F438861

General Info

Members Datasets Scaffolds Average Seq Length
416 222 832 240

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0899819|Ga0436364_0899819_247_1005
Length 252
Sequence MTVRIFLDEPAKSSTSAIVVASGPEGIVLDRTVFYARGGGQPGDTGTLRWEGGETVIVDTVKGEGEAILHLPRPDAMLPPPGSRLEASIDWDRRHALMRMHTAMHLLCSLIKGAFVTGGAVGVEKSRLDFDLPAPPQKEVIEAELNTLIAADHLVRIEWVDESVLDTDPGLVRTMSVQPPRGTGRLRLMRIGDGEPPIDLQPCGGTHVARTGEIGPMRILKIENKGKQNRRITIAPSALTQTKSAVRVRAPG

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
89 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
90 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
91 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
92 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
93 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
94 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
96 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
100 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
115 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
116 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
117 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
215 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
216 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
217 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
218 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
219 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
220 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
221 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
222 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.84
Metatranscriptomes 0.24
Isolates 1.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.49
Nodule 0
Rhizoplane 6.97
Rhizosphere 79.33
Stem 0
Stem Tuber 0
Unclassified 2.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0899819 3300037853 Bacteria 1634
2 JGI25151J46595_10000420 3300003187 Bacteria 42795
3 JGI25406J46586_10001142 3300003203 Bacteria 12470
4 JGI25407J50210_10000054 3300003373 Bacteria 13615
5 Ga0070683_100600215 3300005329 Bacteria 1053
6 Ga0070691_10040255 3300005341 Bacteria 2209
7 Ga0070687_100072652 3300005343 Bacteria 1852
8 Ga0070714_100066405 3300005435 Bacteria 3109
9 Ga0070708_100533454 3300005445 Unclassified 1107
10 Ga0070678_100091083 3300005456 Bacteria 2339
11 Ga0070681_10523810 3300005458 Bacteria 1099
12 Ga0070706_100081403 3300005467 Bacteria 2998
13 Ga0070698_100006244 3300005471 Bacteria 12963
14 Ga0070698_100514604 3300005471 Bacteria 1135
15 Ga0070699_100142024 3300005518 Bacteria 2121
16 Ga0070679_100058363 3300005530 Bacteria 3845
17 Ga0070679_100216834 3300005530 Bacteria 1876
18 Ga0070697_100105260 3300005536 Unclassified 2347
19 Ga0068853_100056202 3300005539 Bacteria 3393
20 Ga0068855_100293458 3300005563 Bacteria 1802
21 Ga0068854_100245589 3300005578 Bacteria 1427
22 Ga0068856_100161376 3300005614 Bacteria 2252
23 Ga0068856_100200167 3300005614 Bacteria 2011
24 Ga0068859_100039858 3300005617 Bacteria 4714
25 Ga0068863_100081172 3300005841 Bacteria 3072
26 Ga0068862_100357920 3300005844 Bacteria 1356
27 Ga0068862_101115971 3300005844 Bacteria 784
28 Ga0081455_10001025 3300005937 Bacteria 35218
29 Ga0081455_10001335 3300005937 Bacteria 30513
30 Ga0081455_10005666 3300005937 Bacteria 13627
31 Ga0081455_10052075 3300005937 Bacteria 3507
32 Ga0081455_10189981 3300005937 Bacteria 1547
33 Ga0081455_10208508 3300005937 Bacteria 1458
34 Ga0081538_10000054 3300005981 Bacteria 107029
35 Ga0081538_10002120 3300005981 Bacteria 19776
36 Ga0081538_10064589 3300005981 Bacteria 2069
37 Ga0081540_1000205 3300005983 Bacteria 61689
38 Ga0081539_10000076 3300005985 Bacteria 229037
39 Ga0081539_10005195 3300005985 Bacteria 13506
40 Ga0081539_10154158 3300005985 Bacteria 1102
41 Ga0075365_10008091 3300006038 Bacteria 5940
42 Ga0075365_10044780 3300006038 Bacteria 2901
43 Ga0075368_10106101 3300006042 Bacteria 1156
44 Ga0075363_100015231 3300006048 Bacteria 3776
45 Ga0075363_100056004 3300006048 Bacteria 2113
46 Ga0075364_10000822 3300006051 Bacteria 16378
47 Ga0075364_10249085 3300006051 Bacteria 1207
48 Ga0075364_10249651 3300006051 Bacteria 1206
49 Ga0075362_10020845 3300006177 Bacteria 2743
50 Ga0075367_10075170 3300006178 Bacteria 2037
51 Ga0075369_10026879 3300006186 Bacteria 2402
52 Ga0075428_100001045 3300006844 Bacteria 29392
53 Ga0075428_100093288 3300006844 Bacteria 3282
54 Ga0075428_100097841 3300006844 Bacteria 3199
55 Ga0075428_100116186 3300006844 Bacteria 2914
56 Ga0075428_100126888 3300006844 Bacteria 2776
57 Ga0075428_100227793 3300006844 Bacteria 2012
58 Ga0075428_100276295 3300006844 Bacteria 1807
59 Ga0075428_100543636 3300006844 Bacteria 1242
60 Ga0075430_100037003 3300006846 Bacteria 4137
61 Ga0075430_100134864 3300006846 Bacteria 2057
62 Ga0075431_100015981 3300006847 Bacteria 7615
63 Ga0075431_100035046 3300006847 Bacteria 5170
64 Ga0075431_100161825 3300006847 Bacteria 2301
65 Ga0075433_10518544 3300006852 Bacteria 1049
66 Ga0075434_100001172 3300006871 Bacteria 21715
67 Ga0075429_100000239 3300006880 Bacteria 37819
68 Ga0075429_100208373 3300006880 Bacteria 1713
69 Ga0075429_100598036 3300006880 Bacteria 966
70 Ga0097620_100039858 3300006931 Bacteria 4714
71 Ga0075435_100094682 3300007076 Bacteria 2469
72 Ga0111539_10005992 3300009094 Bacteria 15706
73 Ga0111539_10023675 3300009094 Bacteria 7545
74 Ga0111539_10045919 3300009094 Bacteria 5228
75 Ga0111539_10047774 3300009094 Bacteria 5114
76 Ga0111539_10509227 3300009094 Unclassified 1402
77 Ga0105245_10601944 3300009098 Bacteria 1126
78 Ga0105247_10278758 3300009101 Bacteria 1153
79 Ga0114129_10000630 3300009147 Bacteria 43905
80 Ga0114129_10000831 3300009147 Bacteria 39916
81 Ga0114129_10027750 3300009147 Bacteria 8016
82 Ga0114129_10051687 3300009147 Bacteria 5769
83 Ga0114129_10124335 3300009147 Bacteria 3548
84 Ga0114129_10156934 3300009147 Bacteria 3111
85 Ga0114129_10190311 3300009147 Bacteria 2787
86 Ga0114129_10237138 3300009147 Bacteria 2454
87 Ga0114129_10290759 3300009147 Bacteria 2181
88 Ga0114129_10366344 3300009147 Bacteria 1906
89 Ga0114129_10621216 3300009147 Bacteria 1398
90 Ga0114129_11342398 3300009147 Unclassified 884
91 Ga0105248_10142017 3300009177 Bacteria 2709
92 Ga0105248_10875808 3300009177 Unclassified 1014
93 Ga0105249_10039085 3300009553 Bacteria 4307
94 Ga0105033_101648 3300009986 Bacteria 1830
95 Ga0105239_10246014 3300010375 Bacteria 2008
96 Ga0105239_11049849 3300010375 Bacteria 937
97 Ga0157370_10348810 3300013104 Bacteria 1364
98 Ga0157374_10136017 3300013296 Bacteria 2382
99 Ga0157378_10292196 3300013297 Bacteria 1574
100 Ga0157375_10625820 3300013308 Bacteria 1234
101 Ga0163163_10197272 3300014325 Bacteria 2061
102 Ga0157380_10287136 3300014326 Bacteria 1509
103 Ga0157379_10231243 3300014968 Bacteria 1676
104 Ga0157379_10580455 3300014968 Bacteria 1045
105 Ga0157376_10673170 3300014969 Bacteria 1037
106 Ga0206353_10482508 3300020082 Bacteria 998
107 Ga0213876_10009161 3300021384 Bacteria 5331
108 Ga0213875_10006288 3300021388 Bacteria 6251
109 Ga0213875_10101362 3300021388 Unclassified 1344
110 Ga0213875_10111318 3300021388 Bacteria 1278
111 Ga0209130_1001791 3300025284 Bacteria 12616
112 Ga0209025_1000225 3300025294 Bacteria 133040
113 Ga0209758_1001483 3300025297 Bacteria 27429
114 Ga0207426_1000317 3300025302 Bacteria 94070
115 Ga0207692_10085806 3300025898 Bacteria 1695
116 Ga0207707_10398036 3300025912 Bacteria 1183
117 Ga0207693_10215266 3300025915 Bacteria 1510
118 Ga0207663_10175579 3300025916 Unclassified 1525
119 Ga0207652_10046407 3300025921 Bacteria 3707
120 Ga0207681_10024521 3300025923 Bacteria 3873
121 Ga0207687_10518056 3300025927 Bacteria 997
122 Ga0207700_10111495 3300025928 Bacteria 2202
123 Ga0207664_10069570 3300025929 Bacteria 2830
124 Ga0207711_10133196 3300025941 Bacteria 2230
125 Ga0207711_10730821 3300025941 Unclassified 923
126 Ga0207712_10032443 3300025961 Bacteria 3526
127 Ga0207668_10541698 3300025972 Bacteria 1007
128 Ga0207639_10095913 3300026041 Bacteria 2385
129 Ga0207702_10030478 3300026078 Bacteria 4496
130 Ga0207702_10798993 3300026078 Bacteria 932
131 Ga0207641_10112959 3300026088 Bacteria 2411
132 Ga0207641_10465375 3300026088 Bacteria 1224
133 Ga0207675_100350283 3300026118 Unclassified 1447
134 Ga0209813_10144710 3300027866 Bacteria 847
135 Ga0207428_10025807 3300027907 Bacteria 4913
136 Ga0207428_10182520 3300027907 Bacteria 1585
137 Ga0207428_10285037 3300027907 Bacteria 1225
138 Ga0207428_10584436 3300027907 Bacteria 806
139 Ga0268266_10115993 3300028379 Bacteria 2378
140 Ga0268265_10058831 3300028380 Bacteria 2937
141 Ga0268265_10413192 3300028380 Bacteria 1251
142 Ga0268264_10079936 3300028381 Bacteria 2791
143 Ga0268264_10470324 3300028381 Bacteria 1221
144 Ga0268264_10768369 3300028381 Bacteria 961
145 Ga0265338_10076050 3300028800 Bacteria 2846
146 Ga0373938_0007231 3300034957 Bacteria 1948
147 Ga0373938_0027820 3300034957 Bacteria 1192
148 Ga0373928_0072028 3300035084 Bacteria 856
149 Ga0373929_0011487 3300035085 Bacteria 1669
150 Ga0373934_0015754 3300035086 Bacteria 2870
151 Ga0373934_0174491 3300035086 Bacteria 883
152 Ga0373944_0023488 3300035089 Bacteria 1800
153 Ga0373949_0023825 3300035090 Bacteria 1420
154 Ga0373949_0026603 3300035090 Bacteria 1356
155 Ga0373923_0028133 3300035111 Bacteria 2247
156 Ga0373923_0034397 3300035111 Bacteria 2057
157 Ga0373939_0033335 3300035114 Bacteria 1503
158 Ga0373941_0005468 3300035115 Bacteria 2993
159 Ga0373953_0076303 3300035117 Bacteria 1388
160 Ga0373955_0009151 3300035172 Bacteria 4629
161 Ga0373955_0086148 3300035172 Bacteria 1784
162 Ga0373961_0043057 3300035241 Bacteria 1311
163 Ga0373924_0227041 3300035410 Bacteria 825
164 Ga0373931_0002529 3300035691 Bacteria 8119
165 Ga0373931_0004365 3300035691 Bacteria 6454
166 Ga0373935_0273711 3300035692 Bacteria 1187
167 Ga0373935_0346430 3300035692 Bacteria 1058
168 Ga0373927_0048693 3300035695 Bacteria 2742
169 Ga0373927_0299074 3300035695 Bacteria 1059
170 Ga0373927_0322620 3300035695 Bacteria 1017
171 Ga0373933_0014259 3300035724 Bacteria 4416
172 Ga0373933_0024567 3300035724 Bacteria 3450
173 Ga0373947_0030625 3300035725 Bacteria 3163
174 Ga0373947_0089254 3300035725 Bacteria 1920
175 Ga0373937_0002130 3300036401 Bacteria 16550
176 Ga0373937_0093789 3300036401 Bacteria 2783
177 Ga0373925_0198897 3300037068 Bacteria 1593
178 Ga0373925_0271550 3300037068 Archaea 1364
179 Ga0436364_0628477 3300037853 Bacteria 2325
180 Ga0436364_0714857 3300037853 Bacteria 42197
181 Ga0436364_0820255 3300037853 Bacteria 1568
182 Ga0436364_1104579 3300037853 Bacteria 29264
183 Ga0436364_1333680 3300037853 Bacteria 3120
184 Ga0436364_1554002 3300037853 Bacteria 3215
185 Ga0395901_0404957 3300038443 Bacteria 1401
186 Ga0400483_025289 3300039062 Bacteria 13121
187 Ga0400483_201271 3300039062 Bacteria 5792
188 Ga0400483_212361 3300039062 Bacteria 11280
189 Ga0400483_271849 3300039062 Bacteria 2413
190 Ga0400483_288343 3300039062 Bacteria 2172
191 Ga0436365_0849013 3300039437 Bacteria 3358
192 Ga0436365_1171205 3300039437 Bacteria 4986
193 Ga0436365_1228554 3300039437 Bacteria 1768
194 Ga0436365_1637878 3300039437 Bacteria 4209
195 Ga0436360_0736927 3300039438 Bacteria 1835
196 Ga0436360_1202660 3300039438 Bacteria 3180
197 Ga0436361_0991677 3300039447 Bacteria 2408
198 Ga0436363_0097684 3300039450 Bacteria 1412
199 Ga0439448_0016753 3300042005 Bacteria 2233
200 Ga0439450_035128 3300042008 Bacteria 1143
201 Ga0439463_037923 3300042016 Bacteria 1222
202 Ga0439464_0018596 3300042439 Bacteria 1891
203 Ga0466966_0030611 3300044684 Bacteria 3492
204 Ga0466961_0101956 3300044693 Bacteria 1808
205 Ga0466963_0599239 3300044694 Bacteria 778
206 Ga0466964_0163573 3300044706 Bacteria 1042
207 Ga0466960_0032708 3300044901 Bacteria 2411
208 Ga0466960_0111637 3300044901 Bacteria 1421
209 Ga0466959_0198317 3300045049 Bacteria 1398
210 Ga0466958_0116837 3300045836 Bacteria 1668
211 Ga0495592_0073341 3300046454 Bacteria 2489
212 Ga0495592_0175690 3300046454 Bacteria 1463
213 Ga0495651_0067412 3300046462 Bacteria 2730
214 Ga0495664_0001377 3300046477 Bacteria 12831
215 Ga0495664_0080859 3300046477 Bacteria 1948
216 Ga0495608_0007282 3300046511 Bacteria 7824
217 Ga0495608_0061029 3300046511 Bacteria 2480
218 Ga0495610_0019664 3300046512 Bacteria 3771
219 Ga0495618_0153350 3300046514 Bacteria 1471
220 Ga0495618_0210248 3300046514 Bacteria 1230
221 Ga0495628_0050735 3300046516 Bacteria 3282
222 Ga0495628_0277961 3300046516 Bacteria 1244
223 Ga0495643_0262154 3300046522 Bacteria 802
224 Ga0495643_0264789 3300046522 Bacteria 797
225 Ga0495640_0122550 3300046533 Bacteria 1688
226 Ga0495640_0329227 3300046533 Bacteria 945
227 Ga0495587_0001275 3300046536 Bacteria 16768
228 Ga0495645_0001882 3300046543 Bacteria 14271
229 Ga0495667_0007693 3300046559 Bacteria 7303
230 Ga0495667_0016101 3300046559 Bacteria 5054
231 Ga0495656_0111388 3300046615 Bacteria 1281
232 Ga0495625_0087288 3300046660 Bacteria 2163
233 Ga0495635_0038771 3300046663 Bacteria 3298
234 Ga0495635_0039242 3300046663 Bacteria 3276
235 Ga0495599_0008537 3300046678 Bacteria 6234
236 Ga0495623_0020618 3300046679 Bacteria 4260
237 Ga0495600_0351545 3300046809 Bacteria 923
238 Ga0495600_0484596 3300046809 Bacteria 762
239 Ga0495604_0116076 3300047317 Bacteria 1944
240 Ga0495604_0270198 3300047317 Bacteria 1152
241 Ga0495674_0187774 3300047319 Bacteria 1719
242 Ga0495674_0738642 3300047319 Bacteria 770
243 Ga0495675_0021399 3300047444 Bacteria 4117
244 Ga0495684_0066064 3300047471 Bacteria 2750
245 Ga0495684_0122069 3300047471 Bacteria 1961
246 Ga0495684_0145155 3300047471 Bacteria 1778
247 Ga0495602_0000654 3300048088 Bacteria 32531
248 Ga0495602_0017021 3300048088 Bacteria 7293
249 Ga0495602_0184821 3300048088 Bacteria 1604
250 Ga0496101_0654052 3300048904 Unclassified 830
251 Ga0496102_0021307 3300048905 Bacteria 5732
252 Ga0496102_0184728 3300048905 Bacteria 1965
253 Ga0496102_0287733 3300048905 Unclassified 1549
254 Ga0496103_0170057 3300048906 Bacteria 1399
255 Ga0496104_0006866 3300048907 Bacteria 10035
256 Ga0496104_0029346 3300048907 Bacteria 5101
257 Ga0496105_0107668 3300048908 Bacteria 2301
258 Ga0496105_0182435 3300048908 Bacteria 1718
259 Ga0496106_0024044 3300048909 Bacteria 4529
260 Ga0496106_0273488 3300048909 Bacteria 1353
261 Ga0496107_0172942 3300048910 Bacteria 1603
262 Ga0496108_0017020 3300048911 Bacteria 5942
263 Ga0496108_0020535 3300048911 Bacteria 5429
264 Ga0496108_0294124 3300048911 Bacteria 1414
265 Ga0496109_0125942 3300048912 Bacteria 2389
266 Ga0496110_0002015 3300048913 Bacteria 15133
267 Ga0496110_0071803 3300048913 Bacteria 3070
268 Ga0496110_0072790 3300048913 Bacteria 3050
269 Ga0496110_0146321 3300048913 Bacteria 2137
270 Ga0496110_0162748 3300048913 Bacteria 2023
271 Ga0496111_0005496 3300048914 Bacteria 8133
272 Ga0496111_0025989 3300048914 Bacteria 4132
273 Ga0496112_0076562 3300048915 Bacteria 3309
274 Ga0496112_0281055 3300048915 Bacteria 1612
275 Ga0496113_0040735 3300048916 Bacteria 3425
276 Ga0496114_0002675 3300048917 Bacteria 13611
277 Ga0496114_0243038 3300048917 Bacteria 1583
278 Ga0496115_0012706 3300048918 Bacteria 6346
279 Ga0496119_0030595 3300048922 Bacteria 3625
280 Ga0496122_0035037 3300048925 Bacteria 4095
281 Ga0496126_0277592 3300048929 Bacteria 1389
282 Ga0501031_0157758 3300049568 Bacteria 1483
283 Ga0501033_0006857 3300049570 Bacteria 8893
284 Ga0501033_0105638 3300049570 Bacteria 2052
285 Ga0501033_0491768 3300049570 Bacteria 849
286 Ga0501033_0510439 3300049570 Bacteria 831
287 Ga0501034_0017301 3300049571 Bacteria 7397
288 Ga0501034_0572514 3300049571 Bacteria 1037
289 Ga0501036_0013021 3300049572 Bacteria 6906
290 Ga0501036_0044059 3300049572 Bacteria 3779
291 Ga0501036_0049050 3300049572 Bacteria 3575
292 Ga0501036_0120481 3300049572 Bacteria 2216
293 Ga0501036_0246192 3300049572 Unclassified 1499
294 Ga0501037_0057553 3300049573 Bacteria 2838
295 Ga0501038_0006269 3300049574 Bacteria 10995
296 Ga0501038_0123565 3300049574 Bacteria 2132
297 Ga0501038_0157636 3300049574 Bacteria 1847
298 Ga0501039_0105214 3300049575 Bacteria 2204
299 Ga0501040_0000617 3300049576 Bacteria 21773
300 Ga0501040_0046517 3300049576 Bacteria 2962
301 Ga0501040_0223805 3300049576 Bacteria 1339
302 Ga0501040_0246520 3300049576 Bacteria 1274
303 Ga0501040_0319240 3300049576 Bacteria 1111
304 Ga0501041_0021027 3300049577 Bacteria 3908
305 Ga0501041_0232683 3300049577 Bacteria 1157
306 Ga0501042_0015649 3300049578 Bacteria 5194
307 Ga0501046_0008885 3300049580 Bacteria 8725
308 Ga0501047_0334139 3300049581 Bacteria 1354
309 Ga0501048_0061720 3300049582 Bacteria 2654
310 Ga0501068_0046468 3300049584 Bacteria 2618
311 Ga0501070_0173843 3300049586 Bacteria 1774
312 Ga0501070_0224684 3300049586 Bacteria 1539
313 Ga0501070_0273953 3300049586 Bacteria 1378
314 Ga0501071_0350520 3300049587 Bacteria 1123
315 Ga0501071_0488201 3300049587 Bacteria 944
316 Ga0501072_0030359 3300049588 Bacteria 4227
317 Ga0501072_0078795 3300049588 Bacteria 2609
318 Ga0501072_0260555 3300049588 Bacteria 1380
319 Ga0501073_0038125 3300049589 Bacteria 3411
320 Ga0501074_0010662 3300049590 Bacteria 6672
321 Ga0501074_0140537 3300049590 Bacteria 1727
322 Ga0501074_0184212 3300049590 Bacteria 1489
323 Ga0501075_0001700 3300049591 Bacteria 14460
324 Ga0501075_0013695 3300049591 Bacteria 5795
325 Ga0501075_0021257 3300049591 Bacteria 4730
326 Ga0501075_0192863 3300049591 Bacteria 1554
327 Ga0501076_0010734 3300049592 Bacteria 6809
328 Ga0501076_0458960 3300049592 Bacteria 1049
329 Ga0501077_0000500 3300049593 Bacteria 23803
330 Ga0501077_0099384 3300049593 Bacteria 1844
331 Ga0501077_0381099 3300049593 Bacteria 901
332 Ga0501079_0001377 3300049741 Bacteria 17127
333 Ga0501079_0012611 3300049741 Bacteria 6455
334 Ga0501079_0022272 3300049741 Bacteria 4858
335 Ga0501079_0177616 3300049741 Bacteria 1661
336 Ga0501079_0241348 3300049741 Bacteria 1412
337 Ga0501079_0461525 3300049741 Bacteria 998
338 Ga0501080_0014353 3300049742 Bacteria 7294
339 Ga0501080_0364308 3300049742 Bacteria 1304
340 Ga0501081_0002228 3300049743 Bacteria 12196
341 Ga0501081_0006686 3300049743 Bacteria 7495
342 Ga0501035_0081854 3300049822 Bacteria 2849
343 Ga0501035_0141145 3300049822 Bacteria 2094
344 Ga0501035_0208129 3300049822 Bacteria 1675
345 Ga0501035_0278087 3300049822 Bacteria 1416
346 Ga0501035_0562196 3300049822 Bacteria 933
347 Ga0501044_0148072 3300049823 Bacteria 2331
348 Ga0501044_0725410 3300049823 Bacteria 878
349 Ga0501045_0137316 3300049824 Bacteria 1818
350 nmdc:mga03683_84534_c1 3300050489 Bacteria 1375
351 nmdc:mga03n38_36658_c1 3300050490 Bacteria 2110
352 nmdc:mga03n38_83030_c1 3300050490 Bacteria 1510
353 nmdc:mga00v17_128584_c1 3300050491 Bacteria 1618
354 nmdc:mga00v17_5740_c1 3300050491 Bacteria 6559
355 nmdc:mga0yw44_182729_c1 3300050492 Bacteria 1381
356 nmdc:mga0yw44_2440_c1 3300050492 Bacteria 7926
357 nmdc:mga0yw44_8439_c1 3300050492 Bacteria 5133
358 nmdc:mga06z11_444089_c1 3300050494 Bacteria 783
359 nmdc:mga05p37_118839_c1 3300050507 Bacteria 3248
360 nmdc:mga05p37_143410_c1 3300050507 Bacteria 2925
361 nmdc:mga05p37_250409_c1 3300050507 Bacteria 2125
362 nmdc:mga05p37_25675_c1 3300050507 Bacteria 7166
363 nmdc:mga05p37_2880_c1 3300050507 Bacteria 19975
364 nmdc:mga05p37_332716_c1 3300050507 Bacteria 1793
365 nmdc:mga05p37_371174_c1 3300050507 Bacteria 1679
366 nmdc:mga05p37_779109_c1 3300050507 Bacteria 1050
367 nmdc:mga09592_1018_c1 3300050508 Bacteria 22263
368 nmdc:mga09592_115303_c1 3300050508 Bacteria 2306
369 nmdc:mga09592_136165_c1 3300050508 Bacteria 2115
370 nmdc:mga09592_43902_c1 3300050508 Bacteria 3761
371 nmdc:mga09592_54940_c1 3300050508 Bacteria 3364
372 nmdc:mga09592_94224_c1 3300050508 Bacteria 2561
373 nmdc:mga0qj67_104188_c1 3300050509 Bacteria 2289
374 nmdc:mga0qj67_16000_c1 3300050509 Bacteria 5681
375 nmdc:mga0qj67_24725_c1 3300050509 Bacteria 4634
376 nmdc:mga0qj67_299748_c1 3300050509 Bacteria 1302
377 nmdc:mga0qj67_65285_c1 3300050509 Bacteria 2897
378 nmdc:mga06r32_164880_c1 3300050510 Bacteria 2199
379 nmdc:mga06r32_23927_c1 3300050510 Bacteria 5660
380 nmdc:mga06r32_279467_c1 3300050510 Bacteria 1657
381 nmdc:mga06r32_38881_c1 3300050510 Bacteria 4511
382 nmdc:mga06r32_47111_c1 3300050510 Bacteria 4117
383 nmdc:mga06r32_56753_c1 3300050510 Bacteria 3760
384 nmdc:mga08y16_121437_c1 3300050511 Bacteria 2719
385 nmdc:mga08y16_198354_c1 3300050511 Bacteria 2080
386 nmdc:mga08y16_413905_c1 3300050511 Bacteria 1378
387 nmdc:mga08y16_74431_c1 3300050511 Bacteria 3539
388 nmdc:mga0n895_186417_c1 3300050512 Bacteria 2106
389 nmdc:mga0rr50_567396_c1 3300050513 Bacteria 967
390 Ga0495601_0022558 3300053077 Bacteria 3865
391 Ga0495612_0001162 3300053078 Bacteria 10816
392 Ga0495595_0012080 3300053084 Bacteria 3622
393 Ga0495595_0056688 3300053084 Bacteria 1826
394 Ga0495595_0168235 3300053084 Bacteria 1084
395 Ga0495619_0005338 3300053085 Bacteria 8137
396 Ga0495619_0030427 3300053085 Bacteria 3495
397 Ga0495619_0188165 3300053085 Bacteria 1429
398 Ga0500645_009730 3300053730 Bacteria 3219
399 Ga0501084_0003181 3300054114 Bacteria 13282
400 Ga0501084_0067804 3300054114 Bacteria 2987
401 Ga0501084_0073242 3300054114 Bacteria 2868
402 Ga0501082_0023281 3300060353 Bacteria 5343
403 Ga0501082_0353287 3300060353 Bacteria 1282
404 Ga0466962_0208017 3300061719 Bacteria 957
405 Ga0530510_0001753 3300061734 Bacteria 14790
406 Ga0530510_0011240 3300061734 Bacteria 6282
407 Ga0530510_0028512 3300061734 Bacteria 4004
408 Ga0530510_0048236 3300061734 Bacteria 3078
409 2821445418 2821443989 Bacteria 7658172
410 2842777631 2842775625 Bacteria 5587290
411 2844535424 2844533157 Bacteria 7517899
412 2883580643 2883577096 Bacteria 4709178
413 2894772666 2894772417 Bacteria 5305674
414 2897805907 2897803580 Bacteria 7000062
415 2929203436 2929199973 Bacteria 7260745
416 8055910452 8055909800 Bacteria 7278581
417 Ga0436364_0899819
418 JGI25151J46595_10000420
419 JGI25406J46586_10001142
420 JGI25407J50210_10000054
421 Ga0070683_100600215
422 Ga0070691_10040255
423 Ga0070687_100072652
424 Ga0070714_100066405
425 Ga0070708_100533454
426 Ga0070678_100091083
427 Ga0070681_10523810
428 Ga0070706_100081403
429 Ga0070698_100006244
430 Ga0070698_100514604
431 Ga0070699_100142024
432 Ga0070679_100058363
433 Ga0070679_100216834
434 Ga0070697_100105260
435 Ga0068853_100056202
436 Ga0068855_100293458
437 Ga0068854_100245589
438 Ga0068856_100161376
439 Ga0068856_100200167
440 Ga0068859_100039858
441 Ga0068863_100081172
442 Ga0068862_100357920
443 Ga0068862_101115971
444 Ga0081455_10001025
445 Ga0081455_10001335
446 Ga0081455_10005666
447 Ga0081455_10052075
448 Ga0081455_10189981
449 Ga0081455_10208508
450 Ga0081538_10000054
451 Ga0081538_10002120
452 Ga0081538_10064589
453 Ga0081540_1000205
454 Ga0081539_10000076
455 Ga0081539_10005195
456 Ga0081539_10154158
457 Ga0075365_10008091
458 Ga0075365_10044780
459 Ga0075368_10106101
460 Ga0075363_100015231
461 Ga0075363_100056004
462 Ga0075364_10000822
463 Ga0075364_10249085
464 Ga0075364_10249651
465 Ga0075362_10020845
466 Ga0075367_10075170
467 Ga0075369_10026879
468 Ga0075428_100001045
469 Ga0075428_100093288
470 Ga0075428_100097841
471 Ga0075428_100116186
472 Ga0075428_100126888
473 Ga0075428_100227793
474 Ga0075428_100276295
475 Ga0075428_100543636
476 Ga0075430_100037003
477 Ga0075430_100134864
478 Ga0075431_100015981
479 Ga0075431_100035046
480 Ga0075431_100161825
481 Ga0075433_10518544
482 Ga0075434_100001172
483 Ga0075429_100000239
484 Ga0075429_100208373
485 Ga0075429_100598036
486 Ga0097620_100039858
487 Ga0075435_100094682
488 Ga0111539_10005992
489 Ga0111539_10023675
490 Ga0111539_10045919
491 Ga0111539_10047774
492 Ga0111539_10509227
493 Ga0105245_10601944
494 Ga0105247_10278758
495 Ga0114129_10000630
496 Ga0114129_10000831
497 Ga0114129_10027750
498 Ga0114129_10051687
499 Ga0114129_10124335
500 Ga0114129_10156934
501 Ga0114129_10190311
502 Ga0114129_10237138
503 Ga0114129_10290759
504 Ga0114129_10366344
505 Ga0114129_10621216
506 Ga0114129_11342398
507 Ga0105248_10142017
508 Ga0105248_10875808
509 Ga0105249_10039085
510 Ga0105033_101648
511 Ga0105239_10246014
512 Ga0105239_11049849
513 Ga0157370_10348810
514 Ga0157374_10136017
515 Ga0157378_10292196
516 Ga0157375_10625820
517 Ga0163163_10197272
518 Ga0157380_10287136
519 Ga0157379_10231243
520 Ga0157379_10580455
521 Ga0157376_10673170
522 Ga0206353_10482508
523 Ga0213876_10009161
524 Ga0213875_10006288
525 Ga0213875_10101362
526 Ga0213875_10111318
527 Ga0209130_1001791
528 Ga0209025_1000225
529 Ga0209758_1001483
530 Ga0207426_1000317
531 Ga0207692_10085806
532 Ga0207707_10398036
533 Ga0207693_10215266
534 Ga0207663_10175579
535 Ga0207652_10046407
536 Ga0207681_10024521
537 Ga0207687_10518056
538 Ga0207700_10111495
539 Ga0207664_10069570
540 Ga0207711_10133196
541 Ga0207711_10730821
542 Ga0207712_10032443
543 Ga0207668_10541698
544 Ga0207639_10095913
545 Ga0207702_10030478
546 Ga0207702_10798993
547 Ga0207641_10112959
548 Ga0207641_10465375
549 Ga0207675_100350283
550 Ga0209813_10144710
551 Ga0207428_10025807
552 Ga0207428_10182520
553 Ga0207428_10285037
554 Ga0207428_10584436
555 Ga0268266_10115993
556 Ga0268265_10058831
557 Ga0268265_10413192
558 Ga0268264_10079936
559 Ga0268264_10470324
560 Ga0268264_10768369
561 Ga0265338_10076050
562 Ga0373938_0007231
563 Ga0373938_0027820
564 Ga0373928_0072028
565 Ga0373929_0011487
566 Ga0373934_0015754
567 Ga0373934_0174491
568 Ga0373944_0023488
569 Ga0373949_0023825
570 Ga0373949_0026603
571 Ga0373923_0028133
572 Ga0373923_0034397
573 Ga0373939_0033335
574 Ga0373941_0005468
575 Ga0373953_0076303
576 Ga0373955_0009151
577 Ga0373955_0086148
578 Ga0373961_0043057
579 Ga0373924_0227041
580 Ga0373931_0002529
581 Ga0373931_0004365
582 Ga0373935_0273711
583 Ga0373935_0346430
584 Ga0373927_0048693
585 Ga0373927_0299074
586 Ga0373927_0322620
587 Ga0373933_0014259
588 Ga0373933_0024567
589 Ga0373947_0030625
590 Ga0373947_0089254
591 Ga0373937_0002130
592 Ga0373937_0093789
593 Ga0373925_0198897
594 Ga0373925_0271550
595 Ga0436364_0628477
596 Ga0436364_0714857
597 Ga0436364_0820255
598 Ga0436364_1104579
599 Ga0436364_1333680
600 Ga0436364_1554002
601 Ga0395901_0404957
602 Ga0400483_025289
603 Ga0400483_201271
604 Ga0400483_212361
605 Ga0400483_271849
606 Ga0400483_288343
607 Ga0436365_0849013
608 Ga0436365_1171205
609 Ga0436365_1228554
610 Ga0436365_1637878
611 Ga0436360_0736927
612 Ga0436360_1202660
613 Ga0436361_0991677
614 Ga0436363_0097684
615 Ga0439448_0016753
616 Ga0439450_035128
617 Ga0439463_037923
618 Ga0439464_0018596
619 Ga0466966_0030611
620 Ga0466961_0101956
621 Ga0466963_0599239
622 Ga0466964_0163573
623 Ga0466960_0032708
624 Ga0466960_0111637
625 Ga0466959_0198317
626 Ga0466958_0116837
627 Ga0495592_0073341
628 Ga0495592_0175690
629 Ga0495651_0067412
630 Ga0495664_0001377
631 Ga0495664_0080859
632 Ga0495608_0007282
633 Ga0495608_0061029
634 Ga0495610_0019664
635 Ga0495618_0153350
636 Ga0495618_0210248
637 Ga0495628_0050735
638 Ga0495628_0277961
639 Ga0495643_0262154
640 Ga0495643_0264789
641 Ga0495640_0122550
642 Ga0495640_0329227
643 Ga0495587_0001275
644 Ga0495645_0001882
645 Ga0495667_0007693
646 Ga0495667_0016101
647 Ga0495656_0111388
648 Ga0495625_0087288
649 Ga0495635_0038771
650 Ga0495635_0039242
651 Ga0495599_0008537
652 Ga0495623_0020618
653 Ga0495600_0351545
654 Ga0495600_0484596
655 Ga0495604_0116076
656 Ga0495604_0270198
657 Ga0495674_0187774
658 Ga0495674_0738642
659 Ga0495675_0021399
660 Ga0495684_0066064
661 Ga0495684_0122069
662 Ga0495684_0145155
663 Ga0495602_0000654
664 Ga0495602_0017021
665 Ga0495602_0184821
666 Ga0496101_0654052
667 Ga0496102_0021307
668 Ga0496102_0184728
669 Ga0496102_0287733
670 Ga0496103_0170057
671 Ga0496104_0006866
672 Ga0496104_0029346
673 Ga0496105_0107668
674 Ga0496105_0182435
675 Ga0496106_0024044
676 Ga0496106_0273488
677 Ga0496107_0172942
678 Ga0496108_0017020
679 Ga0496108_0020535
680 Ga0496108_0294124
681 Ga0496109_0125942
682 Ga0496110_0002015
683 Ga0496110_0071803
684 Ga0496110_0072790
685 Ga0496110_0146321
686 Ga0496110_0162748
687 Ga0496111_0005496
688 Ga0496111_0025989
689 Ga0496112_0076562
690 Ga0496112_0281055
691 Ga0496113_0040735
692 Ga0496114_0002675
693 Ga0496114_0243038
694 Ga0496115_0012706
695 Ga0496119_0030595
696 Ga0496122_0035037
697 Ga0496126_0277592
698 Ga0501031_0157758
699 Ga0501033_0006857
700 Ga0501033_0105638
701 Ga0501033_0491768
702 Ga0501033_0510439
703 Ga0501034_0017301
704 Ga0501034_0572514
705 Ga0501036_0013021
706 Ga0501036_0044059
707 Ga0501036_0049050
708 Ga0501036_0120481
709 Ga0501036_0246192
710 Ga0501037_0057553
711 Ga0501038_0006269
712 Ga0501038_0123565
713 Ga0501038_0157636
714 Ga0501039_0105214
715 Ga0501040_0000617
716 Ga0501040_0046517
717 Ga0501040_0223805
718 Ga0501040_0246520
719 Ga0501040_0319240
720 Ga0501041_0021027
721 Ga0501041_0232683
722 Ga0501042_0015649
723 Ga0501046_0008885
724 Ga0501047_0334139
725 Ga0501048_0061720
726 Ga0501068_0046468
727 Ga0501070_0173843
728 Ga0501070_0224684
729 Ga0501070_0273953
730 Ga0501071_0350520
731 Ga0501071_0488201
732 Ga0501072_0030359
733 Ga0501072_0078795
734 Ga0501072_0260555
735 Ga0501073_0038125
736 Ga0501074_0010662
737 Ga0501074_0140537
738 Ga0501074_0184212
739 Ga0501075_0001700
740 Ga0501075_0013695
741 Ga0501075_0021257
742 Ga0501075_0192863
743 Ga0501076_0010734
744 Ga0501076_0458960
745 Ga0501077_0000500
746 Ga0501077_0099384
747 Ga0501077_0381099
748 Ga0501079_0001377
749 Ga0501079_0012611
750 Ga0501079_0022272
751 Ga0501079_0177616
752 Ga0501079_0241348
753 Ga0501079_0461525
754 Ga0501080_0014353
755 Ga0501080_0364308
756 Ga0501081_0002228
757 Ga0501081_0006686
758 Ga0501035_0081854
759 Ga0501035_0141145
760 Ga0501035_0208129
761 Ga0501035_0278087
762 Ga0501035_0562196
763 Ga0501044_0148072
764 Ga0501044_0725410
765 Ga0501045_0137316
766 nmdc:mga03683_84534_c1
767 nmdc:mga03n38_36658_c1
768 nmdc:mga03n38_83030_c1
769 nmdc:mga00v17_128584_c1
770 nmdc:mga00v17_5740_c1
771 nmdc:mga0yw44_182729_c1
772 nmdc:mga0yw44_2440_c1
773 nmdc:mga0yw44_8439_c1
774 nmdc:mga06z11_444089_c1
775 nmdc:mga05p37_118839_c1
776 nmdc:mga05p37_143410_c1
777 nmdc:mga05p37_250409_c1
778 nmdc:mga05p37_25675_c1
779 nmdc:mga05p37_2880_c1
780 nmdc:mga05p37_332716_c1
781 nmdc:mga05p37_371174_c1
782 nmdc:mga05p37_779109_c1
783 nmdc:mga09592_1018_c1
784 nmdc:mga09592_115303_c1
785 nmdc:mga09592_136165_c1
786 nmdc:mga09592_43902_c1
787 nmdc:mga09592_54940_c1
788 nmdc:mga09592_94224_c1
789 nmdc:mga0qj67_104188_c1
790 nmdc:mga0qj67_16000_c1
791 nmdc:mga0qj67_24725_c1
792 nmdc:mga0qj67_299748_c1
793 nmdc:mga0qj67_65285_c1
794 nmdc:mga06r32_164880_c1
795 nmdc:mga06r32_23927_c1
796 nmdc:mga06r32_279467_c1
797 nmdc:mga06r32_38881_c1
798 nmdc:mga06r32_47111_c1
799 nmdc:mga06r32_56753_c1
800 nmdc:mga08y16_121437_c1
801 nmdc:mga08y16_198354_c1
802 nmdc:mga08y16_413905_c1
803 nmdc:mga08y16_74431_c1
804 nmdc:mga0n895_186417_c1
805 nmdc:mga0rr50_567396_c1
806 Ga0495601_0022558
807 Ga0495612_0001162
808 Ga0495595_0012080
809 Ga0495595_0056688
810 Ga0495595_0168235
811 Ga0495619_0005338
812 Ga0495619_0030427
813 Ga0495619_0188165
814 Ga0500645_009730
815 Ga0501084_0003181
816 Ga0501084_0067804
817 Ga0501084_0073242
818 Ga0501082_0023281
819 Ga0501082_0353287
820 Ga0466962_0208017
821 Ga0530510_0001753
822 Ga0530510_0011240
823 Ga0530510_0028512
824 Ga0530510_0048236
825 2821445418
826 2842777631
827 2844535424
828 2883580643
829 2894772666
830 2897805907
831 2929203436
832 8055910452

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07973

tRNA_SAD

Threonyl and Alanyl tRNA synthetase second additional domain

186

233

0.96

PF01411

tRNA-synt_2c

tRNA synthetases class II (A)

5

93

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zzf-assembly1.cif.gz_A crystal structure of alanyl-trna synthetase without oligomerization domain 0.8808 2 236
2zze-assembly2.cif.gz_B crystal structure of alanyl-trna synthetase without oligomerization domain in lysine-methylated form 0.8795 2 236
2zzg-assembly1.cif.gz_A crystal structure of alanyl-trna synthetase in complex with 5''-o-(n-(l-alanyl)-sulfamyoxyl) adenine without oligomerization domain 0.878 2 236
2zzg-assembly2.cif.gz_B crystal structure of alanyl-trna synthetase in complex with 5''-o-(n-(l-alanyl)-sulfamyoxyl) adenine without oligomerization domain 0.8762 2 236
3wqy-assembly1.cif.gz_B crystal structure of archaeoglobus fulgidus alanyl-trna synthetase in complex with wild-type trna(ala) having g3.u70 0.873 1 236
ID Description Score Start End Superfamily
2ztgA03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9387 2 89 2.40.30.130
af_Q57984_485_578_2.40.30.130 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9231 2 89 2.40.30.130
af_Q5ZDT9_7_111_2.40.30.130 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.8799 2 88 2.40.30.130
af_A0A1I9LMV6_1_102_2.40.30.130 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.8642 2 86 2.40.30.130
2zzeB03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.8609 2 88 2.40.30.130
ID Description Score Start End GO Terms
AF-A0A2A5W6S6-F1-model_v4 Threonyl/alanyl tRNA synthetase SAD domain-containing protein 0.9859 99 238 GO:0002161
GO:0004812
GO:0005524
GO:0043039
GO:0046872
AF-A0A0A0CW63-F1-model_v4 Ala-tRNA(Pro) hydrolase 0.9835 108 241 GO:0002161
GO:0004812
GO:0005524
GO:0043039
GO:0046872
AF-A0A353GBP3-F1-model_v4 Ala-tRNA(Pro) hydrolase 0.9798 94 238 GO:0002161
GO:0004812
GO:0005524
GO:0043039
GO:0046872
AF-A0A3N5GS00-F1-model_v4 Alanyl-tRNA editing protein 0.9798 2 145 GO:0002161
GO:0004813
GO:0005524
GO:0006419
GO:0046872
AF-A0A521YGW0-F1-model_v4 Alanyl-tRNA editing protein 0.979 2 237 GO:0002161
GO:0003676
GO:0004813
GO:0005524
GO:0005737
GO:0006419
GO:0046872

Map