F438864

General Info

Members Datasets Scaffolds Average Seq Length
416 274 410 146

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0000260|Ga0439436_0000260_8943_9470
Length 175
Sequence MDFMPLQTKCLTAYFATGRKNAPTEKSLLPMNDPFDLQRFVDAQDAVIDRVRDELRGGRKRSHWMWFVFPQLAGLGRSEMARRYAIASLDEARAYLAHPLLGPRLRECSTLVLAVQGRTIGKIFGAPDDLKFWSSMTLFLQADPSQAVFRDCLYKYFDGRSDLGTLSLIESGHGG

Samples

Sample ID Description Type Environment
1 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
2 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
176 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
177 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
178 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
181 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
182 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
183 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
184 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
185 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
186 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
187 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
188 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
189 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
190 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
191 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
253 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
266 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
267 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
268 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
269 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
270 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
271 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.24
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.29
Nodule 0
Rhizoplane 3.12
Rhizosphere 87.98
Stem 0
Stem Tuber 0
Unclassified 3.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055530_10000516 3300003791 Bacteria 33586
2 Ga0070676_10430337 3300005328 Bacteria 924
3 Ga0070683_100395467 3300005329 Bacteria 1318
4 Ga0070683_101906061 3300005329 Bacteria 571
5 Ga0068869_100137496 3300005334 Bacteria 1884
6 Ga0070666_10036016 3300005335 Bacteria 3282
7 Ga0070680_100000499 3300005336 Bacteria 26967
8 Ga0068868_100021151 3300005338 Bacteria 4899
9 Ga0068868_100277038 3300005338 Bacteria 1419
10 Ga0070660_100183210 3300005339 Bacteria 1695
11 Ga0070661_100473122 3300005344 Bacteria 999
12 Ga0070692_10362625 3300005345 Bacteria 904
13 Ga0070668_101815274 3300005347 Bacteria 561
14 Ga0070669_100970743 3300005353 Bacteria 728
15 Ga0070671_100224643 3300005355 Bacteria 1593
16 Ga0070674_101024707 3300005356 Bacteria 725
17 Ga0070673_100048352 3300005364 Bacteria 3315
18 Ga0070673_100857881 3300005364 Bacteria 840
19 Ga0070688_100123440 3300005365 Bacteria 1738
20 Ga0070659_100740381 3300005366 Bacteria 852
21 Ga0070703_10029387 3300005406 Bacteria 1649
22 Ga0070709_10002513 3300005434 Bacteria 9930
23 Ga0070709_10214352 3300005434 Bacteria 1370
24 Ga0070709_11054206 3300005434 Bacteria 649
25 Ga0070714_100003750 3300005435 Bacteria 11395
26 Ga0070714_100035351 3300005435 Bacteria 4187
27 Ga0070714_100451645 3300005435 Bacteria 1221
28 Ga0070714_102253113 3300005435 Bacteria 530
29 Ga0070713_100008067 3300005436 Bacteria 7442
30 Ga0070713_100031714 3300005436 Bacteria 4212
31 Ga0070710_10008639 3300005437 Bacteria 4962
32 Ga0070711_100006819 3300005439 Bacteria 6916
33 Ga0070711_100014074 3300005439 Bacteria 5034
34 Ga0070711_100046170 3300005439 Bacteria 2966
35 Ga0070705_100009387 3300005440 Bacteria 4863
36 Ga0070694_100418287 3300005444 Bacteria 1052
37 Ga0070708_101391586 3300005445 Bacteria 654
38 Ga0070663_100307921 3300005455 Bacteria 1270
39 Ga0070663_100328342 3300005455 Bacteria 1232
40 Ga0070678_100045804 3300005456 Bacteria 3131
41 Ga0070681_10065790 3300005458 Bacteria 3594
42 Ga0068867_100156330 3300005459 Bacteria 1795
43 Ga0070706_100094889 3300005467 Bacteria 2768
44 Ga0070698_100000001 3300005471 Bacteria 142099
45 Ga0070698_100576967 3300005471 Bacteria 1065
46 Ga0070679_100000001 3300005530 Bacteria 764811
47 Ga0070684_100522763 3300005535 Bacteria 1100
48 Ga0070697_100406049 3300005536 Bacteria 1182
49 Ga0068853_100083785 3300005539 Bacteria 2794
50 Ga0070695_100056036 3300005545 Bacteria 2542
51 Ga0070695_101010014 3300005545 Bacteria 677
52 Ga0070665_100028206 3300005548 Bacteria 5653
53 Ga0070665_100072804 3300005548 Bacteria 3443
54 Ga0070665_100672691 3300005548 Bacteria 1048
55 Ga0070704_101113619 3300005549 Bacteria 717
56 Ga0068855_100020954 3300005563 Bacteria 7839
57 Ga0070664_100063430 3300005564 Bacteria 3150
58 Ga0068857_100003878 3300005577 Bacteria 12590
59 Ga0068857_100017002 3300005577 Bacteria 6372
60 Ga0068857_100017148 3300005577 Bacteria 6344
61 Ga0068857_100225930 3300005577 Bacteria 1711
62 Ga0068856_100027629 3300005614 Bacteria 5535
63 Ga0068856_100051735 3300005614 Bacteria 4049
64 Ga0068852_100148946 3300005616 Bacteria 2174
65 Ga0068859_100012386 3300005617 Bacteria 8580
66 Ga0068859_100038962 3300005617 Bacteria 4767
67 Ga0068859_100632000 3300005617 Bacteria 1163
68 Ga0068866_10082999 3300005718 Bacteria 1726
69 Ga0068861_100360171 3300005719 Bacteria 1279
70 Ga0068863_100020969 3300005841 Bacteria 6241
71 Ga0068863_100150649 3300005841 Bacteria 2225
72 Ga0068863_100402889 3300005841 Unclassified 1338
73 Ga0068863_100431202 3300005841 Bacteria 1292
74 Ga0068858_100012594 3300005842 Bacteria 7971
75 Ga0068858_100242250 3300005842 Bacteria 1711
76 Ga0068860_100213652 3300005843 Bacteria 1871
77 Ga0068860_100233590 3300005843 Bacteria 1787
78 Ga0068860_100629995 3300005843 Bacteria 1079
79 Ga0068862_100051921 3300005844 Bacteria 3507
80 Ga0070717_10108736 3300006028 Bacteria 2363
81 Ga0075364_10187197 3300006051 Bacteria 1402
82 Ga0070715_10000643 3300006163 Bacteria 9298
83 Ga0070715_10001754 3300006163 Bacteria 6446
84 Ga0070716_100431104 3300006173 Bacteria 956
85 Ga0070712_100000297 3300006175 Bacteria 27954
86 Ga0070712_100057708 3300006175 Bacteria 2728
87 Ga0070712_100616726 3300006175 Bacteria 919
88 Ga0070712_101169812 3300006175 Bacteria 669
89 Ga0075362_10042493 3300006177 Bacteria 2009
90 Ga0075366_10160441 3300006195 Bacteria 1362
91 Ga0097621_100372416 3300006237 Bacteria 1274
92 Ga0097621_100378090 3300006237 Bacteria 1265
93 Ga0097621_101242220 3300006237 Bacteria 702
94 Ga0075370_10030536 3300006353 Bacteria 3007
95 Ga0068871_100191383 3300006358 Bacteria 1762
96 Ga0075433_10016296 3300006852 Bacteria 6118
97 Ga0075434_100073669 3300006871 Bacteria 3407
98 Ga0075434_100529686 3300006871 Bacteria 1198
99 Ga0075436_100820478 3300006914 Bacteria 693
100 Ga0097620_100012385 3300006931 Bacteria 8580
101 Ga0097620_100038962 3300006931 Bacteria 4767
102 Ga0097620_100631950 3300006931 Bacteria 1163
103 Ga0075435_100050964 3300007076 Bacteria 3333
104 Ga0075435_100655610 3300007076 Bacteria 911
105 Ga0099795_10341892 3300007788 Unclassified 667
106 Ga0105240_10000582 3300009093 Bacteria 67645
107 Ga0105240_10424495 3300009093 Unclassified 1493
108 Ga0105240_11797922 3300009093 Bacteria 639
109 Ga0111539_12553117 3300009094 Bacteria 592
110 Ga0105245_10013619 3300009098 Bacteria 7083
111 Ga0105245_10571294 3300009098 Bacteria 1154
112 Ga0105247_10341567 3300009101 Bacteria 1050
113 Ga0105247_10348077 3300009101 Bacteria 1041
114 Ga0105243_10170622 3300009148 Bacteria 1884
115 Ga0105243_11686817 3300009148 Bacteria 662
116 Ga0105241_10037489 3300009174 Bacteria 3653
117 Ga0105241_10137950 3300009174 Bacteria 1982
118 Ga0105241_10340163 3300009174 Bacteria 1300
119 Ga0105248_10204716 3300009177 Bacteria 2224
120 Ga0105248_10223304 3300009177 Bacteria 2121
121 Ga0105248_10295682 3300009177 Bacteria 1823
122 Ga0105248_10905599 3300009177 Bacteria 996
123 Ga0105248_12477858 3300009177 Bacteria 591
124 Ga0105237_10047018 3300009545 Bacteria 4339
125 Ga0105237_11774574 3300009545 Bacteria 625
126 Ga0105238_10154721 3300009551 Bacteria 2268
127 Ga0105249_10092014 3300009553 Bacteria 2839
128 Ga0105249_11353372 3300009553 Bacteria 784
129 Ga0105239_10086058 3300010375 Bacteria 3464
130 Ga0105239_10165550 3300010375 Bacteria 2472
131 Ga0105239_11847508 3300010375 Bacteria 700
132 Ga0105246_10070769 3300011119 Bacteria 2454
133 Ga0105246_10680944 3300011119 Bacteria 899
134 Ga0157371_10213379 3300013102 Bacteria 1385
135 Ga0157369_10002775 3300013105 Bacteria 20913
136 Ga0157369_10019140 3300013105 Bacteria 7663
137 Ga0157369_10129395 3300013105 Bacteria 2676
138 Ga0157374_10158163 3300013296 Bacteria 2206
139 Ga0157374_10177338 3300013296 Bacteria 2080
140 Ga0157374_10501415 3300013296 Bacteria 1218
141 Ga0157374_12379198 3300013296 Unclassified 557
142 Ga0157378_10792590 3300013297 Bacteria 973
143 Ga0163162_10027367 3300013306 Bacteria 5638
144 Ga0163162_10295359 3300013306 Bacteria 1752
145 Ga0157375_10805194 3300013308 Bacteria 1088
146 Ga0157375_13180651 3300013308 Bacteria 548
147 Ga0163163_10149944 3300014325 Bacteria 2376
148 Ga0163163_10206163 3300014325 Bacteria 2014
149 Ga0182008_10052588 3300014497 Bacteria 2018
150 Ga0157377_10187364 3300014745 Bacteria 1305
151 Ga0157379_10001081 3300014968 Bacteria 22242
152 Ga0157379_10031362 3300014968 Bacteria 4734
153 Ga0157376_10157960 3300014969 Bacteria 2052
154 Ga0157376_10788074 3300014969 Bacteria 962
155 Ga0157376_11531545 3300014969 Bacteria 700
156 Ga0183362_10001 3300015683 Bacteria 2046624
157 Ga0163161_10021230 3300017792 Bacteria 4565
158 Ga0213876_10003905 3300021384 Bacteria 8428
159 Ga0213876_10050322 3300021384 Bacteria 2201
160 Ga0213876_10080334 3300021384 Bacteria 1724
161 Ga0213875_10039543 3300021388 Bacteria 2222
162 Ga0209675_1012822 3300025291 Bacteria 2672
163 Ga0209025_1006121 3300025294 Bacteria 9488
164 Ga0209564_1000456 3300025295 Bacteria 69075
165 Ga0209758_1000308 3300025297 Bacteria 94851
166 Ga0209050_1000655 3300025298 Bacteria 53550
167 Ga0209256_1005259 3300025299 Bacteria 7556
168 Ga0207653_10002583 3300025885 Bacteria 5750
169 Ga0207692_10000839 3300025898 Bacteria 11022
170 Ga0207710_10183245 3300025900 Bacteria 1028
171 Ga0207710_10352488 3300025900 Bacteria 750
172 Ga0207688_10049640 3300025901 Bacteria 2346
173 Ga0207685_10003449 3300025905 Bacteria 3847
174 Ga0207685_10022019 3300025905 Bacteria 2146
175 Ga0207705_10388200 3300025909 Bacteria 1079
176 Ga0207684_10335840 3300025910 Bacteria 1301
177 Ga0207654_10018584 3300025911 Bacteria 3650
178 Ga0207654_10134332 3300025911 Bacteria 1570
179 Ga0207707_10085189 3300025912 Bacteria 2761
180 Ga0207695_10000004 3300025913 Bacteria 1288665
181 Ga0207671_10299576 3300025914 Bacteria 1270
182 Ga0207671_11519183 3300025914 Bacteria 517
183 Ga0207693_10000349 3300025915 Bacteria 42666
184 Ga0207693_10001213 3300025915 Bacteria 22999
185 Ga0207693_10544023 3300025915 Bacteria 906
186 Ga0207693_10827225 3300025915 Bacteria 713
187 Ga0207663_10000219 3300025916 Bacteria 25504
188 Ga0207663_10011176 3300025916 Bacteria 4811
189 Ga0207663_10191685 3300025916 Bacteria 1468
190 Ga0207660_10001527 3300025917 Bacteria 15521
191 Ga0207657_10400828 3300025919 Bacteria 1079
192 Ga0207652_10000002 3300025921 Bacteria 878035
193 Ga0207681_10244353 3300025923 Bacteria 1398
194 Ga0207694_10000015 3300025924 Bacteria 363898
195 Ga0207694_10103396 3300025924 Bacteria 2259
196 Ga0207687_10061259 3300025927 Bacteria 2657
197 Ga0207700_10021157 3300025928 Bacteria 4435
198 Ga0207700_10051885 3300025928 Bacteria 3064
199 Ga0207664_10035505 3300025929 Bacteria 3847
200 Ga0207664_10157764 3300025929 Bacteria 1933
201 Ga0207644_10121008 3300025931 Bacteria 1992
202 Ga0207644_10250861 3300025931 Bacteria 1412
203 Ga0207704_11395157 3300025938 Bacteria 600
204 Ga0207665_10007855 3300025939 Bacteria 7045
205 Ga0207665_10498655 3300025939 Bacteria 940
206 Ga0207691_10063731 3300025940 Bacteria 3342
207 Ga0207711_10053933 3300025941 Bacteria 3449
208 Ga0207711_10123400 3300025941 Bacteria 2315
209 Ga0207661_10057695 3300025944 Bacteria 3123
210 Ga0207667_10000226 3300025949 Bacteria 79075
211 Ga0207667_11107593 3300025949 Bacteria 775
212 Ga0207651_10207229 3300025960 Bacteria 1576
213 Ga0207677_10045436 3300026023 Bacteria 2933
214 Ga0207703_10292946 3300026035 Bacteria 1482
215 Ga0207703_10396122 3300026035 Bacteria 1280
216 Ga0207639_11194514 3300026041 Bacteria 714
217 Ga0207678_10590966 3300026067 Bacteria 973
218 Ga0207702_10169693 3300026078 Bacteria 2000
219 Ga0207641_10218039 3300026088 Bacteria 1768
220 Ga0207641_10418096 3300026088 Bacteria 1290
221 Ga0207648_10197602 3300026089 Bacteria 1783
222 Ga0207648_10430614 3300026089 Bacteria 1199
223 Ga0207674_10002704 3300026116 Bacteria 22129
224 Ga0207674_10003653 3300026116 Bacteria 18761
225 Ga0207674_10093502 3300026116 Bacteria 2995
226 Ga0207675_100389789 3300026118 Bacteria 1371
227 Ga0207683_10098595 3300026121 Bacteria 2607
228 Ga0207683_12092785 3300026121 Bacteria 514
229 Ga0207698_10262905 3300026142 Bacteria 1586
230 Ga0207698_10443511 3300026142 Bacteria 1251
231 Ga0268266_10027587 3300028379 Bacteria 4827
232 Ga0268266_10143901 3300028379 Bacteria 2142
233 Ga0268266_10899687 3300028379 Bacteria 856
234 Ga0268265_10013738 3300028380 Bacteria 5509
235 Ga0268265_10088314 3300028380 Bacteria 2469
236 Ga0268264_10009057 3300028381 Bacteria 8260
237 Ga0268264_10467502 3300028381 Bacteria 1225
238 Ga0265318_10026714 3300028577 Bacteria 2272
239 Ga0307515_10000195 3300028794 Bacteria 148138
240 Ga0265330_10043078 3300031235 Bacteria 1998
241 Ga0265325_10001851 3300031241 Bacteria 14616
242 Ga0265340_10375508 3300031247 Bacteria 627
243 Ga0265339_10003286 3300031249 Bacteria 11320
244 Ga0265339_10044297 3300031249 Bacteria 2455
245 Ga0265316_10400256 3300031344 Bacteria 989
246 Ga0307513_10053037 3300031456 Bacteria 4362
247 Ga0307408_100000199 3300031548 Bacteria 65275
248 Ga0307408_100031295 3300031548 Bacteria 3704
249 Ga0307408_100174839 3300031548 Bacteria 1717
250 Ga0307408_100373908 3300031548 Bacteria 1216
251 Ga0265314_10000144 3300031711 Bacteria 107465
252 Ga0307516_10032353 3300031730 Bacteria 5268
253 Ga0307410_10120394 3300031852 Bacteria 1913
254 Ga0307407_10284619 3300031903 Bacteria 1146
255 Ga0307411_10219081 3300032005 Bacteria 1475
256 Ga0307411_10359941 3300032005 Bacteria 1189
257 Ga0373934_0110439 3300035086 Bacteria 1115
258 Ga0373941_0410199 3300035115 Bacteria 562
259 Ga0373955_0250341 3300035172 Bacteria 1062
260 Ga0373962_0104024 3300035242 Bacteria 889
261 Ga0373935_0145010 3300035692 Bacteria 1607
262 Ga0373935_0260541 3300035692 Bacteria 1216
263 Ga0373933_0429171 3300035724 Bacteria 864
264 Ga0373937_0011187 3300036401 Bacteria 7866
265 Ga0373937_0709986 3300036401 Bacteria 952
266 Ga0373937_0974356 3300036401 Bacteria 797
267 Ga0373925_0186740 3300037068 Bacteria 1643
268 Ga0395899_0002200 3300037312 Bacteria 15986
269 Ga0395899_0141971 3300037312 Bacteria 1708
270 Ga0395899_0305579 3300037312 Bacteria 1075
271 Ga0395900_0022196 3300037418 Bacteria 6493
272 Ga0395900_0085963 3300037418 Bacteria 3232
273 Ga0395900_0118405 3300037418 Bacteria 2718
274 Ga0395905_0085279 3300037471 Bacteria 2960
275 Ga0395905_0329856 3300037471 Bacteria 1416
276 Ga0436364_0271209 3300037853 Bacteria 17136
277 Ga0395901_0003101 3300038443 Bacteria 16714
278 Ga0395901_0190512 3300038443 Bacteria 2151
279 Ga0395901_0356371 3300038443 Bacteria 1509
280 Ga0436365_0278456 3300039437 Bacteria 1708
281 Ga0436365_0405532 3300039437 Bacteria 6166
282 Ga0436365_0438840 3300039437 Bacteria 2374
283 Ga0436365_0792738 3300039437 Bacteria 3855
284 Ga0436365_1715419 3300039437 Bacteria 532
285 Ga0436361_0096607 3300039447 Bacteria 4888
286 Ga0436361_0721106 3300039447 Bacteria 908
287 Ga0439436_0000260 3300041404 Bacteria 12706
288 Ga0439439_0016266 3300041406 Bacteria 1820
289 Ga0439439_0050961 3300041406 Bacteria 1085
290 Ga0439447_017035 3300041407 Bacteria 1984
291 Ga0439447_031818 3300041407 Bacteria 1322
292 Ga0439466_0000855 3300041411 Bacteria 11622
293 Ga0439465_0002578 3300041413 Bacteria 5908
294 Ga0439433_0000430 3300041999 Bacteria 7657
295 Ga0439442_027692 3300042002 Bacteria 1181
296 Ga0439442_093347 3300042002 Bacteria 648
297 Ga0439445_0003533 3300042004 Bacteria 3506
298 Ga0439432_001804 3300042006 Bacteria 8030
299 Ga0439432_137725 3300042006 Bacteria 718
300 Ga0439449_0000810 3300042007 Bacteria 12045
301 Ga0439449_0004544 3300042007 Bacteria 5361
302 Ga0439449_0048188 3300042007 Bacteria 1577
303 Ga0439452_003529 3300042010 Bacteria 5460
304 Ga0439457_006811 3300042014 Bacteria 2770
305 Ga0439462_0001576 3300042015 Bacteria 5115
306 Ga0439462_0002548 3300042015 Bacteria 4247
307 Ga0450923_091751 3300042125 Bacteria 693
308 Ga0450897_023953 3300042128 Bacteria 667
309 Ga0439446_0002102 3300042156 Bacteria 4731
310 Ga0450908_015111 3300042184 Bacteria 1384
311 Ga0439434_0001306 3300042435 Bacteria 7179
312 Ga0466972_0029268 3300044658 Bacteria 2712
313 Ga0466963_0341975 3300044694 Bacteria 1053
314 Ga0466963_0429260 3300044694 Bacteria 932
315 Ga0466971_0049019 3300044719 Bacteria 1900
316 Ga0466957_0247399 3300044842 Bacteria 1185
317 Ga0466960_0113907 3300044901 Bacteria 1408
318 Ga0466958_0116615 3300045836 Bacteria 1669
319 Ga0466967_0302091 3300045976 Bacteria 1540
320 Ga0495592_0149273 3300046454 Bacteria 1618
321 Ga0495638_0121752 3300046460 Bacteria 1541
322 Ga0495651_0124982 3300046462 Bacteria 1885
323 Ga0495653_0730787 3300046463 Bacteria 599
324 Ga0495580_0324881 3300046472 Bacteria 1045
325 Ga0495664_0015339 3300046477 Bacteria 4355
326 Ga0495607_0001943 3300046501 Bacteria 17467
327 Ga0495583_0015035 3300046506 Bacteria 4232
328 Ga0495606_0001038 3300046507 Bacteria 40221
329 Ga0495606_0539905 3300046507 Bacteria 582
330 Ga0495648_0200284 3300046524 Bacteria 1000
331 Ga0495642_0025238 3300046528 Bacteria 2355
332 Ga0495652_0113670 3300046529 Bacteria 2173
333 Ga0495586_0493869 3300046535 Bacteria 706
334 Ga0495598_0079832 3300046537 Bacteria 1047
335 Ga0495645_0010332 3300046543 Bacteria 6543
336 Ga0495645_0447435 3300046543 Unclassified 815
337 Ga0495667_0315562 3300046559 Bacteria 989
338 Ga0495656_0000447 3300046615 Bacteria 13485
339 Ga0495634_0676076 3300046642 Bacteria 595
340 Ga0495588_0000492 3300046674 Bacteria 19394
341 Ga0495657_0449229 3300046675 Unclassified 755
342 Ga0495599_0125682 3300046678 Bacteria 1594
343 Ga0495599_0223677 3300046678 Bacteria 1151
344 Ga0495599_0561319 3300046678 Bacteria 668
345 Ga0495624_0270341 3300046690 Bacteria 1027
346 Ga0495670_0035061 3300046691 Bacteria 2500
347 Ga0495670_0158438 3300046691 Bacteria 1189
348 Ga0495670_0342469 3300046691 Bacteria 804
349 Ga0495671_0327003 3300046692 Bacteria 736
350 Ga0495600_0146373 3300046809 Bacteria 1531
351 Ga0495581_0197818 3300047315 Bacteria 1176
352 Ga0495604_0737127 3300047317 Bacteria 624
353 Ga0495636_0049877 3300047318 Bacteria 1751
354 Ga0495674_0027833 3300047319 Bacteria 5162
355 Ga0495674_0397605 3300047319 Bacteria 1113
356 Ga0495672_0256110 3300047320 Bacteria 847
357 Ga0495673_0001049 3300047469 Bacteria 24312
358 Ga0495684_0670788 3300047471 Bacteria 691
359 Ga0495686_0000248 3300047472 Bacteria 97017
360 Ga0495686_0008226 3300047472 Bacteria 7689
361 Ga0495686_0496906 3300047472 Bacteria 643
362 Ga0495602_0621564 3300048088 Bacteria 741
363 Ga0495615_0139426 3300048090 Bacteria 714
364 Ga0496101_0091700 3300048904 Bacteria 2261
365 Ga0496104_0531849 3300048907 Bacteria 1086
366 Ga0496104_0734533 3300048907 Unclassified 894
367 Ga0496106_0399827 3300048909 Bacteria 1104
368 Ga0496107_0591303 3300048910 Bacteria 821
369 Ga0496108_0002328 3300048911 Bacteria 15215
370 Ga0496109_0092325 3300048912 Bacteria 2800
371 Ga0496109_0379742 3300048912 Bacteria 1335
372 Ga0496110_0045907 3300048913 Bacteria 3820
373 Ga0496110_1524264 3300048913 Bacteria 578
374 Ga0496112_0119370 3300048915 Bacteria 2607
375 Ga0496112_0122548 3300048915 Bacteria 2570
376 Ga0496114_0033341 3300048917 Bacteria 4243
377 Ga0496125_0585847 3300048928 Bacteria 612
378 Ga0495682_0000834 3300049460 Bacteria 19318
379 Ga0495682_0134062 3300049460 Bacteria 885
380 Ga0501036_1378063 3300049572 Bacteria 572
381 Ga0501037_0344531 3300049573 Unclassified 1029
382 Ga0501047_0222164 3300049581 Bacteria 1745
383 Ga0501068_1110966 3300049584 Bacteria 523
384 Ga0501070_0375004 3300049586 Bacteria 1153
385 Ga0501075_0785723 3300049591 Bacteria 725
386 Ga0501206_005175 3300049653 Bacteria 1676
387 Ga0501257_045482 3300049686 Bacteria 1086
388 Ga0501079_1046778 3300049741 Bacteria 643
389 Ga0501080_0672506 3300049742 Bacteria 915
390 Ga0501265_024118 3300049762 Bacteria 840
391 Ga0501044_0017995 3300049823 Bacteria 7577
392 Ga0501044_0419510 3300049823 Bacteria 1248
393 nmdc:mga03683_4544_c1 3300050489 Bacteria 4618
394 nmdc:mga03n38_243058_c1 3300050490 Bacteria 948
395 nmdc:mga07m45_23466_c1 3300050496 Bacteria 3373
396 nmdc:mga0n895_191901_c1 3300050512 Bacteria 2074
397 nmdc:mga0n895_651666_c1 3300050512 Bacteria 1052
398 nmdc:mga0rr50_42756_c1 3300050513 Bacteria 3311
399 nmdc:mga0a205_3851_c2 3300050515 Bacteria 10890
400 Ga0495601_0479732 3300053077 Bacteria 803
401 Ga0500643_011679 3300053087 Bacteria 3188
402 Ga0500595_025677 3300053119 Bacteria 2039
403 Ga0500655_001116 3300053133 Bacteria 5126
404 Ga0500655_008462 3300053133 Bacteria 1851
405 Ga0500658_0360181 3300053134 Bacteria 667
406 Ga0500559_0000801 3300053136 Bacteria 20557
407 Ga0500573_0032860 3300053140 Bacteria 2993
408 Ga0500627_0289318 3300053158 Bacteria 717
409 Ga0501084_0000074 3300054114 Bacteria 72522
410 Ga0587070_089481 3300059491 Bacteria 690

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025941 Ga0207711_10123400 Ga0207711_101234005 123
2 3300046678 Ga0495599_0561319 Ga0495599_0561319_252_650 129
3 3300005347 Ga0070668_101815274 Ga0070668_1018152741 132
4 3300046454 Ga0495592_0149273 Ga0495592_0149273_922_1344 134
5 3300046462 Ga0495651_0124982 Ga0495651_0124982_1211_1633 134
6 3300046477 Ga0495664_0015339 Ga0495664_0015339_653_1075 134
7 3300046529 Ga0495652_0113670 Ga0495652_0113670_1484_1906 134
8 3300046543 Ga0495645_0010332 Ga0495645_0010332_1525_1947 134
9 3300046559 Ga0495667_0315562 Ga0495667_0315562_337_759 134
10 3300046678 Ga0495599_0125682 Ga0495599_0125682_85_507 134
11 3300047319 Ga0495674_0397605 Ga0495674_0397605_241_663 134
12 3300005366 Ga0070659_100740381 Ga0070659_1007403812 135
13 3300025297 Ga0209758_1000308 Ga0209758_100030831 135
14 3300005329 Ga0070683_100395467 Ga0070683_1003954672 136
15 3300005329 Ga0070683_101906061 Ga0070683_1019060611 136
16 3300005334 Ga0068869_100137496 Ga0068869_1001374962 136
17 3300005335 Ga0070666_10036016 Ga0070666_100360162 136
18 3300005336 Ga0070680_100000499 Ga0070680_10000049911 136
19 3300005338 Ga0068868_100021151 Ga0068868_1000211515 136
20 3300005355 Ga0070671_100224643 Ga0070671_1002246432 136
21 3300005356 Ga0070674_101024707 Ga0070674_1010247071 136
22 3300005364 Ga0070673_100857881 Ga0070673_1008578812 136
23 3300005365 Ga0070688_100123440 Ga0070688_1001234402 136
24 3300005435 Ga0070714_102253113 Ga0070714_1022531131 136
25 3300005439 Ga0070711_100046170 Ga0070711_1000461701 136
26 3300005440 Ga0070705_100009387 Ga0070705_1000093873 136
27 3300005455 Ga0070663_100328342 Ga0070663_1003283422 136
28 3300005458 Ga0070681_10065790 Ga0070681_100657905 136
29 3300005459 Ga0068867_100156330 Ga0068867_1001563302 136
30 3300005471 Ga0070698_100000001 Ga0070698_10000000126 136
31 3300005530 Ga0070679_100000001 Ga0070679_100000001346 136
32 3300005535 Ga0070684_100522763 Ga0070684_1005227632 136
33 3300005539 Ga0068853_100083785 Ga0068853_1000837854 136
34 3300005548 Ga0070665_100028206 Ga0070665_1000282066 136
35 3300005548 Ga0070665_100072804 Ga0070665_1000728043 136
36 3300005614 Ga0068856_100027629 Ga0068856_1000276293 136
37 3300005617 Ga0068859_100632000 Ga0068859_1006320002 136
38 3300005718 Ga0068866_10082999 Ga0068866_100829993 136
39 3300005841 Ga0068863_100020969 Ga0068863_1000209696 136
40 3300005841 Ga0068863_100402889 Ga0068863_1004028891 136
41 3300005841 Ga0068863_100431202 Ga0068863_1004312022 136
42 3300005842 Ga0068858_100242250 Ga0068858_1002422503 136
43 3300005843 Ga0068860_100233590 Ga0068860_1002335901 136
44 3300005844 Ga0068862_100051921 Ga0068862_1000519215 136
45 3300006163 Ga0070715_10001754 Ga0070715_100017546 136
46 3300006175 Ga0070712_100057708 Ga0070712_1000577083 136
47 3300006175 Ga0070712_101169812 Ga0070712_1011698121 136
48 3300006237 Ga0097621_100378090 Ga0097621_1003780902 136
49 3300006237 Ga0097621_101242220 Ga0097621_1012422201 136
50 3300006358 Ga0068871_100191383 Ga0068871_1001913832 136
51 3300006914 Ga0075436_100820478 Ga0075436_1008204781 136
52 3300006931 Ga0097620_100631950 Ga0097620_1006319502 136
53 3300007076 Ga0075435_100655610 Ga0075435_1006556102 136
54 3300007788 Ga0099795_10341892 Ga0099795_103418921 136
55 3300009093 Ga0105240_10000582 Ga0105240_1000058234 136
56 3300009093 Ga0105240_10424495 Ga0105240_104244952 136
57 3300009098 Ga0105245_10013619 Ga0105245_100136192 136
58 3300009098 Ga0105245_10571294 Ga0105245_105712942 136
59 3300009101 Ga0105247_10341567 Ga0105247_103415672 136
60 3300009174 Ga0105241_10340163 Ga0105241_103401632 136
61 3300009177 Ga0105248_10204716 Ga0105248_102047161 136
62 3300009177 Ga0105248_10223304 Ga0105248_102233043 136
63 3300009177 Ga0105248_10295682 Ga0105248_102956822 136
64 3300009177 Ga0105248_12477858 Ga0105248_124778581 136
65 3300009545 Ga0105237_10047018 Ga0105237_100470185 136
66 3300010375 Ga0105239_10086058 Ga0105239_100860583 136
67 3300010375 Ga0105239_11847508 Ga0105239_118475081 136
68 3300013296 Ga0157374_10158163 Ga0157374_101581633 136
69 3300013296 Ga0157374_10177338 Ga0157374_101773382 136
70 3300013296 Ga0157374_10501415 Ga0157374_105014152 136
71 3300013296 Ga0157374_12379198 Ga0157374_123791981 136
72 3300013297 Ga0157378_10792590 Ga0157378_107925902 136
73 3300013306 Ga0163162_10027367 Ga0163162_100273675 136
74 3300013308 Ga0157375_13180651 Ga0157375_131806511 136
75 3300014325 Ga0163163_10206163 Ga0163163_102061633 136
76 3300014968 Ga0157379_10031362 Ga0157379_100313623 136
77 3300014969 Ga0157376_10157960 Ga0157376_101579603 136
78 3300014969 Ga0157376_10788074 Ga0157376_107880742 136
79 3300021384 Ga0213876_10003905 Ga0213876_100039052 136
80 3300021384 Ga0213876_10050322 Ga0213876_100503222 136
81 3300021384 Ga0213876_10080334 Ga0213876_100803342 136
82 3300025294 Ga0209025_1006121 Ga0209025_10061212 136
83 3300025900 Ga0207710_10352488 Ga0207710_103524882 136
84 3300025905 Ga0207685_10022019 Ga0207685_100220193 136
85 3300025911 Ga0207654_10134332 Ga0207654_101343323 136
86 3300025912 Ga0207707_10085189 Ga0207707_100851892 136
87 3300025913 Ga0207695_10000004 Ga0207695_10000004136 136
88 3300025914 Ga0207671_10299576 Ga0207671_102995763 136
89 3300025915 Ga0207693_10001213 Ga0207693_100012138 136
90 3300025915 Ga0207693_10827225 Ga0207693_108272251 136
91 3300025916 Ga0207663_10191685 Ga0207663_101916852 136
92 3300025917 Ga0207660_10001527 Ga0207660_100015271 136
93 3300025921 Ga0207652_10000002 Ga0207652_10000002909 136
94 3300025927 Ga0207687_10061259 Ga0207687_100612592 136
95 3300025928 Ga0207700_10021157 Ga0207700_100211574 136
96 3300025929 Ga0207664_10157764 Ga0207664_101577642 136
97 3300025931 Ga0207644_10121008 Ga0207644_101210084 136
98 3300025931 Ga0207644_10250861 Ga0207644_102508613 136
99 3300025938 Ga0207704_11395157 Ga0207704_113951571 136
100 3300025939 Ga0207665_10007855 Ga0207665_100078551 136
101 3300025941 Ga0207711_10053933 Ga0207711_100539333 136
102 3300025944 Ga0207661_10057695 Ga0207661_100576956 136
103 3300025949 Ga0207667_11107593 Ga0207667_111075932 136
104 3300026023 Ga0207677_10045436 Ga0207677_100454364 136
105 3300026035 Ga0207703_10292946 Ga0207703_102929462 136
106 3300026041 Ga0207639_11194514 Ga0207639_111945142 136
107 3300026067 Ga0207678_10590966 Ga0207678_105909662 136
108 3300026088 Ga0207641_10218039 Ga0207641_102180393 136
109 3300026088 Ga0207641_10418096 Ga0207641_104180963 136
110 3300026089 Ga0207648_10430614 Ga0207648_104306142 136
111 3300026121 Ga0207683_12092785 Ga0207683_120927851 136
112 3300026142 Ga0207698_10262905 Ga0207698_102629051 136
113 3300028379 Ga0268266_10027587 Ga0268266_100275874 136
114 3300028379 Ga0268266_10143901 Ga0268266_101439012 136
115 3300028380 Ga0268265_10013738 Ga0268265_100137386 136
116 3300031235 Ga0265330_10043078 Ga0265330_100430782 136
117 3300031711 Ga0265314_10000144 Ga0265314_1000014411 136
118 3300031852 Ga0307410_10120394 Ga0307410_101203942 136
119 3300031903 Ga0307407_10284619 Ga0307407_102846192 136
120 3300032005 Ga0307411_10359941 Ga0307411_103599411 136
121 3300036401 Ga0373937_0974356 Ga0373937_0974356_165_602 136
122 3300038443 Ga0395901_0003101 Ga0395901_0003101_13270_13698 136
123 3300039437 Ga0436365_0405532 Ga0436365_0405532_1550_1972 136
124 3300039437 Ga0436365_0438840 Ga0436365_0438840_1300_1728 136
125 3300039437 Ga0436365_0792738 Ga0436365_0792738_314_748 136
126 3300039437 Ga0436365_1715419 Ga0436365_1715419_52_498 136
127 3300044694 Ga0466963_0341975 Ga0466963_0341975_374_796 136
128 3300044719 Ga0466971_0049019 Ga0466971_0049019_528_956 136
129 3300044842 Ga0466957_0247399 Ga0466957_0247399_291_722 136
130 3300045836 Ga0466958_0116615 Ga0466958_0116615_796_1218 136
131 3300046460 Ga0495638_0121752 Ga0495638_0121752_549_998 136
132 3300046472 Ga0495580_0324881 Ga0495580_0324881_565_999 136
133 3300046501 Ga0495607_0001943 Ga0495607_0001943_11548_11973 136
134 3300046506 Ga0495583_0015035 Ga0495583_0015035_616_1065 136
135 3300046507 Ga0495606_0001038 Ga0495606_0001038_20938_21375 136
136 3300046507 Ga0495606_0539905 Ga0495606_0539905_122_571 136
137 3300046524 Ga0495648_0200284 Ga0495648_0200284_31_471 136
138 3300046543 Ga0495645_0447435 Ga0495645_0447435_207_638 136
139 3300046642 Ga0495634_0676076 Ga0495634_0676076_116_550 136
140 3300046675 Ga0495657_0449229 Ga0495657_0449229_250_681 136
141 3300046678 Ga0495599_0223677 Ga0495599_0223677_406_837 136
142 3300046692 Ga0495671_0327003 Ga0495671_0327003_204_644 136
143 3300046809 Ga0495600_0146373 Ga0495600_0146373_739_1170 136
144 3300047319 Ga0495674_0027833 Ga0495674_0027833_1728_2159 136
145 3300047320 Ga0495672_0256110 Ga0495672_0256110_359_808 136
146 3300047469 Ga0495673_0001049 Ga0495673_0001049_21374_21799 136
147 3300047472 Ga0495686_0000248 Ga0495686_0000248_43936_44364 136
148 3300047472 Ga0495686_0008226 Ga0495686_0008226_2836_3273 136
149 3300047472 Ga0495686_0496906 Ga0495686_0496906_54_494 136
150 3300048904 Ga0496101_0091700 Ga0496101_0091700_932_1366 136
151 3300048907 Ga0496104_0531849 Ga0496104_0531849_107_541 136
152 3300048907 Ga0496104_0734533 Ga0496104_0734533_41_472 136
153 3300048911 Ga0496108_0002328 Ga0496108_0002328_2126_2560 136
154 3300048912 Ga0496109_0092325 Ga0496109_0092325_1340_1774 136
155 3300048913 Ga0496110_0045907 Ga0496110_0045907_927_1361 136
156 3300048915 Ga0496112_0119370 Ga0496112_0119370_1278_1712 136
157 3300048917 Ga0496114_0033341 Ga0496114_0033341_3191_3622 136
158 3300048928 Ga0496125_0585847 Ga0496125_0585847_147_575 136
159 3300049460 Ga0495682_0134062 Ga0495682_0134062_238_687 136
160 3300049572 Ga0501036_1378063 Ga0501036_1378063_114_539 136
161 3300049581 Ga0501047_0222164 Ga0501047_0222164_1265_1693 136
162 3300049584 Ga0501068_1110966 Ga0501068_1110966_31_456 136
163 3300049591 Ga0501075_0785723 Ga0501075_0785723_183_611 136
164 3300049653 Ga0501206_005175 Ga0501206_005175_669_1091 136
165 3300049686 Ga0501257_045482 Ga0501257_045482_181_603 136
166 3300049741 Ga0501079_1046778 Ga0501079_1046778_29_454 136
167 3300049762 Ga0501265_024118 Ga0501265_024118_18_440 136
168 3300049823 Ga0501044_0017995 Ga0501044_0017995_2903_3328 136
169 3300050512 nmdc:mga0n895_651666_c1 nmdc:mga0n895_651666_c1_15_437 136
170 3300053077 Ga0495601_0479732 Ga0495601_0479732_295_729 136
171 3300053119 Ga0500595_025677 Ga0500595_025677_438_887 136
172 3300053134 Ga0500658_0360181 Ga0500658_0360181_85_510 136
173 3300053136 Ga0500559_0000801 Ga0500559_0000801_4249_4683 136
174 3300053140 Ga0500573_0032860 Ga0500573_0032860_2269_2703 136
175 3300054114 Ga0501084_0000074 Ga0501084_0000074_39121_39552 136
176 iso_pu_bacteria 2881101125 2881103808 136
177 3300005328 Ga0070676_10430337 Ga0070676_104303372 137
178 3300005338 Ga0068868_100277038 Ga0068868_1002770382 137
179 3300005364 Ga0070673_100048352 Ga0070673_1000483523 137
180 3300005434 Ga0070709_11054206 Ga0070709_110542061 137
181 3300005435 Ga0070714_100451645 Ga0070714_1004516452 137
182 3300005439 Ga0070711_100014074 Ga0070711_1000140742 137
183 3300005455 Ga0070663_100307921 Ga0070663_1003079212 137
184 3300005456 Ga0070678_100045804 Ga0070678_1000458043 137
185 3300005545 Ga0070695_101010014 Ga0070695_1010100141 137
186 3300005577 Ga0068857_100017002 Ga0068857_1000170022 137
187 3300005577 Ga0068857_100017148 Ga0068857_1000171489 137
188 3300005614 Ga0068856_100051735 Ga0068856_1000517355 137
189 3300005617 Ga0068859_100012386 Ga0068859_1000123862 137
190 3300005841 Ga0068863_100150649 Ga0068863_1001506494 137
191 3300005842 Ga0068858_100012594 Ga0068858_1000125941 137
192 3300005843 Ga0068860_100213652 Ga0068860_1002136524 137
193 3300005843 Ga0068860_100629995 Ga0068860_1006299952 137
194 3300006175 Ga0070712_100000297 Ga0070712_1000002974 137
195 3300006237 Ga0097621_100372416 Ga0097621_1003724162 137
196 3300006852 Ga0075433_10016296 Ga0075433_100162967 137
197 3300006871 Ga0075434_100529686 Ga0075434_1005296862 137
198 3300006931 Ga0097620_100012385 Ga0097620_1000123852 137
199 3300009094 Ga0111539_12553117 Ga0111539_125531171 137
200 3300009101 Ga0105247_10348077 Ga0105247_103480772 137
201 3300009148 Ga0105243_10170622 Ga0105243_101706222 137
202 3300009174 Ga0105241_10037489 Ga0105241_100374894 137
203 3300009553 Ga0105249_10092014 Ga0105249_100920144 137
204 3300011119 Ga0105246_10070769 Ga0105246_100707694 137
205 3300013102 Ga0157371_10213379 Ga0157371_102133792 137
206 3300013105 Ga0157369_10129395 Ga0157369_101293951 137
207 3300013306 Ga0163162_10295359 Ga0163162_102953594 137
208 3300013308 Ga0157375_10805194 Ga0157375_108051942 137
209 3300014745 Ga0157377_10187364 Ga0157377_101873642 137
210 3300014968 Ga0157379_10001081 Ga0157379_1000108114 137
211 3300017792 Ga0163161_10021230 Ga0163161_100212304 137
212 3300025900 Ga0207710_10183245 Ga0207710_101832451 137
213 3300025901 Ga0207688_10049640 Ga0207688_100496404 137
214 3300025909 Ga0207705_10388200 Ga0207705_103882002 137
215 3300025911 Ga0207654_10018584 Ga0207654_100185844 137
216 3300025915 Ga0207693_10000349 Ga0207693_1000034930 137
217 3300025916 Ga0207663_10011176 Ga0207663_100111763 137
218 3300025923 Ga0207681_10244353 Ga0207681_102443532 137
219 3300025940 Ga0207691_10063731 Ga0207691_100637314 137
220 3300026035 Ga0207703_10396122 Ga0207703_103961221 137
221 3300026078 Ga0207702_10169693 Ga0207702_101696934 137
222 3300026116 Ga0207674_10003653 Ga0207674_1000365322 137
223 3300026116 Ga0207674_10093502 Ga0207674_100935024 137
224 3300026121 Ga0207683_10098595 Ga0207683_100985953 137
225 3300028380 Ga0268265_10088314 Ga0268265_100883144 137
226 3300028381 Ga0268264_10009057 Ga0268264_100090574 137
227 3300028381 Ga0268264_10467502 Ga0268264_104675022 137
228 3300035086 Ga0373934_0110439 Ga0373934_0110439_500_928 137
229 3300035115 Ga0373941_0410199 Ga0373941_0410199_67_501 137
230 3300035172 Ga0373955_0250341 Ga0373955_0250341_243_671 137
231 3300035242 Ga0373962_0104024 Ga0373962_0104024_25_456 137
232 3300035692 Ga0373935_0145010 Ga0373935_0145010_308_736 137
233 3300036401 Ga0373937_0709986 Ga0373937_0709986_228_656 137
234 3300037312 Ga0395899_0141971 Ga0395899_0141971_265_693 137
235 3300037418 Ga0395900_0085963 Ga0395900_0085963_517_945 137
236 3300037418 Ga0395900_0118405 Ga0395900_0118405_2031_2468 137
237 3300037471 Ga0395905_0085279 Ga0395905_0085279_1550_1987 137
238 3300038443 Ga0395901_0190512 Ga0395901_0190512_497_934 137
239 3300044658 Ga0466972_0029268 Ga0466972_0029268_848_1279 137
240 3300046537 Ga0495598_0079832 Ga0495598_0079832_41_463 137
241 3300046615 Ga0495656_0000447 Ga0495656_0000447_580_1002 137
242 3300047317 Ga0495604_0737127 Ga0495604_0737127_21_449 137
243 3300048088 Ga0495602_0621564 Ga0495602_0621564_159_587 137
244 3300048090 Ga0495615_0139426 Ga0495615_0139426_118_540 137
245 3300050515 nmdc:mga0a205_3851_c2 nmdc:mga0a205_3851_c2_9834_10265 137
246 3300005434 Ga0070709_10214352 Ga0070709_102143522 138
247 3300005548 Ga0070665_100672691 Ga0070665_1006726912 138
248 3300021388 Ga0213875_10039543 Ga0213875_100395432 138
249 3300028379 Ga0268266_10899687 Ga0268266_108996872 138
250 3300031249 Ga0265339_10044297 Ga0265339_100442973 138
251 3300031344 Ga0265316_10400256 Ga0265316_104002563 138
252 3300037853 Ga0436364_0271209 Ga0436364_0271209_15363_15797 138
253 3300039437 Ga0436365_0278456 Ga0436365_0278456_277_711 138
254 3300039447 Ga0436361_0721106 Ga0436361_0721106_298_735 138
255 3300048909 Ga0496106_0399827 Ga0496106_0399827_27_461 138
256 3300048912 Ga0496109_0379742 Ga0496109_0379742_377_817 138
257 3300048913 Ga0496110_1524264 Ga0496110_1524264_109_543 138
258 3300048915 Ga0496112_0122548 Ga0496112_0122548_844_1278 138
259 3300053158 Ga0500627_0289318 Ga0500627_0289318_61_507 138
260 3300005434 Ga0070709_10002513 Ga0070709_100025136 139
261 3300005435 Ga0070714_100003750 Ga0070714_1000037503 139
262 3300005436 Ga0070713_100008067 Ga0070713_1000080672 139
263 3300005437 Ga0070710_10008639 Ga0070710_100086396 139
264 3300005439 Ga0070711_100006819 Ga0070711_1000068192 139
265 3300005617 Ga0068859_100038962 Ga0068859_1000389624 139
266 3300006028 Ga0070717_10108736 Ga0070717_101087362 139
267 3300006051 Ga0075364_10187197 Ga0075364_101871972 139
268 3300006163 Ga0070715_10000643 Ga0070715_1000064310 139
269 3300006175 Ga0070712_100616726 Ga0070712_1006167262 139
270 3300006871 Ga0075434_100073669 Ga0075434_1000736692 139
271 3300006931 Ga0097620_100038962 Ga0097620_1000389624 139
272 3300007076 Ga0075435_100050964 Ga0075435_1000509645 139
273 3300009093 Ga0105240_10000582 Ga0105240_1000058240 139
274 3300009177 Ga0105248_10905599 Ga0105248_109055992 139
275 3300014325 Ga0163163_10149944 Ga0163163_101499444 139
276 3300025898 Ga0207692_10000839 Ga0207692_100008391 139
277 3300025905 Ga0207685_10003449 Ga0207685_100034492 139
278 3300025913 Ga0207695_10000004 Ga0207695_10000004143 139
279 3300025916 Ga0207663_10000219 Ga0207663_100002195 139
280 3300025929 Ga0207664_10035505 Ga0207664_100355052 139
281 3300037312 Ga0395899_0002200 Ga0395899_0002200_5502_5930 139
282 3300037312 Ga0395899_0305579 Ga0395899_0305579_161_589 139
283 3300037418 Ga0395900_0022196 Ga0395900_0022196_2865_3293 139
284 3300037471 Ga0395905_0329856 Ga0395905_0329856_906_1334 139
285 3300038443 Ga0395901_0356371 Ga0395901_0356371_877_1305 139
286 3300042125 Ga0450923_091751 Ga0450923_091751_112_540 139
287 3300044694 Ga0466963_0429260 Ga0466963_0429260_421_888 139
288 3300045976 Ga0466967_0302091 Ga0466967_0302091_127_594 139
289 3300046535 Ga0495586_0493869 Ga0495586_0493869_58_492 139
290 3300046691 Ga0495670_0342469 Ga0495670_0342469_147_578 139
291 3300047471 Ga0495684_0670788 Ga0495684_0670788_142_570 139
292 3300050512 nmdc:mga0n895_191901_c1 nmdc:mga0n895_191901_c1_882_1316 139
293 3300050513 nmdc:mga0rr50_42756_c1 nmdc:mga0rr50_42756_c1_946_1380 139
294 3300059491 Ga0587070_089481 Ga0587070_089481_132_560 139
295 3300005344 Ga0070661_100473122 Ga0070661_1004731222 140
296 3300005435 Ga0070714_100035351 Ga0070714_1000353514 140
297 3300005436 Ga0070713_100031714 Ga0070713_1000317142 140
298 3300005616 Ga0068852_100148946 Ga0068852_1001489462 140
299 3300006173 Ga0070716_100431104 Ga0070716_1004311042 140
300 3300009093 Ga0105240_11797922 Ga0105240_117979221 140
301 3300009174 Ga0105241_10137950 Ga0105241_101379504 140
302 3300009545 Ga0105237_11774574 Ga0105237_117745741 140
303 3300009551 Ga0105238_10154721 Ga0105238_101547212 140
304 3300010375 Ga0105239_10165550 Ga0105239_101655502 140
305 3300013105 Ga0157369_10002775 Ga0157369_100027758 140
306 3300013105 Ga0157369_10019140 Ga0157369_100191403 140
307 3300014969 Ga0157376_11531545 Ga0157376_115315452 140
308 3300025914 Ga0207671_11519183 Ga0207671_115191831 140
309 3300025915 Ga0207693_10544023 Ga0207693_105440232 140
310 3300025924 Ga0207694_10000015 Ga0207694_10000015227 140
311 3300025924 Ga0207694_10103396 Ga0207694_101033963 140
312 3300025928 Ga0207700_10051885 Ga0207700_100518852 140
313 3300025939 Ga0207665_10498655 Ga0207665_104986551 140
314 3300031241 Ga0265325_10001851 Ga0265325_1000185113 140
315 3300031247 Ga0265340_10375508 Ga0265340_103755081 140
316 3300031249 Ga0265339_10003286 Ga0265339_100032869 140
317 3300031730 Ga0307516_10032353 Ga0307516_100323532 140
318 3300035692 Ga0373935_0260541 Ga0373935_0260541_335_772 140
319 3300035724 Ga0373933_0429171 Ga0373933_0429171_30_467 140
320 3300036401 Ga0373937_0011187 Ga0373937_0011187_5796_6233 140
321 3300037068 Ga0373925_0186740 Ga0373925_0186740_112_549 140
322 3300039447 Ga0436361_0096607 Ga0436361_0096607_3754_4194 140
323 3300046463 Ga0495653_0730787 Ga0495653_0730787_149_580 140
324 3300046528 Ga0495642_0025238 Ga0495642_0025238_1489_1926 140
325 3300046674 Ga0495588_0000492 Ga0495588_0000492_14115_14552 140
326 3300046690 Ga0495624_0270341 Ga0495624_0270341_403_834 140
327 3300046691 Ga0495670_0035061 Ga0495670_0035061_1300_1737 140
328 3300046691 Ga0495670_0158438 Ga0495670_0158438_606_1043 140
329 3300047315 Ga0495581_0197818 Ga0495581_0197818_82_555 140
330 3300047318 Ga0495636_0049877 Ga0495636_0049877_68_505 140
331 3300048910 Ga0496107_0591303 Ga0496107_0591303_156_593 140
332 3300049460 Ga0495682_0000834 Ga0495682_0000834_14237_14677 140
333 3300053087 Ga0500643_011679 Ga0500643_011679_461_892 140
334 3300053133 Ga0500655_001116 Ga0500655_001116_1045_1485 140
335 iso_pu_bacteria 2885192300 2885197357 140
336 iso_pu_bacteria 8045864390 8045868021 140
337 3300003791 Ga0055530_10000516 Ga0055530_100005166 141
338 3300005339 Ga0070660_100183210 Ga0070660_1001832103 141
339 3300005345 Ga0070692_10362625 Ga0070692_103626252 141
340 3300005353 Ga0070669_100970743 Ga0070669_1009707432 141
341 3300005406 Ga0070703_10029387 Ga0070703_100293872 141
342 3300005444 Ga0070694_100418287 Ga0070694_1004182871 141
343 3300005445 Ga0070708_101391586 Ga0070708_1013915861 141
344 3300005467 Ga0070706_100094889 Ga0070706_1000948893 141
345 3300005471 Ga0070698_100576967 Ga0070698_1005769673 141
346 3300005536 Ga0070697_100406049 Ga0070697_1004060492 141
347 3300005545 Ga0070695_100056036 Ga0070695_1000560361 141
348 3300005549 Ga0070704_101113619 Ga0070704_1011136191 141
349 3300005563 Ga0068855_100020954 Ga0068855_1000209549 141
350 3300005564 Ga0070664_100063430 Ga0070664_1000634302 141
351 3300005577 Ga0068857_100003878 Ga0068857_1000038788 141
352 3300005577 Ga0068857_100225930 Ga0068857_1002259304 141
353 3300005719 Ga0068861_100360171 Ga0068861_1003601712 141
354 3300006177 Ga0075362_10042493 Ga0075362_100424933 141
355 3300006195 Ga0075366_10160441 Ga0075366_101604413 141
356 3300006353 Ga0075370_10030536 Ga0075370_100305362 141
357 3300009148 Ga0105243_11686817 Ga0105243_116868171 141
358 3300009553 Ga0105249_11353372 Ga0105249_113533722 141
359 3300011119 Ga0105246_10680944 Ga0105246_106809441 141
360 3300014497 Ga0182008_10052588 Ga0182008_100525882 141
361 3300015683 Ga0183362_10001 Ga0183362_10001672 141
362 3300025291 Ga0209675_1012822 Ga0209675_10128223 141
363 3300025295 Ga0209564_1000456 Ga0209564_100045620 141
364 3300025298 Ga0209050_1000655 Ga0209050_100065533 141
365 3300025299 Ga0209256_1005259 Ga0209256_10052596 141
366 3300025885 Ga0207653_10002583 Ga0207653_100025835 141
367 3300025910 Ga0207684_10335840 Ga0207684_103358401 141
368 3300025919 Ga0207657_10400828 Ga0207657_104008283 141
369 3300025924 Ga0207694_10000015 Ga0207694_10000015220 141
370 3300025949 Ga0207667_10000226 Ga0207667_1000022639 141
371 3300025960 Ga0207651_10207229 Ga0207651_102072292 141
372 3300026089 Ga0207648_10197602 Ga0207648_101976022 141
373 3300026116 Ga0207674_10002704 Ga0207674_100027049 141
374 3300026118 Ga0207675_100389789 Ga0207675_1003897892 141
375 3300026142 Ga0207698_10443511 Ga0207698_104435113 141
376 3300028577 Ga0265318_10026714 Ga0265318_100267143 141
377 3300028794 Ga0307515_10000195 Ga0307515_1000019536 141
378 3300031456 Ga0307513_10053037 Ga0307513_100530375 141
379 3300031548 Ga0307408_100000199 Ga0307408_10000019943 141
380 3300031548 Ga0307408_100031295 Ga0307408_1000312956 141
381 3300031548 Ga0307408_100174839 Ga0307408_1001748393 141
382 3300031548 Ga0307408_100373908 Ga0307408_1003739081 141
383 3300032005 Ga0307411_10219081 Ga0307411_102190812 141
384 3300041404 Ga0439436_0000260 Ga0439436_0000260_8943_9470 141
385 3300041406 Ga0439439_0016266 Ga0439439_0016266_1354_1791 141
386 3300041406 Ga0439439_0050961 Ga0439439_0050961_331_858 141
387 3300041407 Ga0439447_017035 Ga0439447_017035_872_1309 141
388 3300041407 Ga0439447_031818 Ga0439447_031818_692_1219 141
389 3300041411 Ga0439466_0000855 Ga0439466_0000855_3179_3706 141
390 3300041413 Ga0439465_0002578 Ga0439465_0002578_3635_4162 141
391 3300041999 Ga0439433_0000430 Ga0439433_0000430_4254_4781 141
392 3300042002 Ga0439442_027692 Ga0439442_027692_108_545 141
393 3300042002 Ga0439442_093347 Ga0439442_093347_140_577 141
394 3300042004 Ga0439445_0003533 Ga0439445_0003533_740_1267 141
395 3300042006 Ga0439432_001804 Ga0439432_001804_3952_4479 141
396 3300042006 Ga0439432_137725 Ga0439432_137725_217_654 141
397 3300042007 Ga0439449_0000810 Ga0439449_0000810_4436_4963 141
398 3300042007 Ga0439449_0004544 Ga0439449_0004544_50_487 141
399 3300042007 Ga0439449_0048188 Ga0439449_0048188_202_639 141
400 3300042010 Ga0439452_003529 Ga0439452_003529_1283_1810 141
401 3300042014 Ga0439457_006811 Ga0439457_006811_1500_1937 141
402 3300042015 Ga0439462_0001576 Ga0439462_0001576_942_1379 141
403 3300042015 Ga0439462_0002548 Ga0439462_0002548_1643_2170 141
404 3300042128 Ga0450897_023953 Ga0450897_023953_124_561 141
405 3300042156 Ga0439446_0002102 Ga0439446_0002102_1424_1951 141
406 3300042184 Ga0450908_015111 Ga0450908_015111_123_560 141
407 3300042435 Ga0439434_0001306 Ga0439434_0001306_5061_5588 141
408 3300044901 Ga0466960_0113907 Ga0466960_0113907_30_467 141
409 3300049573 Ga0501037_0344531 Ga0501037_0344531_273_725 141
410 3300049586 Ga0501070_0375004 Ga0501070_0375004_195_647 141
411 3300049742 Ga0501080_0672506 Ga0501080_0672506_93_545 141
412 3300049823 Ga0501044_0419510 Ga0501044_0419510_152_604 141
413 3300050489 nmdc:mga03683_4544_c1 nmdc:mga03683_4544_c1_3274_3711 141
414 3300050490 nmdc:mga03n38_243058_c1 nmdc:mga03n38_243058_c1_65_502 141
415 3300050496 nmdc:mga07m45_23466_c1 nmdc:mga07m45_23466_c1_437_874 141
416 3300053133 Ga0500655_008462 Ga0500655_008462_1244_1684 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08837

DUF1810

Protein of unknown function (DUF1810)

34

169

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.9937 4 137
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.9445 4 137
4dba-assembly2.cif.gz_D designed armadillo repeat protein (yiim3aii) 0.4278 2 120
2ix8-assembly1.cif.gz_A model for eef3 bound to an 80s ribosome 0.3578 4 120
4dba-assembly2.cif.gz_D designed armadillo repeat protein (yiim3aii) 0.3441 2 120
ID Description Score Start End Superfamily
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.9937 4 137 1.25.40.380
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.9445 4 137 1.25.40.380
af_Q54B61_245_442_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.516 6 122 1.25.10.10
af_Q8VE52_114_320_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4828 12 123 1.25.10.10
af_Q54B61_245_442_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4456 6 122 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A127Q1W3-F1-model_v4 Calpastatin 1.003 33 134
AF-A0A3M9XJW8-F1-model_v4 DUF1810 domain-containing protein 1.002 2 141
AF-A0A357EF10-F1-model_v4 DUF1810 domain-containing protein 1.002 1 139
AF-A0A849WR08-F1-model_v4 DUF1810 family protein 1.002 1 80
AF-A0A0P0RG68-F1-model_v4 Calpastatin 1.001 1 136

Feature Viewer

pLDDT pTM Quality
96.82 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map