F438851

General Info

Members Datasets Scaffolds Average Seq Length
416 251 416 95

Family's Representative Sequence

Representative Sequence 3300035172|Ga0373955_0731804|Ga0373955_0731804_91_390
Length 99
Sequence MTGERMAAYVIGEIEVTDAGLYDEYRKQVLATITKYNGRFLARGGKSEPLEGAAPKRVVVLEFPSYEQALKWYRSAEYAPLITLRQKASRGRLVLVEGA

Samples

Sample ID Description Type Environment
1 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
120 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
121 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
122 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
123 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
124 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
125 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
126 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
129 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
155 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
156 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
157 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
158 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
159 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
160 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
163 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.24
Rhizosphere 98.32
Stem 0
Stem Tuber 0
Unclassified 1.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11363987 3300004798 Bacteria 1096
2 Ga0058860_11345607 3300004801 Unclassified 595
3 Ga0070683_100111272 3300005329 Bacteria 2583
4 Ga0070690_100030314 3300005330 Bacteria 3360
5 Ga0068869_100293999 3300005334 Bacteria 1310
6 Ga0070680_100477387 3300005336 Unclassified 1066
7 Ga0070680_101619320 3300005336 Bacteria 561
8 Ga0068868_100686299 3300005338 Bacteria 915
9 Ga0070689_100091472 3300005340 Bacteria 2399
10 Ga0070668_101379579 3300005347 Bacteria 642
11 Ga0070669_100438939 3300005353 Bacteria 1074
12 Ga0070673_101439158 3300005364 Unclassified 649
13 Ga0070703_10202605 3300005406 Bacteria 780
14 Ga0070709_10976275 3300005434 Bacteria 673
15 Ga0070714_100389972 3300005435 Bacteria 1314
16 Ga0070713_101172557 3300005436 Bacteria 743
17 Ga0070710_10320664 3300005437 Bacteria 1017
18 Ga0070701_10566111 3300005438 Bacteria 748
19 Ga0070701_10765598 3300005438 Unclassified 655
20 Ga0070701_10906565 3300005438 Bacteria 609
21 Ga0070701_11377091 3300005438 Unclassified 506
22 Ga0070711_100801808 3300005439 Bacteria 799
23 Ga0070705_100417632 3300005440 Bacteria 998
24 Ga0070705_100942306 3300005440 Bacteria 697
25 Ga0070700_100306610 3300005441 Bacteria 1161
26 Ga0070694_100110068 3300005444 Bacteria 1961
27 Ga0070694_101727424 3300005444 Bacteria 532
28 Ga0070708_100059831 3300005445 Bacteria 3398
29 Ga0070708_100150468 3300005445 Bacteria 2164
30 Ga0070681_10000790 3300005458 Bacteria 26387
31 Ga0070681_11213466 3300005458 Bacteria 676
32 Ga0070685_11275122 3300005466 Bacteria 560
33 Ga0070706_100084313 3300005467 Bacteria 2944
34 Ga0070707_100035031 3300005468 Bacteria 4787
35 Ga0070698_100004886 3300005471 Bacteria 14713
36 Ga0070699_100005366 3300005518 Bacteria 11242
37 Ga0070699_100727184 3300005518 Unclassified 907
38 Ga0070679_100590601 3300005530 Bacteria 1054
39 Ga0070679_100619758 3300005530 Bacteria 1025
40 Ga0070684_100052637 3300005535 Bacteria 3541
41 Ga0070684_101161425 3300005535 Bacteria 726
42 Ga0070697_100003738 3300005536 Bacteria 11689
43 Ga0070697_100005980 3300005536 Bacteria 9407
44 Ga0068853_100060938 3300005539 Bacteria 3262
45 Ga0070686_100029533 3300005544 Bacteria 3336
46 Ga0070686_100093762 3300005544 Bacteria 2014
47 Ga0070686_100317956 3300005544 Bacteria 1160
48 Ga0070695_100021652 3300005545 Bacteria 3937
49 Ga0070695_100395732 3300005545 Bacteria 1046
50 Ga0070695_100642928 3300005545 Unclassified 837
51 Ga0070695_101202778 3300005545 Bacteria 623
52 Ga0070696_100058481 3300005546 Bacteria 2692
53 Ga0070696_100198109 3300005546 Bacteria 1498
54 Ga0070696_100236532 3300005546 Bacteria 1376
55 Ga0070693_101030180 3300005547 Bacteria 624
56 Ga0070704_100137836 3300005549 Bacteria 1901
57 Ga0070704_101363931 3300005549 Bacteria 650
58 Ga0070664_100515582 3300005564 Bacteria 1103
59 Ga0068856_100122010 3300005614 Bacteria 2608
60 Ga0070702_100221361 3300005615 Bacteria 1266
61 Ga0068859_101673263 3300005617 Bacteria 703
62 Ga0068859_102427156 3300005617 Bacteria 578
63 Ga0068864_100058403 3300005618 Bacteria 3334
64 Ga0068861_100055968 3300005719 Bacteria 3009
65 Ga0068861_100805569 3300005719 Bacteria 882
66 Ga0068861_101805322 3300005719 Bacteria 607
67 Ga0068863_100211692 3300005841 Bacteria 1867
68 Ga0068858_100022873 3300005842 Bacteria 5830
69 Ga0068858_100345765 3300005842 Unclassified 1424
70 Ga0068860_101823456 3300005843 Bacteria 630
71 Ga0068862_100964255 3300005844 Bacteria 842
72 Ga0075432_10039316 3300006058 Bacteria 1650
73 Ga0070715_10179522 3300006163 Bacteria 1061
74 Ga0070715_11096410 3300006163 Bacteria 501
75 Ga0070712_100340843 3300006175 Bacteria 1224
76 Ga0097621_100003624 3300006237 Bacteria 10679
77 Ga0097621_100539416 3300006237 Bacteria 1061
78 Ga0068871_100003463 3300006358 Bacteria 10850
79 Ga0075428_100000134 3300006844 Bacteria 65107
80 Ga0075428_100060559 3300006844 Bacteria 4145
81 Ga0075428_100200050 3300006844 Bacteria 2160
82 Ga0075428_101101558 3300006844 Unclassified 839
83 Ga0075430_100068932 3300006846 Bacteria 2968
84 Ga0075430_100467632 3300006846 Bacteria 1041
85 Ga0075431_100040684 3300006847 Bacteria 4790
86 Ga0075431_100708563 3300006847 Bacteria 984
87 Ga0075433_10054760 3300006852 Bacteria 3480
88 Ga0075433_10134495 3300006852 Bacteria 2198
89 Ga0075433_10212455 3300006852 Bacteria 1719
90 Ga0075433_10306076 3300006852 Bacteria 1407
91 Ga0075433_10310608 3300006852 Unclassified 1395
92 Ga0075434_100000013 3300006871 Bacteria 83380
93 Ga0075434_100000813 3300006871 Bacteria 24754
94 Ga0075434_100019971 3300006871 Bacteria 6489
95 Ga0075434_100322442 3300006871 Unclassified 1565
96 Ga0075434_100544132 3300006871 Bacteria 1181
97 Ga0075434_101244155 3300006871 Bacteria 756
98 Ga0075429_100018153 3300006880 Bacteria 6088
99 Ga0075429_100129371 3300006880 Bacteria 2208
100 Ga0075436_100006112 3300006914 Bacteria 8263
101 Ga0075436_101045658 3300006914 Unclassified 614
102 Ga0097620_101673616 3300006931 Bacteria 703
103 Ga0097620_102426981 3300006931 Bacteria 578
104 Ga0075435_100000137 3300007076 Bacteria 41370
105 Ga0075435_100012509 3300007076 Bacteria 6286
106 Ga0075435_100024418 3300007076 Bacteria 4691
107 Ga0075435_100079238 3300007076 Unclassified 2695
108 Ga0075435_101284683 3300007076 Bacteria 641
109 Ga0099794_10044097 3300007265 Bacteria 2131
110 Ga0099795_10095744 3300007788 Unclassified 1157
111 Ga0111539_10005688 3300009094 Bacteria 16134
112 Ga0111539_10008191 3300009094 Bacteria 13304
113 Ga0111539_10153696 3300009094 Bacteria 2693
114 Ga0105247_10221378 3300009101 Bacteria 1281
115 Ga0114129_10014055 3300009147 Bacteria 11404
116 Ga0114129_10040737 3300009147 Bacteria 6547
117 Ga0114129_10086683 3300009147 Bacteria 4342
118 Ga0114129_10124013 3300009147 Bacteria 3553
119 Ga0105248_11312065 3300009177 Bacteria 819
120 Ga0105248_11787568 3300009177 Bacteria 697
121 Ga0105249_10127623 3300009553 Bacteria 2424
122 Ga0105249_12006880 3300009553 Unclassified 651
123 Ga0105249_12040816 3300009553 Bacteria 646
124 Ga0105246_10446432 3300011119 Bacteria 1086
125 Ga0157347_1028308 3300012502 Bacteria 691
126 Ga0157370_10087172 3300013104 Bacteria 2932
127 Ga0157375_13022786 3300013308 Bacteria 561
128 Ga0157379_11512848 3300014968 Unclassified 653
129 Ga0157376_10120867 3300014969 Bacteria 2321
130 Ga0182007_10300762 3300015262 Bacteria 589
131 Ga0163161_11149479 3300017792 Unclassified 669
132 Ga0213874_10463601 3300021377 Bacteria 502
133 Ga0207710_10372138 3300025900 Unclassified 730
134 Ga0207685_10695852 3300025905 Bacteria 553
135 Ga0207684_10001023 3300025910 Bacteria 31386
136 Ga0207684_10500048 3300025910 Bacteria 1042
137 Ga0207707_10019422 3300025912 Bacteria 5932
138 Ga0207695_10490894 3300025913 Bacteria 1110
139 Ga0207693_10218370 3300025915 Bacteria 1498
140 Ga0207660_10397407 3300025917 Bacteria 1110
141 Ga0207652_10117503 3300025921 Bacteria 2363
142 Ga0207652_10540687 3300025921 Bacteria 1048
143 Ga0207646_10001026 3300025922 Bacteria 35667
144 Ga0207646_10816937 3300025922 Bacteria 830
145 Ga0207681_10741265 3300025923 Bacteria 818
146 Ga0207700_10961334 3300025928 Bacteria 765
147 Ga0207664_10354318 3300025929 Bacteria 1299
148 Ga0207690_11277476 3300025932 Unclassified 613
149 Ga0207670_10112546 3300025936 Bacteria 1964
150 Ga0207689_10294469 3300025942 Bacteria 1345
151 Ga0207661_10108100 3300025944 Bacteria 2347
152 Ga0207679_11432242 3300025945 Bacteria 634
153 Ga0207668_10332895 3300025972 Bacteria 1264
154 Ga0207703_10378586 3300026035 Unclassified 1309
155 Ga0207639_10338057 3300026041 Bacteria 1342
156 Ga0207708_10419791 3300026075 Bacteria 1109
157 Ga0207708_10484453 3300026075 Bacteria 1034
158 Ga0207708_10681886 3300026075 Unclassified 877
159 Ga0207708_11069153 3300026075 Bacteria 703
160 Ga0207702_10084336 3300026078 Bacteria 2766
161 Ga0207702_10891572 3300026078 Bacteria 881
162 Ga0207641_10323835 3300026088 Bacteria 1462
163 Ga0207648_11794834 3300026089 Bacteria 575
164 Ga0207676_10045896 3300026095 Bacteria 3378
165 Ga0207675_100384055 3300026118 Bacteria 1381
166 Ga0207675_100639911 3300026118 Bacteria 1069
167 Ga0207675_102745575 3300026118 Unclassified 500
168 Ga0209967_1001797 3300027364 Bacteria 2756
169 Ga0209981_1001144 3300027378 Bacteria 3359
170 Ga0210000_1000566 3300027462 Bacteria 5075
171 Ga0209995_1046683 3300027471 Bacteria 733
172 Ga0209999_1003874 3300027543 Bacteria 2691
173 Ga0209999_1020892 3300027543 Bacteria 1202
174 Ga0209588_1029194 3300027671 Bacteria 1758
175 Ga0209588_1072806 3300027671 Bacteria 1110
176 Ga0207428_10005247 3300027907 Bacteria 12107
177 Ga0207428_10117904 3300027907 Bacteria 2037
178 Ga0268265_11102617 3300028380 Bacteria 788
179 Ga0268264_10748028 3300028381 Bacteria 974
180 Ga0268264_11097789 3300028381 Bacteria 804
181 Ga0307408_100254299 3300031548 Bacteria 1451
182 Ga0307408_100645333 3300031548 Bacteria 946
183 Ga0307405_10419148 3300031731 Bacteria 1053
184 Ga0307413_11731137 3300031824 Bacteria 558
185 Ga0307412_12142064 3300031911 Unclassified 520
186 Ga0307416_100793545 3300032002 Bacteria 1042
187 Ga0307416_100809682 3300032002 Bacteria 1033
188 Ga0307416_101106388 3300032002 Bacteria 897
189 Ga0307411_10188441 3300032005 Bacteria 1573
190 Ga0373930_0168549 3300034816 Unclassified 557
191 Ga0373948_0034474 3300034817 Bacteria 1035
192 Ga0373950_0028791 3300034818 Bacteria 1020
193 Ga0373959_0012474 3300034820 Bacteria 1518
194 Ga0373938_0008507 3300034957 Bacteria 1834
195 Ga0373938_0019701 3300034957 Bacteria 1352
196 Ga0373926_0000737 3300035083 Bacteria 9084
197 Ga0373928_0003968 3300035084 Bacteria 2825
198 Ga0373928_0078608 3300035084 Bacteria 828
199 Ga0373928_0141803 3300035084 Unclassified 659
200 Ga0373929_0031199 3300035085 Bacteria 1140
201 Ga0373929_0069858 3300035085 Bacteria 838
202 Ga0373929_0071546 3300035085 Bacteria 830
203 Ga0373934_0406575 3300035086 Bacteria 569
204 Ga0373940_0178825 3300035088 Bacteria 689
205 Ga0373949_0014336 3300035090 Bacteria 1764
206 Ga0373951_0055439 3300035091 Bacteria 983
207 Ga0373952_0033218 3300035092 Bacteria 1157
208 Ga0373923_0335994 3300035111 Unclassified 719
209 Ga0373932_0063489 3300035112 Bacteria 1128
210 Ga0373932_0265685 3300035112 Bacteria 630
211 Ga0373939_0064895 3300035114 Unclassified 1173
212 Ga0373939_0351029 3300035114 Bacteria 600
213 Ga0373941_0002898 3300035115 Bacteria 3823
214 Ga0373941_0464151 3300035115 Unclassified 533
215 Ga0373945_0013898 3300035116 Bacteria 2692
216 Ga0373954_0000011 3300035118 Bacteria 74083
217 Ga0373960_0008726 3300035121 Bacteria 2438
218 Ga0373943_0015118 3300035170 Bacteria 3503
219 Ga0373946_0015861 3300035171 Bacteria 2863
220 Ga0373946_0240967 3300035171 Bacteria 879
221 Ga0373955_0094907 3300035172 Bacteria 1705
222 Ga0373955_0731804 3300035172 Unclassified 607
223 Ga0373942_0051577 3300035207 Bacteria 1155
224 Ga0373961_0121032 3300035241 Bacteria 867
225 Ga0373962_0206079 3300035242 Unclassified 668
226 Ga0373924_0026494 3300035410 Bacteria 2300
227 Ga0373931_0001269 3300035691 Bacteria 10782
228 Ga0373931_0026318 3300035691 Bacteria 2960
229 Ga0373931_0191776 3300035691 Bacteria 1216
230 Ga0373935_0013997 3300035692 Bacteria 4844
231 Ga0373927_0018778 3300035695 Bacteria 4536
232 Ga0373933_0009633 3300035724 Bacteria 5278
233 Ga0373947_0023636 3300035725 Bacteria 3577
234 Ga0373937_0018642 3300036401 Bacteria 6200
235 Ga0373937_0049684 3300036401 Bacteria 3840
236 Ga0373925_0002777 3300037068 Bacteria 13833
237 Ga0373925_1129458 3300037068 Unclassified 644
238 Ga0436363_0778074 3300039450 Bacteria 504
239 Ga0451839_0683468 3300041496 Bacteria 532
240 Ga0451843_0350432 3300041509 Bacteria 531
241 Ga0439441_175281 3300042001 Unclassified 514
242 Ga0439462_0056771 3300042015 Bacteria 1057
243 Ga0439446_0098563 3300042156 Bacteria 922
244 Ga0439458_0194990 3300042157 Bacteria 553
245 Ga0439460_0185517 3300042461 Bacteria 704
246 Ga0451577_0011400 3300042876 Bacteria 8411
247 Ga0451577_0344510 3300042876 Bacteria 1352
248 Ga0451577_1446928 3300042876 Bacteria 609
249 Ga0439440_0096436 3300042993 Unclassified 800
250 Ga0453683_0081301 3300044673 Bacteria 2029
251 Ga0453684_0084097 3300044712 Bacteria 3959
252 Ga0466960_0284099 3300044901 Bacteria 928
253 Ga0451576_0014343 3300045051 Bacteria 8825
254 Ga0451576_0020291 3300045051 Bacteria 7239
255 Ga0451576_0024266 3300045051 Bacteria 6551
256 Ga0451576_0533965 3300045051 Bacteria 1232
257 Ga0451576_0590291 3300045051 Bacteria 1167
258 Ga0495592_0000730 3300046454 Bacteria 22941
259 Ga0495603_0010469 3300046455 Bacteria 5619
260 Ga0495629_0079443 3300046459 Bacteria 2291
261 Ga0495651_0896067 3300046462 Unclassified 543
262 Ga0495653_0134840 3300046463 Bacteria 1743
263 Ga0495580_0002125 3300046472 Bacteria 17378
264 Ga0495582_0098852 3300046473 Bacteria 1633
265 Ga0495639_0416148 3300046475 Bacteria 680
266 Ga0495639_0509069 3300046475 Bacteria 615
267 Ga0495662_0020959 3300046476 Bacteria 3161
268 Ga0495594_0520243 3300046499 Bacteria 675
269 Ga0495608_0000969 3300046511 Bacteria 20269
270 Ga0495608_0385075 3300046511 Unclassified 859
271 Ga0495618_0009221 3300046514 Bacteria 5960
272 Ga0495628_0015267 3300046516 Bacteria 6416
273 Ga0495628_0770585 3300046516 Unclassified 675
274 Ga0495630_0032736 3300046517 Bacteria 3875
275 Ga0495630_0493178 3300046517 Bacteria 939
276 Ga0495644_0348685 3300046523 Unclassified 583
277 Ga0495666_0135745 3300046526 Bacteria 1148
278 Ga0495666_0270661 3300046526 Bacteria 771
279 Ga0495652_0434361 3300046529 Bacteria 922
280 Ga0495665_0065213 3300046531 Bacteria 1922
281 Ga0495640_0004298 3300046533 Bacteria 11372
282 Ga0495640_0098414 3300046533 Bacteria 1922
283 Ga0495586_0001781 3300046535 Bacteria 11779
284 Ga0495586_0002995 3300046535 Bacteria 9113
285 Ga0495586_0730557 3300046535 Unclassified 571
286 Ga0495587_0112266 3300046536 Bacteria 1565
287 Ga0495645_0711551 3300046543 Unclassified 609
288 Ga0495622_0267611 3300046557 Bacteria 749
289 Ga0495667_0010267 3300046559 Bacteria 6335
290 Ga0495634_0013921 3300046642 Bacteria 5813
291 Ga0495635_0036465 3300046663 Bacteria 3408
292 Ga0495657_0114704 3300046675 Bacteria 1703
293 Ga0495599_0166230 3300046678 Bacteria 1362
294 Ga0495646_0271148 3300046680 Bacteria 904
295 Ga0495647_0274133 3300046681 Bacteria 755
296 Ga0495658_0028196 3300046683 Bacteria 3028
297 Ga0495613_0492203 3300046689 Bacteria 826
298 Ga0495624_0561290 3300046690 Unclassified 681
299 Ga0495600_0052296 3300046809 Bacteria 2667
300 Ga0495581_0559553 3300047315 Bacteria 663
301 Ga0495604_0015596 3300047317 Bacteria 6065
302 Ga0495636_0003719 3300047318 Bacteria 5936
303 Ga0495674_0257861 3300047319 Bacteria 1433
304 Ga0495674_0502859 3300047319 Bacteria 969
305 Ga0495676_0506925 3300047321 Bacteria 791
306 Ga0495680_0001489 3300047322 Bacteria 25192
307 Ga0495680_0189841 3300047322 Bacteria 1479
308 Ga0495684_0267140 3300047471 Bacteria 1239
309 Ga0495593_0132111 3300047673 Bacteria 1267
310 Ga0496114_1479844 3300048917 Bacteria 567
311 Ga0501291_083903 3300049514 Bacteria 639
312 Ga0501031_0158892 3300049568 Bacteria 1477
313 Ga0501031_0442507 3300049568 Bacteria 840
314 Ga0501033_0003914 3300049570 Bacteria 12089
315 Ga0501033_0410471 3300049570 Bacteria 944
316 Ga0501036_0017428 3300049572 Bacteria 6004
317 Ga0501036_0045842 3300049572 Bacteria 3703
318 Ga0501036_0852349 3300049572 Bacteria 749
319 Ga0501037_0211206 3300049573 Bacteria 1368
320 Ga0501037_0578184 3300049573 Bacteria 756
321 Ga0501038_0044308 3300049574 Bacteria 3867
322 Ga0501038_0110895 3300049574 Bacteria 2273
323 Ga0501038_0992520 3300049574 Unclassified 617
324 Ga0501039_0002169 3300049575 Bacteria 14495
325 Ga0501039_0018345 3300049575 Bacteria 5370
326 Ga0501039_0388777 3300049575 Bacteria 1096
327 Ga0501040_0024532 3300049576 Bacteria 4047
328 Ga0501040_0048884 3300049576 Bacteria 2891
329 Ga0501040_0377247 3300049576 Bacteria 1017
330 Ga0501040_0480719 3300049576 Bacteria 895
331 Ga0501041_0000170 3300049577 Bacteria 29128
332 Ga0501041_0010053 3300049577 Bacteria 5575
333 Ga0501042_0063500 3300049578 Bacteria 2639
334 Ga0501042_0382948 3300049578 Bacteria 1018
335 Ga0501042_1044596 3300049578 Bacteria 596
336 Ga0501042_1455135 3300049578 Bacteria 500
337 Ga0501043_0035446 3300049579 Bacteria 3925
338 Ga0501043_0152407 3300049579 Bacteria 1809
339 Ga0501046_0000480 3300049580 Bacteria 39915
340 Ga0501046_0467052 3300049580 Unclassified 906
341 Ga0501047_0614668 3300049581 Bacteria 908
342 Ga0501048_0000896 3300049582 Bacteria 21988
343 Ga0501048_0080997 3300049582 Bacteria 2291
344 Ga0501048_0110793 3300049582 Bacteria 1938
345 Ga0501067_0130723 3300049583 Bacteria 1397
346 Ga0501068_0111773 3300049584 Bacteria 1699
347 Ga0501070_0122187 3300049586 Bacteria 2152
348 Ga0501071_0019933 3300049587 Bacteria 4658
349 Ga0501071_0032149 3300049587 Bacteria 3724
350 Ga0501071_0294744 3300049587 Bacteria 1229
351 Ga0501072_0002754 3300049588 Bacteria 13208
352 Ga0501072_0019871 3300049588 Bacteria 5198
353 Ga0501072_0203082 3300049588 Bacteria 1580
354 Ga0501072_0479570 3300049588 Unclassified 984
355 Ga0501074_0042414 3300049590 Bacteria 3292
356 Ga0501075_0007676 3300049591 Bacteria 7487
357 Ga0501075_0061253 3300049591 Bacteria 2835
358 Ga0501076_0000566 3300049592 Bacteria 23610
359 Ga0501076_0002853 3300049592 Bacteria 11956
360 Ga0501076_0320675 3300049592 Bacteria 1271
361 Ga0501076_0635030 3300049592 Bacteria 881
362 Ga0501077_0051387 3300049593 Bacteria 2619
363 Ga0501077_0061904 3300049593 Bacteria 2375
364 Ga0501079_0001982 3300049741 Bacteria 14673
365 Ga0501079_0014763 3300049741 Bacteria 5955
366 Ga0501080_0019198 3300049742 Bacteria 6330
367 Ga0501081_0014351 3300049743 Bacteria 5224
368 Ga0501081_0019367 3300049743 Bacteria 4532
369 Ga0501035_0100919 3300049822 Bacteria 2533
370 Ga0501035_0105814 3300049822 Bacteria 2467
371 Ga0501045_0004353 3300049824 Bacteria 9761
372 Ga0501045_0018514 3300049824 Bacteria 4955
373 Ga0501045_0357999 3300049824 Bacteria 1086
374 Ga0501045_1206955 3300049824 Unclassified 552
375 nmdc:mga05p37_10565_c2 3300050507 Unclassified 1870
376 nmdc:mga05p37_155358_c1 3300050507 Bacteria 2796
377 nmdc:mga05p37_26113_c1 3300050507 Bacteria 7102
378 nmdc:mga05p37_261151_c1 3300050507 Bacteria 2072
379 nmdc:mga05p37_618_c1 3300050507 Bacteria 39293
380 nmdc:mga09592_1355095_c1 3300050508 Bacteria 583
381 nmdc:mga09592_25284_c1 3300050508 Bacteria 4914
382 nmdc:mga0qj67_9471_c1 3300050509 Bacteria 7250
383 nmdc:mga06r32_1313360_c1 3300050510 Bacteria 667
384 nmdc:mga06r32_133125_c1 3300050510 Bacteria 2460
385 nmdc:mga08y16_1554524_c1 3300050511 Bacteria 621
386 nmdc:mga08y16_49766_c1 3300050511 Bacteria 4385
387 nmdc:mga08y16_99491_c1 3300050511 Bacteria 3028
388 nmdc:mga0n895_11483_c1 3300050512 Bacteria 7905
389 nmdc:mga0n895_2274_c1 3300050512 Bacteria 14897
390 nmdc:mga0n895_340012_c1 3300050512 Bacteria 1520
391 nmdc:mga0n895_3867_c1 3300050512 Bacteria 12157
392 nmdc:mga0n895_3962_c1 3300050512 Bacteria 12037
393 nmdc:mga0n895_479085_c1 3300050512 Bacteria 1255
394 nmdc:mga0rr50_17115_c1 3300050513 Bacteria 4830
395 nmdc:mga0rr50_27253_c1 3300050513 Bacteria 3998
396 nmdc:mga0rr50_7242_c1 3300050513 Bacteria 6823
397 nmdc:mga0rr50_875866_c1 3300050513 Bacteria 766
398 nmdc:mga08x19_143073_c1 3300050514 Bacteria 1616
399 nmdc:mga08x19_35262_c1 3300050514 Bacteria 3164
400 nmdc:mga08x19_373_c1 3300050514 Bacteria 31469
401 nmdc:mga08x19_7491_c1 3300050514 Bacteria 6483
402 nmdc:mga08x19_938104_c1 3300050514 Bacteria 615
403 nmdc:mga0a205_1128084_c1 3300050515 Bacteria 632
404 nmdc:mga0a205_24242_c1 3300050515 Bacteria 5766
405 nmdc:mga0a205_259775_c1 3300050515 Bacteria 1614
406 nmdc:mga0a205_285077_c1 3300050515 Unclassified 1527
407 nmdc:mga0a205_289060_c1 3300050515 Bacteria 1514
408 Ga0495601_0071090 3300053077 Bacteria 2222
409 Ga0495619_0297541 3300053085 Bacteria 1118
410 Ga0501084_0026094 3300054114 Bacteria 4874
411 Ga0501082_0000431 3300060353 Bacteria 37176
412 Ga0501082_0114472 3300060353 Bacteria 2335
413 Ga0501082_0217855 3300060353 Bacteria 1661
414 Ga0530510_0004584 3300061734 Bacteria 9564
415 Ga0530510_0042497 3300061734 Bacteria 3284
416 Ga0530510_0346112 3300061734 Bacteria 1116

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100091472 Ga0070689_1000914724 94
2 3300005436 Ga0070713_101172557 Ga0070713_1011725571 94
3 3300005437 Ga0070710_10320664 Ga0070710_103206642 94
4 3300005438 Ga0070701_10566111 Ga0070701_105661111 94
5 3300005440 Ga0070705_100417632 Ga0070705_1004176322 94
6 3300005444 Ga0070694_100110068 Ga0070694_1001100684 94
7 3300005444 Ga0070694_101727424 Ga0070694_1017274242 94
8 3300005544 Ga0070686_100093762 Ga0070686_1000937624 94
9 3300005545 Ga0070695_100021652 Ga0070695_1000216525 94
10 3300005545 Ga0070695_100395732 Ga0070695_1003957322 94
11 3300005545 Ga0070695_100642928 Ga0070695_1006429282 94
12 3300005546 Ga0070696_100058481 Ga0070696_1000584812 94
13 3300005546 Ga0070696_100236532 Ga0070696_1002365322 94
14 3300005547 Ga0070693_101030180 Ga0070693_1010301801 94
15 3300005549 Ga0070704_100137836 Ga0070704_1001378362 94
16 3300005614 Ga0068856_100122010 Ga0068856_1001220105 94
17 3300006175 Ga0070712_100340843 Ga0070712_1003408432 94
18 3300006237 Ga0097621_100539416 Ga0097621_1005394162 94
19 3300006871 Ga0075434_100019971 Ga0075434_1000199711 94
20 3300009177 Ga0105248_11312065 Ga0105248_113120652 94
21 3300025915 Ga0207693_10218370 Ga0207693_102183702 94
22 3300025917 Ga0207660_10397407 Ga0207660_103974072 94
23 3300025928 Ga0207700_10961334 Ga0207700_109613342 94
24 3300025936 Ga0207670_10112546 Ga0207670_101125464 94
25 3300026075 Ga0207708_10419791 Ga0207708_104197912 94
26 3300026075 Ga0207708_10681886 Ga0207708_106818862 94
27 3300026078 Ga0207702_10084336 Ga0207702_100843365 94
28 3300031911 Ga0307412_12142064 Ga0307412_121420642 94
29 3300032002 Ga0307416_100809682 Ga0307416_1008096822 94
30 3300035111 Ga0373923_0335994 Ga0373923_0335994_163_447 94
31 3300035172 Ga0373955_0094907 Ga0373955_0094907_931_1215 94
32 3300035172 Ga0373955_0731804 Ga0373955_0731804_91_390 94
33 3300035242 Ga0373962_0206079 Ga0373962_0206079_208_492 94
34 3300036401 Ga0373937_0018642 Ga0373937_0018642_5877_6161 94
35 3300041496 Ga0451839_0683468 Ga0451839_0683468_220_507 94
36 3300042001 Ga0439441_175281 Ga0439441_175281_124_408 94
37 3300045051 Ga0451576_0533965 Ga0451576_0533965_768_1052 94
38 3300046454 Ga0495592_0000730 Ga0495592_0000730_11686_11970 94
39 3300046459 Ga0495629_0079443 Ga0495629_0079443_1104_1391 94
40 3300046462 Ga0495651_0896067 Ga0495651_0896067_85_384 94
41 3300046463 Ga0495653_0134840 Ga0495653_0134840_1448_1732 94
42 3300046475 Ga0495639_0509069 Ga0495639_0509069_34_318 94
43 3300046476 Ga0495662_0020959 Ga0495662_0020959_1275_1559 94
44 3300046511 Ga0495608_0000969 Ga0495608_0000969_164_448 94
45 3300046511 Ga0495608_0385075 Ga0495608_0385075_170_457 94
46 3300046514 Ga0495618_0009221 Ga0495618_0009221_320_604 94
47 3300046516 Ga0495628_0015267 Ga0495628_0015267_2921_3205 94
48 3300046516 Ga0495628_0770585 Ga0495628_0770585_234_533 94
49 3300046517 Ga0495630_0032736 Ga0495630_0032736_2076_2360 94
50 3300046523 Ga0495644_0348685 Ga0495644_0348685_77_361 94
51 3300046526 Ga0495666_0135745 Ga0495666_0135745_325_609 94
52 3300046529 Ga0495652_0434361 Ga0495652_0434361_163_447 94
53 3300046533 Ga0495640_0004298 Ga0495640_0004298_9069_9353 94
54 3300046533 Ga0495640_0098414 Ga0495640_0098414_1103_1390 94
55 3300046535 Ga0495586_0001781 Ga0495586_0001781_545_829 94
56 3300046536 Ga0495587_0112266 Ga0495587_0112266_704_988 94
57 3300046543 Ga0495645_0711551 Ga0495645_0711551_293_592 94
58 3300046559 Ga0495667_0010267 Ga0495667_0010267_2066_2350 94
59 3300046642 Ga0495634_0013921 Ga0495634_0013921_3502_3786 94
60 3300046663 Ga0495635_0036465 Ga0495635_0036465_1987_2271 94
61 3300046678 Ga0495599_0166230 Ga0495599_0166230_813_1097 94
62 3300046680 Ga0495646_0271148 Ga0495646_0271148_122_409 94
63 3300046689 Ga0495613_0492203 Ga0495613_0492203_286_570 94
64 3300046690 Ga0495624_0561290 Ga0495624_0561290_91_375 94
65 3300046809 Ga0495600_0052296 Ga0495600_0052296_2094_2378 94
66 3300047315 Ga0495581_0559553 Ga0495581_0559553_55_339 94
67 3300047317 Ga0495604_0015596 Ga0495604_0015596_2059_2343 94
68 3300047318 Ga0495636_0003719 Ga0495636_0003719_544_828 94
69 3300047319 Ga0495674_0257861 Ga0495674_0257861_987_1274 94
70 3300047319 Ga0495674_0502859 Ga0495674_0502859_510_794 94
71 3300047322 Ga0495680_0001489 Ga0495680_0001489_20544_20828 94
72 3300047322 Ga0495680_0189841 Ga0495680_0189841_332_631 94
73 3300047471 Ga0495684_0267140 Ga0495684_0267140_588_872 94
74 3300047673 Ga0495593_0132111 Ga0495593_0132111_290_577 94
75 3300049574 Ga0501038_0992520 Ga0501038_0992520_222_506 94
76 3300050512 nmdc:mga0n895_3867_c1 nmdc:mga0n895_3867_c1_9366_9650 94
77 3300053077 Ga0495601_0071090 Ga0495601_0071090_156_443 94
78 3300053085 Ga0495619_0297541 Ga0495619_0297541_326_610 94
79 3300004798 Ga0058859_11363987 Ga0058859_113639871 95
80 3300004801 Ga0058860_11345607 Ga0058860_113456071 95
81 3300005329 Ga0070683_100111272 Ga0070683_1001112723 95
82 3300005330 Ga0070690_100030314 Ga0070690_1000303142 95
83 3300005334 Ga0068869_100293999 Ga0068869_1002939991 95
84 3300005336 Ga0070680_100477387 Ga0070680_1004773871 95
85 3300005336 Ga0070680_101619320 Ga0070680_1016193201 95
86 3300005338 Ga0068868_100686299 Ga0068868_1006862992 95
87 3300005347 Ga0070668_101379579 Ga0070668_1013795792 95
88 3300005353 Ga0070669_100438939 Ga0070669_1004389392 95
89 3300005364 Ga0070673_101439158 Ga0070673_1014391581 95
90 3300005406 Ga0070703_10202605 Ga0070703_102026052 95
91 3300005434 Ga0070709_10976275 Ga0070709_109762752 95
92 3300005435 Ga0070714_100389972 Ga0070714_1003899722 95
93 3300005438 Ga0070701_10765598 Ga0070701_107655981 95
94 3300005438 Ga0070701_10906565 Ga0070701_109065651 95
95 3300005438 Ga0070701_11377091 Ga0070701_113770911 95
96 3300005439 Ga0070711_100801808 Ga0070711_1008018081 95
97 3300005440 Ga0070705_100942306 Ga0070705_1009423062 95
98 3300005441 Ga0070700_100306610 Ga0070700_1003066102 95
99 3300005445 Ga0070708_100059831 Ga0070708_1000598311 95
100 3300005445 Ga0070708_100150468 Ga0070708_1001504682 95
101 3300005458 Ga0070681_10000790 Ga0070681_1000079030 95
102 3300005458 Ga0070681_11213466 Ga0070681_112134662 95
103 3300005466 Ga0070685_11275122 Ga0070685_112751222 95
104 3300005467 Ga0070706_100084313 Ga0070706_1000843134 95
105 3300005468 Ga0070707_100035031 Ga0070707_1000350315 95
106 3300005471 Ga0070698_100004886 Ga0070698_10000488612 95
107 3300005518 Ga0070699_100005366 Ga0070699_1000053666 95
108 3300005518 Ga0070699_100727184 Ga0070699_1007271842 95
109 3300005530 Ga0070679_100590601 Ga0070679_1005906012 95
110 3300005530 Ga0070679_100619758 Ga0070679_1006197582 95
111 3300005535 Ga0070684_100052637 Ga0070684_1000526372 95
112 3300005535 Ga0070684_101161425 Ga0070684_1011614252 95
113 3300005536 Ga0070697_100003738 Ga0070697_10000373813 95
114 3300005536 Ga0070697_100005980 Ga0070697_1000059805 95
115 3300005539 Ga0068853_100060938 Ga0068853_1000609382 95
116 3300005544 Ga0070686_100029533 Ga0070686_1000295332 95
117 3300005544 Ga0070686_100317956 Ga0070686_1003179562 95
118 3300005545 Ga0070695_101202778 Ga0070695_1012027782 95
119 3300005546 Ga0070696_100198109 Ga0070696_1001981091 95
120 3300005549 Ga0070704_101363931 Ga0070704_1013639312 95
121 3300005564 Ga0070664_100515582 Ga0070664_1005155822 95
122 3300005615 Ga0070702_100221361 Ga0070702_1002213612 95
123 3300005617 Ga0068859_101673263 Ga0068859_1016732631 95
124 3300005617 Ga0068859_102427156 Ga0068859_1024271562 95
125 3300005618 Ga0068864_100058403 Ga0068864_1000584033 95
126 3300005719 Ga0068861_100055968 Ga0068861_1000559682 95
127 3300005719 Ga0068861_100805569 Ga0068861_1008055692 95
128 3300005719 Ga0068861_101805322 Ga0068861_1018053222 95
129 3300005841 Ga0068863_100211692 Ga0068863_1002116922 95
130 3300005842 Ga0068858_100022873 Ga0068858_1000228736 95
131 3300005842 Ga0068858_100345765 Ga0068858_1003457654 95
132 3300005843 Ga0068860_101823456 Ga0068860_1018234561 95
133 3300005844 Ga0068862_100964255 Ga0068862_1009642552 95
134 3300006058 Ga0075432_10039316 Ga0075432_100393162 95
135 3300006163 Ga0070715_10179522 Ga0070715_101795222 95
136 3300006163 Ga0070715_11096410 Ga0070715_110964101 95
137 3300006237 Ga0097621_100003624 Ga0097621_10000362411 95
138 3300006358 Ga0068871_100003463 Ga0068871_10000346312 95
139 3300006844 Ga0075428_100000134 Ga0075428_10000013460 95
140 3300006844 Ga0075428_100060559 Ga0075428_1000605593 95
141 3300006844 Ga0075428_100200050 Ga0075428_1002000502 95
142 3300006844 Ga0075428_101101558 Ga0075428_1011015582 95
143 3300006846 Ga0075430_100068932 Ga0075430_1000689322 95
144 3300006846 Ga0075430_100467632 Ga0075430_1004676322 95
145 3300006847 Ga0075431_100040684 Ga0075431_1000406845 95
146 3300006847 Ga0075431_100708563 Ga0075431_1007085631 95
147 3300006852 Ga0075433_10054760 Ga0075433_100547606 95
148 3300006852 Ga0075433_10134495 Ga0075433_101344952 95
149 3300006852 Ga0075433_10212455 Ga0075433_102124553 95
150 3300006852 Ga0075433_10306076 Ga0075433_103060762 95
151 3300006852 Ga0075433_10310608 Ga0075433_103106083 95
152 3300006871 Ga0075434_100000013 Ga0075434_1000000132 95
153 3300006871 Ga0075434_100000813 Ga0075434_1000008132 95
154 3300006871 Ga0075434_100322442 Ga0075434_1003224422 95
155 3300006871 Ga0075434_100544132 Ga0075434_1005441322 95
156 3300006871 Ga0075434_101244155 Ga0075434_1012441552 95
157 3300006880 Ga0075429_100018153 Ga0075429_1000181538 95
158 3300006880 Ga0075429_100129371 Ga0075429_1001293712 95
159 3300006914 Ga0075436_100006112 Ga0075436_1000061128 95
160 3300006914 Ga0075436_101045658 Ga0075436_1010456582 95
161 3300006931 Ga0097620_101673616 Ga0097620_1016736161 95
162 3300006931 Ga0097620_102426981 Ga0097620_1024269812 95
163 3300007076 Ga0075435_100000137 Ga0075435_1000001377 95
164 3300007076 Ga0075435_100012509 Ga0075435_1000125096 95
165 3300007076 Ga0075435_100024418 Ga0075435_1000244186 95
166 3300007076 Ga0075435_100079238 Ga0075435_1000792382 95
167 3300007076 Ga0075435_101284683 Ga0075435_1012846832 95
168 3300007265 Ga0099794_10044097 Ga0099794_100440972 95
169 3300007788 Ga0099795_10095744 Ga0099795_100957441 95
170 3300009094 Ga0111539_10005688 Ga0111539_1000568814 95
171 3300009094 Ga0111539_10008191 Ga0111539_1000819116 95
172 3300009094 Ga0111539_10153696 Ga0111539_101536962 95
173 3300009101 Ga0105247_10221378 Ga0105247_102213782 95
174 3300009147 Ga0114129_10014055 Ga0114129_100140557 95
175 3300009147 Ga0114129_10040737 Ga0114129_100407377 95
176 3300009147 Ga0114129_10086683 Ga0114129_100866833 95
177 3300009147 Ga0114129_10124013 Ga0114129_101240134 95
178 3300009177 Ga0105248_11787568 Ga0105248_117875682 95
179 3300009553 Ga0105249_10127623 Ga0105249_101276233 95
180 3300009553 Ga0105249_12006880 Ga0105249_120068802 95
181 3300009553 Ga0105249_12040816 Ga0105249_120408162 95
182 3300011119 Ga0105246_10446432 Ga0105246_104464322 95
183 3300012502 Ga0157347_1028308 Ga0157347_10283082 95
184 3300013104 Ga0157370_10087172 Ga0157370_100871723 95
185 3300013308 Ga0157375_13022786 Ga0157375_130227861 95
186 3300014968 Ga0157379_11512848 Ga0157379_115128482 95
187 3300014969 Ga0157376_10120867 Ga0157376_101208674 95
188 3300015262 Ga0182007_10300762 Ga0182007_103007621 95
189 3300017792 Ga0163161_11149479 Ga0163161_111494791 95
190 3300021377 Ga0213874_10463601 Ga0213874_104636012 95
191 3300025900 Ga0207710_10372138 Ga0207710_103721381 95
192 3300025905 Ga0207685_10695852 Ga0207685_106958521 95
193 3300025910 Ga0207684_10001023 Ga0207684_1000102327 95
194 3300025910 Ga0207684_10500048 Ga0207684_105000482 95
195 3300025912 Ga0207707_10019422 Ga0207707_100194223 95
196 3300025913 Ga0207695_10490894 Ga0207695_104908942 95
197 3300025921 Ga0207652_10117503 Ga0207652_101175032 95
198 3300025921 Ga0207652_10540687 Ga0207652_105406872 95
199 3300025922 Ga0207646_10001026 Ga0207646_1000102618 95
200 3300025922 Ga0207646_10816937 Ga0207646_108169371 95
201 3300025923 Ga0207681_10741265 Ga0207681_107412652 95
202 3300025929 Ga0207664_10354318 Ga0207664_103543182 95
203 3300025932 Ga0207690_11277476 Ga0207690_112774761 95
204 3300025942 Ga0207689_10294469 Ga0207689_102944691 95
205 3300025944 Ga0207661_10108100 Ga0207661_101081003 95
206 3300025945 Ga0207679_11432242 Ga0207679_114322422 95
207 3300025972 Ga0207668_10332895 Ga0207668_103328951 95
208 3300026035 Ga0207703_10378586 Ga0207703_103785864 95
209 3300026041 Ga0207639_10338057 Ga0207639_103380571 95
210 3300026075 Ga0207708_10484453 Ga0207708_104844532 95
211 3300026075 Ga0207708_11069153 Ga0207708_110691532 95
212 3300026078 Ga0207702_10891572 Ga0207702_108915722 95
213 3300026088 Ga0207641_10323835 Ga0207641_103238352 95
214 3300026089 Ga0207648_11794834 Ga0207648_117948342 95
215 3300026095 Ga0207676_10045896 Ga0207676_100458964 95
216 3300026118 Ga0207675_100384055 Ga0207675_1003840552 95
217 3300026118 Ga0207675_100639911 Ga0207675_1006399112 95
218 3300026118 Ga0207675_102745575 Ga0207675_1027455752 95
219 3300027364 Ga0209967_1001797 Ga0209967_10017974 95
220 3300027378 Ga0209981_1001144 Ga0209981_10011445 95
221 3300027462 Ga0210000_1000566 Ga0210000_10005662 95
222 3300027471 Ga0209995_1046683 Ga0209995_10466832 95
223 3300027543 Ga0209999_1003874 Ga0209999_10038743 95
224 3300027543 Ga0209999_1020892 Ga0209999_10208922 95
225 3300027671 Ga0209588_1029194 Ga0209588_10291944 95
226 3300027671 Ga0209588_1072806 Ga0209588_10728062 95
227 3300027907 Ga0207428_10005247 Ga0207428_100052472 95
228 3300027907 Ga0207428_10117904 Ga0207428_101179044 95
229 3300028380 Ga0268265_11102617 Ga0268265_111026172 95
230 3300028381 Ga0268264_10748028 Ga0268264_107480282 95
231 3300028381 Ga0268264_11097789 Ga0268264_110977892 95
232 3300031548 Ga0307408_100254299 Ga0307408_1002542992 95
233 3300031548 Ga0307408_100645333 Ga0307408_1006453332 95
234 3300031731 Ga0307405_10419148 Ga0307405_104191482 95
235 3300031824 Ga0307413_11731137 Ga0307413_117311372 95
236 3300032002 Ga0307416_100793545 Ga0307416_1007935452 95
237 3300032002 Ga0307416_101106388 Ga0307416_1011063882 95
238 3300032005 Ga0307411_10188441 Ga0307411_101884414 95
239 3300034816 Ga0373930_0168549 Ga0373930_0168549_239_526 95
240 3300034817 Ga0373948_0034474 Ga0373948_0034474_372_659 95
241 3300034818 Ga0373950_0028791 Ga0373950_0028791_697_984 95
242 3300034820 Ga0373959_0012474 Ga0373959_0012474_346_633 95
243 3300034957 Ga0373938_0008507 Ga0373938_0008507_159_446 95
244 3300034957 Ga0373938_0019701 Ga0373938_0019701_632_919 95
245 3300035083 Ga0373926_0000737 Ga0373926_0000737_1626_1913 95
246 3300035084 Ga0373928_0003968 Ga0373928_0003968_16_303 95
247 3300035084 Ga0373928_0078608 Ga0373928_0078608_125_412 95
248 3300035084 Ga0373928_0141803 Ga0373928_0141803_123_410 95
249 3300035085 Ga0373929_0031199 Ga0373929_0031199_76_363 95
250 3300035085 Ga0373929_0069858 Ga0373929_0069858_144_431 95
251 3300035085 Ga0373929_0071546 Ga0373929_0071546_356_643 95
252 3300035086 Ga0373934_0406575 Ga0373934_0406575_258_545 95
253 3300035088 Ga0373940_0178825 Ga0373940_0178825_341_628 95
254 3300035090 Ga0373949_0014336 Ga0373949_0014336_1078_1365 95
255 3300035091 Ga0373951_0055439 Ga0373951_0055439_302_589 95
256 3300035092 Ga0373952_0033218 Ga0373952_0033218_658_945 95
257 3300035112 Ga0373932_0063489 Ga0373932_0063489_727_1014 95
258 3300035112 Ga0373932_0265685 Ga0373932_0265685_264_551 95
259 3300035114 Ga0373939_0064895 Ga0373939_0064895_664_951 95
260 3300035114 Ga0373939_0351029 Ga0373939_0351029_137_424 95
261 3300035115 Ga0373941_0002898 Ga0373941_0002898_1695_1982 95
262 3300035115 Ga0373941_0464151 Ga0373941_0464151_216_503 95
263 3300035116 Ga0373945_0013898 Ga0373945_0013898_347_634 95
264 3300035118 Ga0373954_0000011 Ga0373954_0000011_4086_4373 95
265 3300035121 Ga0373960_0008726 Ga0373960_0008726_1284_1571 95
266 3300035170 Ga0373943_0015118 Ga0373943_0015118_2013_2300 95
267 3300035171 Ga0373946_0015861 Ga0373946_0015861_71_358 95
268 3300035171 Ga0373946_0240967 Ga0373946_0240967_390_677 95
269 3300035207 Ga0373942_0051577 Ga0373942_0051577_585_872 95
270 3300035241 Ga0373961_0121032 Ga0373961_0121032_88_375 95
271 3300035410 Ga0373924_0026494 Ga0373924_0026494_1699_1986 95
272 3300035691 Ga0373931_0001269 Ga0373931_0001269_2100_2387 95
273 3300035691 Ga0373931_0026318 Ga0373931_0026318_924_1211 95
274 3300035691 Ga0373931_0191776 Ga0373931_0191776_29_316 95
275 3300035692 Ga0373935_0013997 Ga0373935_0013997_3120_3407 95
276 3300035695 Ga0373927_0018778 Ga0373927_0018778_228_515 95
277 3300035724 Ga0373933_0009633 Ga0373933_0009633_4030_4317 95
278 3300035725 Ga0373947_0023636 Ga0373947_0023636_187_474 95
279 3300036401 Ga0373937_0049684 Ga0373937_0049684_2247_2534 95
280 3300037068 Ga0373925_0002777 Ga0373925_0002777_250_537 95
281 3300037068 Ga0373925_1129458 Ga0373925_1129458_167_454 95
282 3300039450 Ga0436363_0778074 Ga0436363_0778074_35_322 95
283 3300041509 Ga0451843_0350432 Ga0451843_0350432_143_442 95
284 3300042015 Ga0439462_0056771 Ga0439462_0056771_322_609 95
285 3300042156 Ga0439446_0098563 Ga0439446_0098563_428_715 95
286 3300042157 Ga0439458_0194990 Ga0439458_0194990_254_541 95
287 3300042461 Ga0439460_0185517 Ga0439460_0185517_181_468 95
288 3300042876 Ga0451577_0011400 Ga0451577_0011400_192_482 95
289 3300042876 Ga0451577_0344510 Ga0451577_0344510_65_352 95
290 3300042876 Ga0451577_1446928 Ga0451577_1446928_61_348 95
291 3300042993 Ga0439440_0096436 Ga0439440_0096436_479_766 95
292 3300044673 Ga0453683_0081301 Ga0453683_0081301_1376_1666 95
293 3300044712 Ga0453684_0084097 Ga0453684_0084097_3082_3372 95
294 3300044901 Ga0466960_0284099 Ga0466960_0284099_586_876 95
295 3300045051 Ga0451576_0014343 Ga0451576_0014343_4202_4489 95
296 3300045051 Ga0451576_0020291 Ga0451576_0020291_347_634 95
297 3300045051 Ga0451576_0024266 Ga0451576_0024266_5006_5293 95
298 3300045051 Ga0451576_0590291 Ga0451576_0590291_328_618 95
299 3300046455 Ga0495603_0010469 Ga0495603_0010469_180_467 95
300 3300046472 Ga0495580_0002125 Ga0495580_0002125_7973_8260 95
301 3300046473 Ga0495582_0098852 Ga0495582_0098852_598_885 95
302 3300046475 Ga0495639_0416148 Ga0495639_0416148_54_341 95
303 3300046499 Ga0495594_0520243 Ga0495594_0520243_320_607 95
304 3300046517 Ga0495630_0493178 Ga0495630_0493178_549_836 95
305 3300046526 Ga0495666_0270661 Ga0495666_0270661_186_473 95
306 3300046531 Ga0495665_0065213 Ga0495665_0065213_25_312 95
307 3300046535 Ga0495586_0002995 Ga0495586_0002995_3564_3851 95
308 3300046535 Ga0495586_0730557 Ga0495586_0730557_198_485 95
309 3300046557 Ga0495622_0267611 Ga0495622_0267611_337_624 95
310 3300046675 Ga0495657_0114704 Ga0495657_0114704_1080_1367 95
311 3300046681 Ga0495647_0274133 Ga0495647_0274133_129_416 95
312 3300046683 Ga0495658_0028196 Ga0495658_0028196_2362_2649 95
313 3300047321 Ga0495676_0506925 Ga0495676_0506925_299_586 95
314 3300048917 Ga0496114_1479844 Ga0496114_1479844_30_317 95
315 3300049514 Ga0501291_083903 Ga0501291_083903_310_597 95
316 3300049568 Ga0501031_0158892 Ga0501031_0158892_1139_1426 95
317 3300049568 Ga0501031_0442507 Ga0501031_0442507_119_406 95
318 3300049570 Ga0501033_0003914 Ga0501033_0003914_8325_8612 95
319 3300049570 Ga0501033_0410471 Ga0501033_0410471_555_842 95
320 3300049572 Ga0501036_0017428 Ga0501036_0017428_81_368 95
321 3300049572 Ga0501036_0045842 Ga0501036_0045842_3278_3565 95
322 3300049572 Ga0501036_0852349 Ga0501036_0852349_255_542 95
323 3300049573 Ga0501037_0211206 Ga0501037_0211206_1066_1353 95
324 3300049573 Ga0501037_0578184 Ga0501037_0578184_262_549 95
325 3300049574 Ga0501038_0044308 Ga0501038_0044308_2209_2496 95
326 3300049574 Ga0501038_0110895 Ga0501038_0110895_165_452 95
327 3300049575 Ga0501039_0002169 Ga0501039_0002169_1250_1537 95
328 3300049575 Ga0501039_0018345 Ga0501039_0018345_2656_2943 95
329 3300049575 Ga0501039_0388777 Ga0501039_0388777_326_613 95
330 3300049576 Ga0501040_0024532 Ga0501040_0024532_1529_1816 95
331 3300049576 Ga0501040_0048884 Ga0501040_0048884_208_495 95
332 3300049576 Ga0501040_0377247 Ga0501040_0377247_368_655 95
333 3300049576 Ga0501040_0480719 Ga0501040_0480719_345_632 95
334 3300049577 Ga0501041_0000170 Ga0501041_0000170_27890_28177 95
335 3300049577 Ga0501041_0010053 Ga0501041_0010053_4249_4536 95
336 3300049578 Ga0501042_0063500 Ga0501042_0063500_2264_2551 95
337 3300049578 Ga0501042_0382948 Ga0501042_0382948_412_699 95
338 3300049578 Ga0501042_1044596 Ga0501042_1044596_73_360 95
339 3300049578 Ga0501042_1455135 Ga0501042_1455135_141_428 95
340 3300049579 Ga0501043_0035446 Ga0501043_0035446_1471_1758 95
341 3300049579 Ga0501043_0152407 Ga0501043_0152407_142_429 95
342 3300049580 Ga0501046_0000480 Ga0501046_0000480_22976_23263 95
343 3300049580 Ga0501046_0467052 Ga0501046_0467052_529_816 95
344 3300049581 Ga0501047_0614668 Ga0501047_0614668_418_705 95
345 3300049582 Ga0501048_0000896 Ga0501048_0000896_2258_2545 95
346 3300049582 Ga0501048_0080997 Ga0501048_0080997_805_1092 95
347 3300049582 Ga0501048_0110793 Ga0501048_0110793_1007_1294 95
348 3300049583 Ga0501067_0130723 Ga0501067_0130723_1017_1304 95
349 3300049584 Ga0501068_0111773 Ga0501068_0111773_798_1085 95
350 3300049586 Ga0501070_0122187 Ga0501070_0122187_153_440 95
351 3300049587 Ga0501071_0019933 Ga0501071_0019933_899_1186 95
352 3300049587 Ga0501071_0032149 Ga0501071_0032149_3308_3595 95
353 3300049587 Ga0501071_0294744 Ga0501071_0294744_384_671 95
354 3300049588 Ga0501072_0002754 Ga0501072_0002754_2212_2499 95
355 3300049588 Ga0501072_0019871 Ga0501072_0019871_2865_3152 95
356 3300049588 Ga0501072_0203082 Ga0501072_0203082_354_641 95
357 3300049588 Ga0501072_0479570 Ga0501072_0479570_419_706 95
358 3300049590 Ga0501074_0042414 Ga0501074_0042414_738_1025 95
359 3300049591 Ga0501075_0007676 Ga0501075_0007676_4811_5098 95
360 3300049591 Ga0501075_0061253 Ga0501075_0061253_2326_2613 95
361 3300049592 Ga0501076_0000566 Ga0501076_0000566_21208_21495 95
362 3300049592 Ga0501076_0002853 Ga0501076_0002853_5963_6250 95
363 3300049592 Ga0501076_0320675 Ga0501076_0320675_107_394 95
364 3300049592 Ga0501076_0635030 Ga0501076_0635030_510_800 95
365 3300049593 Ga0501077_0051387 Ga0501077_0051387_2257_2544 95
366 3300049593 Ga0501077_0061904 Ga0501077_0061904_409_696 95
367 3300049741 Ga0501079_0001982 Ga0501079_0001982_14278_14565 95
368 3300049741 Ga0501079_0014763 Ga0501079_0014763_2496_2783 95
369 3300049742 Ga0501080_0019198 Ga0501080_0019198_4111_4398 95
370 3300049743 Ga0501081_0014351 Ga0501081_0014351_2498_2785 95
371 3300049743 Ga0501081_0019367 Ga0501081_0019367_2378_2665 95
372 3300049822 Ga0501035_0100919 Ga0501035_0100919_130_417 95
373 3300049822 Ga0501035_0105814 Ga0501035_0105814_1705_1992 95
374 3300049824 Ga0501045_0004353 Ga0501045_0004353_2271_2558 95
375 3300049824 Ga0501045_0018514 Ga0501045_0018514_93_380 95
376 3300049824 Ga0501045_0357999 Ga0501045_0357999_568_855 95
377 3300049824 Ga0501045_1206955 Ga0501045_1206955_219_506 95
378 3300050507 nmdc:mga05p37_10565_c2 nmdc:mga05p37_10565_c2_1407_1700 95
379 3300050507 nmdc:mga05p37_155358_c1 nmdc:mga05p37_155358_c1_612_899 95
380 3300050507 nmdc:mga05p37_26113_c1 nmdc:mga05p37_26113_c1_6322_6615 95
381 3300050507 nmdc:mga05p37_261151_c1 nmdc:mga05p37_261151_c1_223_510 95
382 3300050507 nmdc:mga05p37_618_c1 nmdc:mga05p37_618_c1_37596_37883 95
383 3300050508 nmdc:mga09592_1355095_c1 nmdc:mga09592_1355095_c1_112_399 95
384 3300050508 nmdc:mga09592_25284_c1 nmdc:mga09592_25284_c1_1558_1845 95
385 3300050509 nmdc:mga0qj67_9471_c1 nmdc:mga0qj67_9471_c1_1070_1357 95
386 3300050510 nmdc:mga06r32_1313360_c1 nmdc:mga06r32_1313360_c1_180_467 95
387 3300050510 nmdc:mga06r32_133125_c1 nmdc:mga06r32_133125_c1_112_399 95
388 3300050511 nmdc:mga08y16_1554524_c1 nmdc:mga08y16_1554524_c1_303_596 95
389 3300050511 nmdc:mga08y16_49766_c1 nmdc:mga08y16_49766_c1_1836_2123 95
390 3300050511 nmdc:mga08y16_99491_c1 nmdc:mga08y16_99491_c1_877_1164 95
391 3300050512 nmdc:mga0n895_11483_c1 nmdc:mga0n895_11483_c1_503_796 95
392 3300050512 nmdc:mga0n895_2274_c1 nmdc:mga0n895_2274_c1_13752_14039 95
393 3300050512 nmdc:mga0n895_340012_c1 nmdc:mga0n895_340012_c1_1219_1506 95
394 3300050512 nmdc:mga0n895_3962_c1 nmdc:mga0n895_3962_c1_3965_4252 95
395 3300050512 nmdc:mga0n895_479085_c1 nmdc:mga0n895_479085_c1_859_1146 95
396 3300050513 nmdc:mga0rr50_17115_c1 nmdc:mga0rr50_17115_c1_2481_2768 95
397 3300050513 nmdc:mga0rr50_27253_c1 nmdc:mga0rr50_27253_c1_3577_3870 95
398 3300050513 nmdc:mga0rr50_7242_c1 nmdc:mga0rr50_7242_c1_3901_4188 95
399 3300050513 nmdc:mga0rr50_875866_c1 nmdc:mga0rr50_875866_c1_225_512 95
400 3300050514 nmdc:mga08x19_143073_c1 nmdc:mga08x19_143073_c1_1131_1418 95
401 3300050514 nmdc:mga08x19_35262_c1 nmdc:mga08x19_35262_c1_554_847 95
402 3300050514 nmdc:mga08x19_373_c1 nmdc:mga08x19_373_c1_11807_12094 95
403 3300050514 nmdc:mga08x19_7491_c1 nmdc:mga08x19_7491_c1_3694_3984 95
404 3300050514 nmdc:mga08x19_938104_c1 nmdc:mga08x19_938104_c1_153_443 95
405 3300050515 nmdc:mga0a205_1128084_c1 nmdc:mga0a205_1128084_c1_57_350 95
406 3300050515 nmdc:mga0a205_24242_c1 nmdc:mga0a205_24242_c1_2764_3051 95
407 3300050515 nmdc:mga0a205_259775_c1 nmdc:mga0a205_259775_c1_222_509 95
408 3300050515 nmdc:mga0a205_285077_c1 nmdc:mga0a205_285077_c1_917_1210 95
409 3300050515 nmdc:mga0a205_289060_c1 nmdc:mga0a205_289060_c1_685_972 95
410 3300054114 Ga0501084_0026094 Ga0501084_0026094_1099_1386 95
411 3300060353 Ga0501082_0000431 Ga0501082_0000431_183_470 95
412 3300060353 Ga0501082_0114472 Ga0501082_0114472_1147_1434 95
413 3300060353 Ga0501082_0217855 Ga0501082_0217855_702_989 95
414 3300061734 Ga0530510_0004584 Ga0530510_0004584_6902_7189 95
415 3300061734 Ga0530510_0042497 Ga0530510_0042497_662_949 95
416 3300061734 Ga0530510_0346112 Ga0530510_0346112_42_329 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07045

DUF1330

Domain of unknown function (DUF1330)

7

99

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.9454 2 95
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.9408 2 92
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.9172 2 95
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.8936 2 92
3dca-assembly2.cif.gz_D crystal structure of the rpa0582- protein of unknown function from rhodopseudomonas palustris- a structural genomics target 0.789 2 95
ID Description Score Start End Superfamily
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9376 1 95 3.30.70.100
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9186 1 95 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8711 1 90 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8365 1 90 3.30.70.100
af_Q4DL38_2_104_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.719 1 95 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A6A0HLG8-F1-model_v4 DUF1330 domain-containing protein 0.9899 1 95
AF-A0A7W0LG49-F1-model_v4 DUF1330 domain-containing protein 0.9898 1 95
AF-A0A2E4GYH2-F1-model_v4 D-fructose-6-phosphate amidotransferase 0.989 1 95 GO:0016740
AF-A0A2E4EZ79-F1-model_v4 D-fructose-6-phosphate amidotransferase 0.9886 1 95 GO:0016740
AF-L8JT41-F1-model_v4 DUF1330 domain-containing protein 0.9884 1 95

Feature Viewer

pLDDT pTM Quality
96.54 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map