F438882

General Info

Members Datasets Scaffolds Average Seq Length
416 235 832 282

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0086518|Ga0495629_0086518_809_1810
Length 323
Sequence VSALLASIPSPHSGVLHIGPVPLRMYGLMLLVAIALCVWLTRRRWIARGGDGDLVYEVALWGVLAGIVGARLYHDLTSWNEDQLLGADPGPHPWWGAFAVILFGVAAGAIVVRRGLRAQVRRLEEEGAQIRGADEQRGLLERIAAIKRLGIRDMLDAAAPGLLLAQGVGRWGNYWNQELFGKATRLPWALQIDYDHCPDSDKDLTNTSCNLTYHPTFLYEFIWDLAGVGLLLWLDRKFRFRAPALFALYVSYYTFGRFFEELLRIDPSGHFLGLRLNAWVSVVVFLASTLFFVFWQIVQPRRARKRAGSAPSRPAMAVPRGRR

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
103 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
104 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
105 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
116 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
117 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
118 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
119 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
120 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
124 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
135 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.66
Rhizosphere 85.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0086518 3300046459 Bacteria 2186
2 Ga0070683_100022285 3300005329 Bacteria 5659
3 Ga0070683_100221345 3300005329 Bacteria 1799
4 Ga0070690_100111686 3300005330 Bacteria 1825
5 Ga0070666_10223741 3300005335 Bacteria 1328
6 Ga0070682_100028832 3300005337 Bacteria 3340
7 Ga0068868_100090464 3300005338 Bacteria 2464
8 Ga0068868_100133290 3300005338 Bacteria 2035
9 Ga0070660_100031826 3300005339 Bacteria 3965
10 Ga0070691_10030925 3300005341 Bacteria 2509
11 Ga0070661_100031679 3300005344 Bacteria 3824
12 Ga0070674_100070512 3300005356 Bacteria 2470
13 Ga0070709_10026111 3300005434 Bacteria 3457
14 Ga0070709_10065237 3300005434 Bacteria 2331
15 Ga0070714_100074326 3300005435 Bacteria 2946
16 Ga0070710_10023301 3300005437 Bacteria 3252
17 Ga0070701_10018414 3300005438 Bacteria 3282
18 Ga0070711_100044907 3300005439 Bacteria 3001
19 Ga0070705_100014772 3300005440 Bacteria 4025
20 Ga0070700_100070605 3300005441 Bacteria 2227
21 Ga0070708_100136017 3300005445 Bacteria 2276
22 Ga0070708_100202002 3300005445 Bacteria 1861
23 Ga0070663_100154945 3300005455 Bacteria 1760
24 Ga0070678_100065063 3300005456 Bacteria 2705
25 Ga0070681_10010437 3300005458 Bacteria 9174
26 Ga0070681_10036636 3300005458 Bacteria 4925
27 Ga0068867_100130263 3300005459 Bacteria 1954
28 Ga0070685_10051803 3300005466 Bacteria 2374
29 Ga0070706_100150963 3300005467 Bacteria 2169
30 Ga0070707_100067435 3300005468 Bacteria 3442
31 Ga0070679_100046029 3300005530 Bacteria 4347
32 Ga0070679_100052389 3300005530 Bacteria 4065
33 Ga0070684_100081101 3300005535 Bacteria 2870
34 Ga0070684_100422394 3300005535 Bacteria 1231
35 Ga0070697_100125619 3300005536 Bacteria 2149
36 Ga0070672_100199257 3300005543 Bacteria 1674
37 Ga0070686_100089204 3300005544 Bacteria 2059
38 Ga0070696_100131876 3300005546 Bacteria 1819
39 Ga0068855_100071114 3300005563 Bacteria 4046
40 Ga0068857_100241637 3300005577 Bacteria 1653
41 Ga0068854_100078539 3300005578 Bacteria 2432
42 Ga0068856_100088801 3300005614 Bacteria 3073
43 Ga0068864_100366425 3300005618 Bacteria 1363
44 Ga0068861_100261485 3300005719 Bacteria 1482
45 Ga0068860_100094624 3300005843 Bacteria 2847
46 Ga0068862_100181978 3300005844 Bacteria 1887
47 Ga0081455_10016625 3300005937 Bacteria 7093
48 Ga0081455_10084474 3300005937 Bacteria 2591
49 Ga0081540_1015388 3300005983 Bacteria 4846
50 Ga0081540_1031163 3300005983 Bacteria 2938
51 Ga0081539_10001726 3300005985 Bacteria 34952
52 Ga0081539_10080345 3300005985 Bacteria 1715
53 Ga0075432_10039742 3300006058 Bacteria 1641
54 Ga0070715_10010812 3300006163 Bacteria 3264
55 Ga0070716_100132948 3300006173 Bacteria 1575
56 Ga0070712_100013489 3300006175 Bacteria 5224
57 Ga0075428_100104256 3300006844 Bacteria 3092
58 Ga0075431_100047905 3300006847 Bacteria 4407
59 Ga0075431_100066021 3300006847 Bacteria 3736
60 Ga0075431_100077111 3300006847 Bacteria 3440
61 Ga0075434_100032740 3300006871 Bacteria 5126
62 Ga0075429_100101731 3300006880 Bacteria 2509
63 Ga0075436_100039396 3300006914 Bacteria 3261
64 Ga0075436_100039729 3300006914 Bacteria 3246
65 Ga0075435_100053400 3300007076 Bacteria 3259
66 Ga0075435_100117924 3300007076 Bacteria 2212
67 Ga0105240_10143555 3300009093 Bacteria 2851
68 Ga0111539_10031773 3300009094 Bacteria 6414
69 Ga0111539_10032436 3300009094 Bacteria 6342
70 Ga0105245_10048614 3300009098 Bacteria 3795
71 Ga0105245_10124437 3300009098 Bacteria 2412
72 Ga0114129_10161734 3300009147 Bacteria 3058
73 Ga0114129_10245861 3300009147 Bacteria 2403
74 Ga0105243_10052626 3300009148 Bacteria 3226
75 Ga0105243_10120000 3300009148 Bacteria 2215
76 Ga0105242_10139755 3300009176 Bacteria 2100
77 Ga0105248_10100227 3300009177 Bacteria 3264
78 Ga0105238_10036271 3300009551 Bacteria 5011
79 Ga0105249_10259326 3300009553 Bacteria 1727
80 Ga0099796_10032024 3300010159 Bacteria 1720
81 Ga0105239_10032860 3300010375 Bacteria 5701
82 Ga0105239_10991809 3300010375 Bacteria 966
83 Ga0157342_1004618 3300012507 Bacteria 1231
84 Ga0157373_10111631 3300013100 Bacteria 1922
85 Ga0157369_10087326 3300013105 Bacteria 3330
86 Ga0157369_10126317 3300013105 Bacteria 2711
87 Ga0157369_10286351 3300013105 Bacteria 1716
88 Ga0157372_10038386 3300013307 Bacteria 5284
89 Ga0163163_10193052 3300014325 Bacteria 2084
90 Ga0163163_10384630 3300014325 Bacteria 1461
91 Ga0182008_10090456 3300014497 Bacteria 1508
92 Ga0157376_10127334 3300014969 Bacteria 2267
93 Ga0163161_10163933 3300017792 Bacteria 1696
94 Ga0213871_10038818 3300021441 Bacteria 1273
95 Ga0224712_10127179 3300022467 Bacteria 1109
96 Ga0207692_10008973 3300025898 Bacteria 4161
97 Ga0207642_10031368 3300025899 Bacteria 2225
98 Ga0207680_10091400 3300025903 Bacteria 1937
99 Ga0207685_10004018 3300025905 Bacteria 3673
100 Ga0207699_10391318 3300025906 Bacteria 988
101 Ga0207705_10033710 3300025909 Bacteria 3659
102 Ga0207654_10048316 3300025911 Bacteria 2435
103 Ga0207693_10000967 3300025915 Bacteria 25810
104 Ga0207693_10348201 3300025915 Bacteria 1159
105 Ga0207657_10002021 3300025919 Bacteria 21926
106 Ga0207657_10193133 3300025919 Bacteria 1641
107 Ga0207646_10021457 3300025922 Bacteria 5966
108 Ga0207687_10216577 3300025927 Bacteria 1505
109 Ga0207700_10124572 3300025928 Bacteria 2094
110 Ga0207664_10012433 3300025929 Bacteria 6085
111 Ga0207664_10024829 3300025929 Bacteria 4506
112 Ga0207664_10096728 3300025929 Bacteria 2431
113 Ga0207690_10026224 3300025932 Bacteria 3668
114 Ga0207690_10111312 3300025932 Bacteria 1973
115 Ga0207706_10013951 3300025933 Bacteria 7285
116 Ga0207709_10127796 3300025935 Bacteria 1727
117 Ga0207704_10019186 3300025938 Bacteria 3587
118 Ga0207704_10257368 3300025938 Bacteria 1314
119 Ga0207665_10012011 3300025939 Bacteria 5687
120 Ga0207691_10092695 3300025940 Bacteria 2705
121 Ga0207661_10044205 3300025944 Bacteria 3519
122 Ga0207661_10172629 3300025944 Bacteria 1883
123 Ga0207679_10304399 3300025945 Bacteria 1375
124 Ga0207678_10177689 3300026067 Bacteria 1818
125 Ga0207708_10055840 3300026075 Bacteria 3011
126 Ga0207702_10112244 3300026078 Bacteria 2425
127 Ga0207702_10171921 3300026078 Bacteria 1987
128 Ga0207674_10261657 3300026116 Bacteria 1677
129 Ga0207675_100393072 3300026118 Bacteria 1365
130 Ga0207683_10020597 3300026121 Bacteria 5644
131 Ga0207428_10017316 3300027907 Bacteria 6186
132 Ga0265319_1026881 3300028563 Bacteria 2046
133 Ga0265334_10027709 3300028573 Bacteria 2281
134 Ga0265322_10023948 3300028654 Bacteria 1745
135 Ga0265336_10001383 3300028666 Bacteria 11181
136 Ga0265338_10019940 3300028800 Bacteria 7080
137 Ga0265338_10053686 3300028800 Bacteria 3601
138 Ga0265338_10109269 3300028800 Bacteria 2231
139 Ga0265330_10017773 3300031235 Bacteria 3273
140 Ga0265339_10067791 3300031249 Bacteria 1908
141 Ga0265316_10013349 3300031344 Bacteria 7301
142 Ga0265313_10021943 3300031595 Bacteria 3479
143 Ga0265314_10025460 3300031711 Bacteria 4462
144 Ga0265314_10041111 3300031711 Bacteria 3312
145 Ga0265342_10097791 3300031712 Bacteria 1676
146 Ga0307416_100108302 3300032002 Bacteria 2441
147 Ga0307415_100032454 3300032126 Bacteria 3377
148 Ga0373929_0018917 3300035085 Bacteria 1374
149 Ga0373944_0014021 3300035089 Bacteria 2232
150 Ga0373951_0008735 3300035091 Bacteria 2284
151 Ga0373952_0036548 3300035092 Bacteria 1116
152 Ga0373939_0010662 3300035114 Bacteria 2305
153 Ga0373939_0025714 3300035114 Bacteria 1653
154 Ga0373941_0033576 3300035115 Bacteria 1543
155 Ga0373943_0000170 3300035170 Bacteria 25570
156 Ga0373943_0003310 3300035170 Bacteria 7322
157 Ga0373946_0004561 3300035171 Bacteria 4963
158 Ga0373946_0023100 3300035171 Bacteria 2427
159 Ga0373942_0016381 3300035207 Bacteria 1817
160 Ga0373924_0094280 3300035410 Bacteria 1283
161 Ga0373947_0000199 3300035725 Bacteria 33261
162 Ga0373925_0001020 3300037068 Bacteria 25337
163 Ga0373925_0004699 3300037068 Bacteria 10306
164 Ga0395899_0100554 3300037312 Bacteria 2088
165 Ga0395899_0112770 3300037312 Bacteria 1953
166 Ga0395899_0141558 3300037312 Bacteria 1711
167 Ga0395899_0203827 3300037312 Bacteria 1378
168 Ga0395899_0302422 3300037312 Bacteria 1082
169 Ga0395899_0493720 3300037312 Bacteria 795
170 Ga0395900_0084467 3300037418 Bacteria 3262
171 Ga0395900_0174978 3300037418 Bacteria 2183
172 Ga0395900_0191252 3300037418 Bacteria 2076
173 Ga0395900_0289718 3300037418 Bacteria 1626
174 Ga0395900_0704621 3300037418 Bacteria 943
175 Ga0395898_0002272 3300037466 Bacteria 23229
176 Ga0395898_0029787 3300037466 Bacteria 5463
177 Ga0395898_0046916 3300037466 Bacteria 4242
178 Ga0395898_0051208 3300037466 Bacteria 4039
179 Ga0395898_0091897 3300037466 Bacteria 2919
180 Ga0395898_0242711 3300037466 Bacteria 1718
181 Ga0395898_0307854 3300037466 Bacteria 1511
182 Ga0395898_0316627 3300037466 Bacteria 1488
183 Ga0395898_0596364 3300037466 Bacteria 1047
184 Ga0395905_0071593 3300037471 Bacteria 3250
185 Ga0395905_0101084 3300037471 Bacteria 2707
186 Ga0395905_0128393 3300037471 Bacteria 2384
187 Ga0395905_0129504 3300037471 Bacteria 2373
188 Ga0395905_0139478 3300037471 Bacteria 2281
189 Ga0395905_0247594 3300037471 Bacteria 1665
190 Ga0395905_0263506 3300037471 Bacteria 1609
191 Ga0395905_0453616 3300037471 Bacteria 1180
192 Ga0395901_0027753 3300038443 Bacteria 5821
193 Ga0395901_0108630 3300038443 Bacteria 2912
194 Ga0395901_0216978 3300038443 Bacteria 2000
195 Ga0395901_0813501 3300038443 Bacteria 922
196 Ga0436360_0699854 3300039438 Bacteria 3203
197 Ga0436360_1160248 3300039438 Bacteria 3878
198 Ga0451853_2474626 3300041512 Bacteria 2101
199 Ga0439448_0009816 3300042005 Bacteria 2827
200 Ga0439463_059982 3300042016 Bacteria 973
201 Ga0466972_0112698 3300044658 Bacteria 1285
202 Ga0466965_0161114 3300044683 Bacteria 1176
203 Ga0466966_0196191 3300044684 Bacteria 1222
204 Ga0466961_0002250 3300044693 Bacteria 11998
205 Ga0466963_0001500 3300044694 Bacteria 12626
206 Ga0466963_0001932 3300044694 Bacteria 11348
207 Ga0466963_0030697 3300044694 Bacteria 3469
208 Ga0466963_0064103 3300044694 Bacteria 2461
209 Ga0466963_0074827 3300044694 Bacteria 2285
210 Ga0466964_0014579 3300044706 Bacteria 2989
211 Ga0466964_0121591 3300044706 Bacteria 1178
212 Ga0466971_0006573 3300044719 Bacteria 5052
213 Ga0466971_0052033 3300044719 Bacteria 1844
214 Ga0466957_0039862 3300044842 Bacteria 2835
215 Ga0466960_0006051 3300044901 Bacteria 4834
216 Ga0466959_0036070 3300045049 Bacteria 3654
217 Ga0451576_0020596 3300045051 Bacteria 7177
218 Ga0451576_0148164 3300045051 Bacteria 2447
219 Ga0466958_0001139 3300045836 Bacteria 12312
220 Ga0466958_0041415 3300045836 Bacteria 2770
221 Ga0466958_0167160 3300045836 Bacteria 1392
222 Ga0466967_0000073 3300045976 Bacteria 37163
223 Ga0466967_0004285 3300045976 Bacteria 9592
224 Ga0466967_0006670 3300045976 Bacteria 8207
225 Ga0466967_0016258 3300045976 Bacteria 5860
226 Ga0466967_0016818 3300045976 Bacteria 5782
227 Ga0466967_0113918 3300045976 Bacteria 2489
228 Ga0466967_0138195 3300045976 Bacteria 2267
229 Ga0466967_0193074 3300045976 Bacteria 1925
230 Ga0466967_0295943 3300045976 Bacteria 1556
231 Ga0466967_0306547 3300045976 Bacteria 1529
232 Ga0466967_0332619 3300045976 Bacteria 1467
233 Ga0466967_0392627 3300045976 Bacteria 1349
234 Ga0495592_0034538 3300046454 Bacteria 3812
235 Ga0495592_0087056 3300046454 Bacteria 2248
236 Ga0495603_0001635 3300046455 Bacteria 13161
237 Ga0495603_0053243 3300046455 Bacteria 2401
238 Ga0495603_0104066 3300046455 Bacteria 1657
239 Ga0495629_0003815 3300046459 Bacteria 11362
240 Ga0495641_0002085 3300046461 Bacteria 16154
241 Ga0495641_0003920 3300046461 Bacteria 10819
242 Ga0495641_0016335 3300046461 Bacteria 3914
243 Ga0495651_0050521 3300046462 Bacteria 3208
244 Ga0495653_0099023 3300046463 Bacteria 2116
245 Ga0495580_0161985 3300046472 Bacteria 1548
246 Ga0495582_0000028 3300046473 Bacteria 79694
247 Ga0495582_0029883 3300046473 Bacteria 2991
248 Ga0495582_0081766 3300046473 Bacteria 1794
249 Ga0495582_0167783 3300046473 Bacteria 1249
250 Ga0495662_0079760 3300046476 Bacteria 1592
251 Ga0495662_0195048 3300046476 Bacteria 998
252 Ga0495664_0047738 3300046477 Bacteria 2541
253 Ga0495664_0100171 3300046477 Bacteria 1745
254 Ga0495594_0002688 3300046499 Bacteria 9235
255 Ga0495608_0012290 3300046511 Bacteria 5947
256 Ga0495608_0041827 3300046511 Bacteria 3065
257 Ga0495628_0203111 3300046516 Bacteria 1492
258 Ga0495630_0012251 3300046517 Bacteria 6221
259 Ga0495630_0018384 3300046517 Bacteria 5136
260 Ga0495630_0136538 3300046517 Bacteria 1863
261 Ga0495630_0166735 3300046517 Bacteria 1677
262 Ga0495637_0059691 3300046520 Bacteria 1569
263 Ga0495652_0200779 3300046529 Bacteria 1513
264 Ga0495665_0142385 3300046531 Bacteria 1253
265 Ga0495640_0196958 3300046533 Bacteria 1278
266 Ga0495586_0001920 3300046535 Bacteria 11329
267 Ga0495586_0125139 3300046535 Bacteria 1438
268 Ga0495586_0179365 3300046535 Bacteria 1198
269 Ga0495587_0037880 3300046536 Bacteria 2893
270 Ga0495645_0089761 3300046543 Bacteria 2197
271 Ga0495667_0023229 3300046559 Bacteria 4178
272 Ga0495667_0187976 3300046559 Bacteria 1324
273 Ga0495656_0111183 3300046615 Bacteria 1282
274 Ga0495634_0048222 3300046642 Bacteria 2868
275 Ga0495659_0052666 3300046664 Bacteria 1486
276 Ga0495588_0000326 3300046674 Bacteria 31548
277 Ga0495657_0010740 3300046675 Bacteria 6882
278 Ga0495657_0149879 3300046675 Bacteria 1449
279 Ga0495623_0252486 3300046679 Bacteria 991
280 Ga0495646_0075510 3300046680 Bacteria 1976
281 Ga0495647_0125679 3300046681 Bacteria 1082
282 Ga0495658_0000277 3300046683 Bacteria 29131
283 Ga0495658_0075683 3300046683 Bacteria 1965
284 Ga0495658_0253714 3300046683 Bacteria 1107
285 Ga0495613_0011009 3300046689 Bacteria 6717
286 Ga0495613_0029350 3300046689 Bacteria 4089
287 Ga0495613_0142876 3300046689 Bacteria 1709
288 Ga0495613_0395639 3300046689 Bacteria 943
289 Ga0495624_0184767 3300046690 Bacteria 1269
290 Ga0495589_0137108 3300046794 Bacteria 1173
291 Ga0495600_0033446 3300046809 Bacteria 3338
292 Ga0495604_0033022 3300047317 Bacteria 4098
293 Ga0495604_0043710 3300047317 Bacteria 3506
294 Ga0495604_0051355 3300047317 Bacteria 3197
295 Ga0495604_0056158 3300047317 Bacteria 3032
296 Ga0495636_0048390 3300047318 Bacteria 1777
297 Ga0495674_0017492 3300047319 Bacteria 6671
298 Ga0495674_0019935 3300047319 Bacteria 6216
299 Ga0495674_0054283 3300047319 Bacteria 3519
300 Ga0495676_0013155 3300047321 Bacteria 7442
301 Ga0495676_0224609 3300047321 Bacteria 1292
302 Ga0495680_0024682 3300047322 Bacteria 4984
303 Ga0495680_0048300 3300047322 Bacteria 3342
304 Ga0495680_0076608 3300047322 Bacteria 2535
305 Ga0495680_0181798 3300047322 Bacteria 1517
306 Ga0495680_0187290 3300047322 Bacteria 1490
307 Ga0495680_0293076 3300047322 Bacteria 1144
308 Ga0495675_0162835 3300047444 Bacteria 1373
309 Ga0495684_0012403 3300047471 Bacteria 6572
310 Ga0495684_0097690 3300047471 Bacteria 2221
311 Ga0495593_0011912 3300047673 Bacteria 4986
312 Ga0496100_0040353 3300048903 Bacteria 2969
313 Ga0496100_0050639 3300048903 Bacteria 2692
314 Ga0496100_0069594 3300048903 Bacteria 2344
315 Ga0496100_0186858 3300048903 Bacteria 1502
316 Ga0496101_0026293 3300048904 Bacteria 4046
317 Ga0496101_0032401 3300048904 Bacteria 3679
318 Ga0496101_0042496 3300048904 Bacteria 3244
319 Ga0496101_0054172 3300048904 Bacteria 2896
320 Ga0496101_0214400 3300048904 Bacteria 1492
321 Ga0496102_0007026 3300048905 Bacteria 9613
322 Ga0496103_0022860 3300048906 Bacteria 3767
323 Ga0496103_0246294 3300048906 Bacteria 1150
324 Ga0496104_0039552 3300048907 Bacteria 4415
325 Ga0496104_0040648 3300048907 Bacteria 4360
326 Ga0496104_0043034 3300048907 Bacteria 4240
327 Ga0496104_0111173 3300048907 Bacteria 2627
328 Ga0496104_0122860 3300048907 Bacteria 2493
329 Ga0496104_0166284 3300048907 Bacteria 2115
330 Ga0496104_0514439 3300048907 Bacteria 1108
331 Ga0496105_0003731 3300048908 Bacteria 11342
332 Ga0496105_0009510 3300048908 Bacteria 7604
333 Ga0496105_0013664 3300048908 Bacteria 6446
334 Ga0496105_0044137 3300048908 Bacteria 3676
335 Ga0496105_0053982 3300048908 Bacteria 3319
336 Ga0496105_0130522 3300048908 Bacteria 2072
337 Ga0496105_0144597 3300048908 Bacteria 1956
338 Ga0496106_0452993 3300048909 Bacteria 1031
339 Ga0496106_0498059 3300048909 Bacteria 979
340 Ga0496107_0035231 3300048910 Bacteria 3587
341 Ga0496107_0082681 3300048910 Bacteria 2342
342 Ga0496107_0091824 3300048910 Bacteria 2219
343 Ga0496107_0120794 3300048910 Bacteria 1930
344 Ga0496108_0044717 3300048911 Bacteria 3696
345 Ga0496108_0068166 3300048911 Bacteria 3001
346 Ga0496108_0097896 3300048911 Bacteria 2500
347 Ga0496108_0249106 3300048911 Bacteria 1545
348 Ga0496109_0058908 3300048912 Bacteria 3508
349 Ga0496109_0475738 3300048912 Bacteria 1179
350 Ga0496110_0032930 3300048913 Bacteria 4480
351 Ga0496110_0045018 3300048913 Bacteria 3855
352 Ga0496110_0055581 3300048913 Bacteria 3483
353 Ga0496111_0003935 3300048914 Bacteria 9317
354 Ga0496111_0028445 3300048914 Bacteria 3961
355 Ga0496111_0081403 3300048914 Bacteria 2363
356 Ga0496112_0040633 3300048915 Bacteria 4548
357 Ga0496112_0062203 3300048915 Bacteria 3681
358 Ga0496112_0095302 3300048915 Bacteria 2947
359 Ga0496112_0625361 3300048915 Bacteria 1007
360 Ga0496113_0022935 3300048916 Bacteria 4423
361 Ga0496114_0007266 3300048917 Bacteria 8746
362 Ga0496114_0052668 3300048917 Bacteria 3391
363 Ga0496114_0100514 3300048917 Bacteria 2468
364 Ga0496114_0290929 3300048917 Bacteria 1441
365 Ga0496114_0319021 3300048917 Bacteria 1373
366 Ga0496115_0001740 3300048918 Bacteria 15619
367 Ga0496115_0024863 3300048918 Bacteria 4658
368 Ga0496115_0025768 3300048918 Bacteria 4583
369 Ga0496115_0029904 3300048918 Bacteria 4283
370 Ga0496115_0066611 3300048918 Bacteria 2910
371 Ga0496115_0370818 3300048918 Bacteria 1165
372 Ga0496115_0420894 3300048918 Bacteria 1082
373 Ga0501034_0041834 3300049571 Bacteria 4637
374 Ga0501047_0027063 3300049581 Bacteria 5523
375 Ga0501067_0021138 3300049583 Bacteria 3601
376 Ga0501069_0024134 3300049585 Bacteria 3317
377 Ga0501069_0046931 3300049585 Bacteria 2397
378 Ga0501070_0277567 3300049586 Bacteria 1368
379 Ga0501072_0011504 3300049588 Bacteria 6764
380 Ga0501073_0015817 3300049589 Bacteria 5467
381 Ga0501074_0026947 3300049590 Bacteria 4165
382 Ga0501074_0036639 3300049590 Bacteria 3553
383 Ga0501077_0092689 3300049593 Bacteria 1914
384 Ga0501079_0409064 3300049741 Bacteria 1064
385 Ga0501080_0074840 3300049742 Bacteria 3150
386 Ga0501080_0149792 3300049742 Bacteria 2157
387 Ga0501081_0051429 3300049743 Bacteria 2842
388 Ga0501083_0005567 3300049744 Bacteria 8932
389 nmdc:mga05p37_131319_c1 3300050507 Bacteria 3073
390 nmdc:mga05p37_256215_c1 3300050507 Bacteria 2097
391 nmdc:mga09592_116088_c1 3300050508 Bacteria 2297
392 nmdc:mga09592_396912_c1 3300050508 Bacteria 1192
393 nmdc:mga0qj67_41453_c1 3300050509 Bacteria 3621
394 nmdc:mga06r32_425530_c1 3300050510 Bacteria 1309
395 nmdc:mga08y16_279785_c1 3300050511 Bacteria 1721
396 nmdc:mga0n895_54409_c1 3300050512 Bacteria 3937
397 nmdc:mga0rr50_190815_c1 3300050513 Bacteria 1679
398 nmdc:mga08x19_82522_c1 3300050514 Bacteria 2112
399 nmdc:mga0a205_816_c1 3300050515 Bacteria 25359
400 nmdc:mga0a205_89152_c1 3300050515 Bacteria 2982
401 Ga0495601_0082561 3300053077 Bacteria 2063
402 Ga0495601_0236437 3300053077 Bacteria 1193
403 Ga0495612_0036298 3300053078 Bacteria 2000
404 Ga0495595_0072760 3300053084 Bacteria 1627
405 Ga0495595_0109850 3300053084 Bacteria 1336
406 Ga0495619_0008308 3300053085 Bacteria 6566
407 Ga0495619_0064844 3300053085 Bacteria 2436
408 Ga0495619_0078328 3300053085 Bacteria 2222
409 Ga0495619_0089260 3300053085 Bacteria 2085
410 Ga0495619_0101749 3300053085 Bacteria 1956
411 Ga0495619_0225583 3300053085 Bacteria 1298
412 Ga0501082_0057342 3300060353 Bacteria 3356
413 Ga0501082_0480036 3300060353 Bacteria 1087
414 Ga0466962_0009088 3300061719 Bacteria 4760
415 Ga0466962_0067466 3300061719 Bacteria 1708
416 Ga0530510_0250808 3300061734 Bacteria 1319
417 Ga0495629_0086518
418 Ga0070683_100022285
419 Ga0070683_100221345
420 Ga0070690_100111686
421 Ga0070666_10223741
422 Ga0070682_100028832
423 Ga0068868_100090464
424 Ga0068868_100133290
425 Ga0070660_100031826
426 Ga0070691_10030925
427 Ga0070661_100031679
428 Ga0070674_100070512
429 Ga0070709_10026111
430 Ga0070709_10065237
431 Ga0070714_100074326
432 Ga0070710_10023301
433 Ga0070701_10018414
434 Ga0070711_100044907
435 Ga0070705_100014772
436 Ga0070700_100070605
437 Ga0070708_100136017
438 Ga0070708_100202002
439 Ga0070663_100154945
440 Ga0070678_100065063
441 Ga0070681_10010437
442 Ga0070681_10036636
443 Ga0068867_100130263
444 Ga0070685_10051803
445 Ga0070706_100150963
446 Ga0070707_100067435
447 Ga0070679_100046029
448 Ga0070679_100052389
449 Ga0070684_100081101
450 Ga0070684_100422394
451 Ga0070697_100125619
452 Ga0070672_100199257
453 Ga0070686_100089204
454 Ga0070696_100131876
455 Ga0068855_100071114
456 Ga0068857_100241637
457 Ga0068854_100078539
458 Ga0068856_100088801
459 Ga0068864_100366425
460 Ga0068861_100261485
461 Ga0068860_100094624
462 Ga0068862_100181978
463 Ga0081455_10016625
464 Ga0081455_10084474
465 Ga0081540_1015388
466 Ga0081540_1031163
467 Ga0081539_10001726
468 Ga0081539_10080345
469 Ga0075432_10039742
470 Ga0070715_10010812
471 Ga0070716_100132948
472 Ga0070712_100013489
473 Ga0075428_100104256
474 Ga0075431_100047905
475 Ga0075431_100066021
476 Ga0075431_100077111
477 Ga0075434_100032740
478 Ga0075429_100101731
479 Ga0075436_100039396
480 Ga0075436_100039729
481 Ga0075435_100053400
482 Ga0075435_100117924
483 Ga0105240_10143555
484 Ga0111539_10031773
485 Ga0111539_10032436
486 Ga0105245_10048614
487 Ga0105245_10124437
488 Ga0114129_10161734
489 Ga0114129_10245861
490 Ga0105243_10052626
491 Ga0105243_10120000
492 Ga0105242_10139755
493 Ga0105248_10100227
494 Ga0105238_10036271
495 Ga0105249_10259326
496 Ga0099796_10032024
497 Ga0105239_10032860
498 Ga0105239_10991809
499 Ga0157342_1004618
500 Ga0157373_10111631
501 Ga0157369_10087326
502 Ga0157369_10126317
503 Ga0157369_10286351
504 Ga0157372_10038386
505 Ga0163163_10193052
506 Ga0163163_10384630
507 Ga0182008_10090456
508 Ga0157376_10127334
509 Ga0163161_10163933
510 Ga0213871_10038818
511 Ga0224712_10127179
512 Ga0207692_10008973
513 Ga0207642_10031368
514 Ga0207680_10091400
515 Ga0207685_10004018
516 Ga0207699_10391318
517 Ga0207705_10033710
518 Ga0207654_10048316
519 Ga0207693_10000967
520 Ga0207693_10348201
521 Ga0207657_10002021
522 Ga0207657_10193133
523 Ga0207646_10021457
524 Ga0207687_10216577
525 Ga0207700_10124572
526 Ga0207664_10012433
527 Ga0207664_10024829
528 Ga0207664_10096728
529 Ga0207690_10026224
530 Ga0207690_10111312
531 Ga0207706_10013951
532 Ga0207709_10127796
533 Ga0207704_10019186
534 Ga0207704_10257368
535 Ga0207665_10012011
536 Ga0207691_10092695
537 Ga0207661_10044205
538 Ga0207661_10172629
539 Ga0207679_10304399
540 Ga0207678_10177689
541 Ga0207708_10055840
542 Ga0207702_10112244
543 Ga0207702_10171921
544 Ga0207674_10261657
545 Ga0207675_100393072
546 Ga0207683_10020597
547 Ga0207428_10017316
548 Ga0265319_1026881
549 Ga0265334_10027709
550 Ga0265322_10023948
551 Ga0265336_10001383
552 Ga0265338_10019940
553 Ga0265338_10053686
554 Ga0265338_10109269
555 Ga0265330_10017773
556 Ga0265339_10067791
557 Ga0265316_10013349
558 Ga0265313_10021943
559 Ga0265314_10025460
560 Ga0265314_10041111
561 Ga0265342_10097791
562 Ga0307416_100108302
563 Ga0307415_100032454
564 Ga0373929_0018917
565 Ga0373944_0014021
566 Ga0373951_0008735
567 Ga0373952_0036548
568 Ga0373939_0010662
569 Ga0373939_0025714
570 Ga0373941_0033576
571 Ga0373943_0000170
572 Ga0373943_0003310
573 Ga0373946_0004561
574 Ga0373946_0023100
575 Ga0373942_0016381
576 Ga0373924_0094280
577 Ga0373947_0000199
578 Ga0373925_0001020
579 Ga0373925_0004699
580 Ga0395899_0100554
581 Ga0395899_0112770
582 Ga0395899_0141558
583 Ga0395899_0203827
584 Ga0395899_0302422
585 Ga0395899_0493720
586 Ga0395900_0084467
587 Ga0395900_0174978
588 Ga0395900_0191252
589 Ga0395900_0289718
590 Ga0395900_0704621
591 Ga0395898_0002272
592 Ga0395898_0029787
593 Ga0395898_0046916
594 Ga0395898_0051208
595 Ga0395898_0091897
596 Ga0395898_0242711
597 Ga0395898_0307854
598 Ga0395898_0316627
599 Ga0395898_0596364
600 Ga0395905_0071593
601 Ga0395905_0101084
602 Ga0395905_0128393
603 Ga0395905_0129504
604 Ga0395905_0139478
605 Ga0395905_0247594
606 Ga0395905_0263506
607 Ga0395905_0453616
608 Ga0395901_0027753
609 Ga0395901_0108630
610 Ga0395901_0216978
611 Ga0395901_0813501
612 Ga0436360_0699854
613 Ga0436360_1160248
614 Ga0451853_2474626
615 Ga0439448_0009816
616 Ga0439463_059982
617 Ga0466972_0112698
618 Ga0466965_0161114
619 Ga0466966_0196191
620 Ga0466961_0002250
621 Ga0466963_0001500
622 Ga0466963_0001932
623 Ga0466963_0030697
624 Ga0466963_0064103
625 Ga0466963_0074827
626 Ga0466964_0014579
627 Ga0466964_0121591
628 Ga0466971_0006573
629 Ga0466971_0052033
630 Ga0466957_0039862
631 Ga0466960_0006051
632 Ga0466959_0036070
633 Ga0451576_0020596
634 Ga0451576_0148164
635 Ga0466958_0001139
636 Ga0466958_0041415
637 Ga0466958_0167160
638 Ga0466967_0000073
639 Ga0466967_0004285
640 Ga0466967_0006670
641 Ga0466967_0016258
642 Ga0466967_0016818
643 Ga0466967_0113918
644 Ga0466967_0138195
645 Ga0466967_0193074
646 Ga0466967_0295943
647 Ga0466967_0306547
648 Ga0466967_0332619
649 Ga0466967_0392627
650 Ga0495592_0034538
651 Ga0495592_0087056
652 Ga0495603_0001635
653 Ga0495603_0053243
654 Ga0495603_0104066
655 Ga0495629_0003815
656 Ga0495641_0002085
657 Ga0495641_0003920
658 Ga0495641_0016335
659 Ga0495651_0050521
660 Ga0495653_0099023
661 Ga0495580_0161985
662 Ga0495582_0000028
663 Ga0495582_0029883
664 Ga0495582_0081766
665 Ga0495582_0167783
666 Ga0495662_0079760
667 Ga0495662_0195048
668 Ga0495664_0047738
669 Ga0495664_0100171
670 Ga0495594_0002688
671 Ga0495608_0012290
672 Ga0495608_0041827
673 Ga0495628_0203111
674 Ga0495630_0012251
675 Ga0495630_0018384
676 Ga0495630_0136538
677 Ga0495630_0166735
678 Ga0495637_0059691
679 Ga0495652_0200779
680 Ga0495665_0142385
681 Ga0495640_0196958
682 Ga0495586_0001920
683 Ga0495586_0125139
684 Ga0495586_0179365
685 Ga0495587_0037880
686 Ga0495645_0089761
687 Ga0495667_0023229
688 Ga0495667_0187976
689 Ga0495656_0111183
690 Ga0495634_0048222
691 Ga0495659_0052666
692 Ga0495588_0000326
693 Ga0495657_0010740
694 Ga0495657_0149879
695 Ga0495623_0252486
696 Ga0495646_0075510
697 Ga0495647_0125679
698 Ga0495658_0000277
699 Ga0495658_0075683
700 Ga0495658_0253714
701 Ga0495613_0011009
702 Ga0495613_0029350
703 Ga0495613_0142876
704 Ga0495613_0395639
705 Ga0495624_0184767
706 Ga0495589_0137108
707 Ga0495600_0033446
708 Ga0495604_0033022
709 Ga0495604_0043710
710 Ga0495604_0051355
711 Ga0495604_0056158
712 Ga0495636_0048390
713 Ga0495674_0017492
714 Ga0495674_0019935
715 Ga0495674_0054283
716 Ga0495676_0013155
717 Ga0495676_0224609
718 Ga0495680_0024682
719 Ga0495680_0048300
720 Ga0495680_0076608
721 Ga0495680_0181798
722 Ga0495680_0187290
723 Ga0495680_0293076
724 Ga0495675_0162835
725 Ga0495684_0012403
726 Ga0495684_0097690
727 Ga0495593_0011912
728 Ga0496100_0040353
729 Ga0496100_0050639
730 Ga0496100_0069594
731 Ga0496100_0186858
732 Ga0496101_0026293
733 Ga0496101_0032401
734 Ga0496101_0042496
735 Ga0496101_0054172
736 Ga0496101_0214400
737 Ga0496102_0007026
738 Ga0496103_0022860
739 Ga0496103_0246294
740 Ga0496104_0039552
741 Ga0496104_0040648
742 Ga0496104_0043034
743 Ga0496104_0111173
744 Ga0496104_0122860
745 Ga0496104_0166284
746 Ga0496104_0514439
747 Ga0496105_0003731
748 Ga0496105_0009510
749 Ga0496105_0013664
750 Ga0496105_0044137
751 Ga0496105_0053982
752 Ga0496105_0130522
753 Ga0496105_0144597
754 Ga0496106_0452993
755 Ga0496106_0498059
756 Ga0496107_0035231
757 Ga0496107_0082681
758 Ga0496107_0091824
759 Ga0496107_0120794
760 Ga0496108_0044717
761 Ga0496108_0068166
762 Ga0496108_0097896
763 Ga0496108_0249106
764 Ga0496109_0058908
765 Ga0496109_0475738
766 Ga0496110_0032930
767 Ga0496110_0045018
768 Ga0496110_0055581
769 Ga0496111_0003935
770 Ga0496111_0028445
771 Ga0496111_0081403
772 Ga0496112_0040633
773 Ga0496112_0062203
774 Ga0496112_0095302
775 Ga0496112_0625361
776 Ga0496113_0022935
777 Ga0496114_0007266
778 Ga0496114_0052668
779 Ga0496114_0100514
780 Ga0496114_0290929
781 Ga0496114_0319021
782 Ga0496115_0001740
783 Ga0496115_0024863
784 Ga0496115_0025768
785 Ga0496115_0029904
786 Ga0496115_0066611
787 Ga0496115_0370818
788 Ga0496115_0420894
789 Ga0501034_0041834
790 Ga0501047_0027063
791 Ga0501067_0021138
792 Ga0501069_0024134
793 Ga0501069_0046931
794 Ga0501070_0277567
795 Ga0501072_0011504
796 Ga0501073_0015817
797 Ga0501074_0026947
798 Ga0501074_0036639
799 Ga0501077_0092689
800 Ga0501079_0409064
801 Ga0501080_0074840
802 Ga0501080_0149792
803 Ga0501081_0051429
804 Ga0501083_0005567
805 nmdc:mga05p37_131319_c1
806 nmdc:mga05p37_256215_c1
807 nmdc:mga09592_116088_c1
808 nmdc:mga09592_396912_c1
809 nmdc:mga0qj67_41453_c1
810 nmdc:mga06r32_425530_c1
811 nmdc:mga08y16_279785_c1
812 nmdc:mga0n895_54409_c1
813 nmdc:mga0rr50_190815_c1
814 nmdc:mga08x19_82522_c1
815 nmdc:mga0a205_816_c1
816 nmdc:mga0a205_89152_c1
817 Ga0495601_0082561
818 Ga0495601_0236437
819 Ga0495612_0036298
820 Ga0495595_0072760
821 Ga0495595_0109850
822 Ga0495619_0008308
823 Ga0495619_0064844
824 Ga0495619_0078328
825 Ga0495619_0089260
826 Ga0495619_0101749
827 Ga0495619_0225583
828 Ga0501082_0057342
829 Ga0501082_0480036
830 Ga0466962_0009088
831 Ga0466962_0067466
832 Ga0530510_0250808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01790

LGT

Prolipoprotein diacylglyceryl transferase

13

294

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.7541 10 266
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.6875 10 266
7bqn-assembly1.cif.gz_A solution nmr structure of fold-c rei; de novo designed protein with an asymmetric all-alpha topology 0.4083 28 149
8wmy-assembly1.cif.gz_B-2 crystal structure of yqek in complex with mg and adp. 0.3728 23 264
2ogi-assembly1.cif.gz_A crystal structure of a putative metal dependent phosphohydrolase (sag1661) from streptococcus agalactiae serogroup v at 1.85 a resolution 0.3683 31 265
ID Description Score Start End Superfamily
af_Q5ALY0_226_333_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.4185 196 264 1.10.472.10
af_Q551C5_1189_1387_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4168 26 148 1.20.1640.10
2ogiA00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.4144 31 265 1.10.3210.10
af_O01735_368_566_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3881 29 267 1.20.1250.20
af_P38687_7_219_1.10.3450.40 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;Signal recognition particle, SRP68 subunit, RNA-binding domain 0.3873 120 266 1.10.3450.40
ID Description Score Start End GO Terms
AF-A0A538KJN9-F1-model_v4 Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-) 0.9408 7 266 GO:0005886
GO:0008961
GO:0042158
AF-A0A5B8U747-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9359 29 266 GO:0005886
GO:0008961
GO:0042158
AF-A0A2E4KGD5-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.926 8 266 GO:0005886
GO:0008961
GO:0042158
AF-A0A2E4ADP8-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9217 8 266 GO:0005886
GO:0008961
GO:0042158
AF-A0A538KJN9-F1-model_v4 Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-) 0.9165 7 266 GO:0005886
GO:0008961
GO:0042158

Map