0496105_0238172 Ga0496105_0238172_247_1095 277
288 3300048909 Ga0496106_0140779 Ga0496106_0140779_176_1024 277
289 3300048910 Ga0496107_0179426 Ga0496107_0179426_227_1075 277
290 3300048917 Ga0496114_0232926 Ga0496114_0232926_81_929 277
291 3300048918 Ga0496115_0246028 Ga0496115_0246028_483_1331 277
292 3300048911 Ga0496108_0210382 Ga0496108_0210382_200_1174 278
293 3300048928 Ga0496125_0097625 Ga0496125_0097625_394_1368 278
294 3300005367 Ga0070667_100284211 Ga0070667_1002842111 279
295 3300005471 Ga0070698_100134981 Ga0070698_1001349812 279
296 3300005548 Ga0070665_100213435 Ga0070665_1002134353 279
297 3300005617 Ga0068859_100010442 Ga0068859_1000104423 279
298 3300005842 Ga0068858_100002984 Ga0068858_10000298411 279
299 3300005842 Ga0068858_100051863 Ga0068858_1000518635 279
300 3300005843 Ga0068860_100016963 Ga0068860_1000169633 279
301 3300006237 Ga0097621_100341637 Ga0097621_1003416371 279
302 3300006931 Ga0097620_100010442 Ga0097620_1000104423 279
303 3300009101 Ga0105247_10131716 Ga0105247_101317162 279
304 3300009177 Ga0105248_10027410 Ga0105248_100274104 279
305 3300009545 Ga0105237_10143621 Ga0105237_101436212 279
306 3300025900 Ga0207710_10004056 Ga0207710_100040562 279
307 3300025941 Ga0207711_10218804 Ga0207711_102188041 279
308 3300025986 Ga0207658_10010540 Ga0207658_100105402 279
309 3300026035 Ga0207703_10002070 Ga0207703_100020705 279
310 3300026035 Ga0207703_10036213 Ga0207703_100362135 279
311 3300028379 Ga0268266_10076168 Ga0268266_100761683 279
312 3300028381 Ga0268264_10027362 Ga0268264_100273622 279
313 3300037471 Ga0395905_0295074 Ga0395905_0295074_387_1340 279
314 3300005334 Ga0068869_100358319 Ga0068869_1003583191 280
315 3300006846 Ga0075430_100204991 Ga0075430_1002049911 280
316 3300006847 Ga0075431_100547305 Ga0075431_1005473051 280
317 3300006881 Ga0068865_100197137 Ga0068865_1001971372 280
318 3300009148 Ga0105243_10150357 Ga0105243_101503572 280
319 3300031824 Ga0307413_10283514 Ga0307413_102835142 280
320 3300031852 Ga0307410_10238357 Ga0307410_102383571 280
321 3300032002 Ga0307416_100389834 Ga0307416_1003898342 280
322 3300032004 Ga0307414_10237646 Ga0307414_102376463 280
323 3300032126 Ga0307415_100303580 Ga0307415_1003035801 280
324 3300048918 Ga0496115_0053839 Ga0496115_0053839_503_1372 280
325 3300049660 Ga0501216_014734 Ga0501216_014734_82_960 280
326 3300049688 Ga0501259_013080 Ga0501259_013080_16_894 280
327 3300049690 Ga0501261_009318 Ga0501261_009318_85_963 280
328 3300049705 Ga0501225_0059861 Ga0501225_0059861_122_1000 280
329 3300049768 Ga0501271_004406 Ga0501271_004406_315_1193 280
330 3300005844 Ga0068862_100298281 Ga0068862_1002982811 281
331 3300014326 Ga0157380_10622910 Ga0157380_106229101 281
332 3300031242 Ga0265329_10018688 Ga0265329_100186883 281
333 3300045976 Ga0466967_0297708 Ga0466967_0297708_515_1480 281
334 3300048905 Ga0496102_0252612 Ga0496102_0252612_186_1031 281
335 3300048906 Ga0496103_0167636 Ga0496103_0167636_39_884 281
336 3300049582 Ga0501048_0253010 Ga0501048_0253010_319_1197 281
337 3300049588 Ga0501072_0286211 Ga0501072_0286211_64_942 281
338 3300049590 Ga0501074_0351992 Ga0501074_0351992_116_994 281
339 3300049592 Ga0501076_0250392 Ga0501076_0250392_245_1123 281
340 3300049593 Ga0501077_0216559 Ga0501077_0216559_113_991 281
341 3300049743 Ga0501081_0219932 Ga0501081_0219932_161_1039 281
342 3300049824 Ga0501045_0283419 Ga0501045_0283419_138_1016 281
343 iso_pu_bacteria 2501939600 2501944824 281
344 iso_pu_bacteria 649633069 649812163 281
345 iso_pu_bacteria 649633069 649813309 281
346 iso_pu_bacteria 649633069 649814336 281
347 3300005327 Ga0070658_10025892 Ga0070658_100258921 283
348 3300005334 Ga0068869_100275740 Ga0068869_1002757402 283
349 3300005339 Ga0070660_100147070 Ga0070660_1001470703 283
350 3300005344 Ga0070661_100298214 Ga0070661_1002982142 283
351 3300005356 Ga0070674_100204439 Ga0070674_1002044392 283
352 3300005539 Ga0068853_100130981 Ga0068853_1001309813 283
353 3300005539 Ga0068853_100358448 Ga0068853_1003584482 283
354 3300005563 Ga0068855_100107880 Ga0068855_1001078804 283
355 3300005614 Ga0068856_100279869 Ga0068856_1002798693 283
356 3300005616 Ga0068852_100352169 Ga0068852_1003521693 283
357 3300005618 Ga0068864_100309577 Ga0068864_1003095772 283
358 3300005841 Ga0068863_100372758 Ga0068863_1003727581 283
359 3300005841 Ga0068863_100388830 Ga0068863_1003888302 283
360 3300005844 Ga0068862_100338690 Ga0068862_1003386902 283
361 3300006051 Ga0075364_10196403 Ga0075364_101964031 283
362 3300006177 Ga0075362_10080230 Ga0075362_100802302 283
363 3300006195 Ga0075366_10098324 Ga0075366_100983241 283
364 3300006358 Ga0068871_100475384 Ga0068871_1004753841 283
365 3300009174 Ga0105241_10208958 Ga0105241_102089582 283
366 3300010375 Ga0105239_10313522 Ga0105239_103135222 283
367 3300013104 Ga0157370_10236140 Ga0157370_102361402 283
368 3300013104 Ga0157370_10271051 Ga0157370_102710513 283
369 3300013308 Ga0157375_10360378 Ga0157375_103603783 283
370 3300014968 Ga0157379_10304782 Ga0157379_103047821 283
371 3300014969 Ga0157376_10290929 Ga0157376_102909292 283
372 3300025321 Ga0207656_10104076 Ga0207656_101040762 283
373 3300025909 Ga0207705_10204049 Ga0207705_102040491 283
374 3300025931 Ga0207644_10150945 Ga0207644_101509452 283
375 3300025937 Ga0207669_10269780 Ga0207669_102697801 283
376 3300025942 Ga0207689_10291983 Ga0207689_102919832 283
377 3300025949 Ga0207667_10474258 Ga0207667_104742581 283
378 3300025986 Ga0207658_10325015 Ga0207658_103250152 283
379 3300026041 Ga0207639_10382616 Ga0207639_103826162 283
380 3300026041 Ga0207639_10387789 Ga0207639_103877892 283
381 3300026078 Ga0207702_10467776 Ga0207702_104677761 283
382 3300026088 Ga0207641_10397296 Ga0207641_103972961 283
383 3300026088 Ga0207641_10430129 Ga0207641_104301291 283
384 3300026088 Ga0207641_10447914 Ga0207641_104479142 283
385 3300026095 Ga0207676_10276591 Ga0207676_102765913 283
386 3300026121 Ga0207683_10522867 Ga0207683_105228672 283
387 3300030878 Ga0265770_1019402 Ga0265770_10194022 283
388 3300031730 Ga0307516_10388568 Ga0307516_103885681 283
389 3300046522 Ga0495643_0075147 Ga0495643_0075147_147_998 283
390 3300050489 nmdc:mga03683_100988_c1 nmdc:mga03683_100988_c1_366_1217 283
391 3300050491 nmdc:mga00v17_190448_c1 nmdc:mga00v17_190448_c1_109_960 283
392 3300050493 nmdc:mga0k408_167490_c1 nmdc:mga0k408_167490_c1_34_885 283
393 3300050494 nmdc:mga06z11_139064_c1 nmdc:mga06z11_139064_c1_477_1328 283
394 3300050496 nmdc:mga07m45_160742_c1 nmdc:mga07m45_160742_c1_69_920 283
395 3300053094 Ga0500566_0080599 Ga0500566_0080599_387_1238 283
396 3300002155 JGI24033J26618_1003055 JGI24033J26618_10030553 284
397 3300002244 JGI24742J22300_10017193 JGI24742J22300_100171931 284
398 3300005328 Ga0070676_10202354 Ga0070676_102023542 284
399 3300005334 Ga0068869_100326608 Ga0068869_1003266081 284
400 3300005456 Ga0070678_100201038 Ga0070678_1002010383 284
401 3300005459 Ga0068867_100088748 Ga0068867_1000887484 284
402 3300005616 Ga0068852_100301003 Ga0068852_1003010033 284
403 3300025942 Ga0207689_10127951 Ga0207689_101279512 284
404 3300026089 Ga0207648_10162179 Ga0207648_101621792 284
405 3300026121 Ga0207683_10237311 Ga0207683_102373111 284
406 3300026142 Ga0207698_10432633 Ga0207698_104326331 284
407 3300031548 Ga0307408_100487663 Ga0307408_1004876631 284
408 3300031911 Ga0307412_10315341 Ga0307412_103153411 284
409 3300031995 Ga0307409_100344001 Ga0307409_1003440012 284
410 3300032004 Ga0307414_10151843 Ga0307414_101518431 284
411 3300045976 Ga0466967_0298111 Ga0466967_0298111_318_1172 284
412 3300049652 Ga0501202_017125 Ga0501202_017125_515_1369 284
413 3300049688 Ga0501259_016390 Ga0501259_016390_43_897 284
414 3300049741 Ga0501079_0361025 Ga0501079_0361025_148_1014 284
415 3300053153 Ga0500616_0012812 Ga0500616_0012812_1211_2065 284
416 3300053177 Ga0500636_0137677 Ga0500636_0137677_69_923 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00665

rve

Integrase core domain

119

217

0.97

PF13333

rve_2

Integrase core domain

224

279

0.97

PF13683

rve_3

Integrase core domain

205

272

0.97

PF13276

HTH_21

HTH-like domain

37

96

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x78-assembly1.cif.gz_A human foamy virus integrase - catalytic core. 0.7865 121 276
3s3n-assembly1.cif.gz_B-2 crystal structure of the prototype foamy virus (pfv) s217h mutant intasome in complex with magnesium and dolutegravir (s/gsk1349572) 0.7833 119 276
7ku7-assembly1.cif.gz_F cryo-em structure of rous sarcoma virus cleaved synaptic complex (csc) with hiv-1 integrase strand transfer inhibitor mk-2048. cluster identified by 3-dimensional variability analysis in cryosparc. 0.7757 122 279
1c0m-assembly1.cif.gz_A crystal structure of rsv two-domain integrase 0.7749 118 278
3os1-assembly1.cif.gz_B pfv target capture complex (tcc) at 2.97 a resolution 0.7744 119 280
ID Description Score Start End Superfamily
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9538 119 277 3.30.420.10
af_Q47718_102_174_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9459 121 186 3.30.420.10
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9424 119 277 3.30.420.10
af_P9WKH9_102_261_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.937 119 273 3.30.420.10
af_P19769_115_278_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9242 119 279 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A2Z2KQG7-F1-model_v4 Integrase catalytic domain-containing protein 0.9624 128 282 GO:0003676
GO:0015074
AF-A0A0H2UZ75-F1-model_v4 IS600 ORF2 0.9613 128 283 GO:0003676
GO:0015074
AF-A0A7V8XCI3-F1-model_v4 IS3 family transposase 0.961 126 284 GO:0003676
GO:0015074
AF-A0A5S3ZBB7-F1-model_v4 Integrase catalytic domain-containing protein 0.9597 117 188 GO:0003676
GO:0015074
AF-A0A388RZ38-F1-model_v4 deleted 0.959 119 277

Feature Viewer

pLDDT pTM Quality
87.44 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map